HHsearch results for GI: 254780305 and protein with PDBid: 3jth_A

>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus}
Probab=95.61  E-value=0.012  Score=33.36  Aligned_cols=57  Identities=16%  Similarity=0.203  Sum_probs=51.1

Q ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCE---EEEE
Q ss_conf             99899999998588988999999982999999999999999941798647986---8981
Q gi|254780305|r   32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK---VSLT   88 (95)
Q Consensus        32 ~~~~~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~---v~l~   88 (95)
                      .++.+.+|+..|...+..+-+|++.+|++.+.|+-.|-.|+=+|.|....-|+   |++.
T Consensus        21 ~~p~Rl~Il~~L~~~~~~v~ela~~l~~s~~tvS~HL~~L~~aglV~~~r~G~~~~Y~l~   80 (98)
T 3jth_A           21 ANERRLQILCMLHNQELSVGELCAKLQLSQSALSQHLAWLRRDGLVTTRKEAQTVYYTLK   80 (98)
T ss_dssp             CSHHHHHHHHHTTTSCEEHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEECCTTCCEEEEC
T ss_pred             CCHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCEEEEEEC
T ss_conf             999999999999729937999999988595678899999998894269987689999988