HHsearch results for GI: 254780305 and protein with PDBid: 3nrv_A

>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP}
Probab=90.73  E-value=0.2  Score=26.76  Aligned_cols=53  Identities=13%  Similarity=0.093  Sum_probs=47.5

Q ss_pred             CCCHHHHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             999899999998588-98899999998299999999999999994179864798
Q gi|254780305|r   31 YTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG   83 (95)
Q Consensus        31 ~~~~~~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg   83 (95)
                      ..+..+-.|+..|+. .++.+-+|++..+++.+.++.++-.|+=+|+|.+.+..
T Consensus        37 glt~~q~~vL~~L~~~~~~t~~~la~~l~i~~~~vsr~l~~L~~~gli~r~~~~   90 (148)
T 3nrv_A           37 GIGMTEWRIISVLSSASDCSVQKISDILGLDKAAVSRTVKKLEEKKYIEVNGHS   90 (148)
T ss_dssp             TCCHHHHHHHHHHHHSSSBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEC----
T ss_pred             CCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCEEECCCC
T ss_conf             989999999999997799799999999896998999999998507936424799