HHSEARCH alignment of GI: 254780305 and SCOP domain: d1z05a1

Alignment
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]}
Probab=92.22  E-value=0.068  Score=28.03  Aligned_cols=45  Identities=16%  Similarity=0.141  Sum_probs=40.1

Q ss_pred             HHHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999998588-9889999999829999999999999999417986
Q gi|254780305|r   35 ERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH   79 (95)
Q Consensus        35 ~~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~   79 (95)
                      .+.+||+.|-. .+++..+|++.+|++.++|..++-+|+=.|+|..
T Consensus         7 N~~~Il~~l~~~g~~sr~eLa~~~glS~~Tv~~~l~~L~~~Glv~e   52 (71)
T d1z05a1           7 NAGRVYKLIDQKGPISRIDLSKESELAPASITKITRELIDAHLIHE   52 (71)
T ss_dssp             HHHHHHHHHHHHCSBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEE
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             9999999999859948999999988788789999999998898797


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: ROK associated domain
domain: Transcriptional regulator VC2007 N-terminal domain
species: Vibrio cholerae [TaxId: 666]