RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780305|ref|YP_003064718.1| hypothetical protein CLIBASIA_00950 [Candidatus Liberibacter asiaticus str. psy62] (95 letters) >2qx2_A Sex pheromone staph-CAM373; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Staphylococcus aureus subsp} (A:1-225) Length = 225 Score = 25.5 bits (56), Expect = 2.9 Identities = 6/16 (37%), Positives = 9/16 (56%) Query: 35 ERVRIKQSLNNVPIHI 50 R+R L ++PIH Sbjct: 175 SRLRENDDLKDIPIHF 190 >2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics, JCSG; 2.46A {Thermotoga maritima} (A:1-85) Length = 85 Score = 24.0 bits (52), Expect = 7.9 Identities = 6/49 (12%), Positives = 15/49 (30%) Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84 RI + + P+ ++ G+ V + G + + Sbjct: 22 ISRILKRIXKSPVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEEKDSP 70 >2p2v_A Alpha-2,3-sialyltransferase; mixed alpha-beta; HET: CSF; 1.85A {Campylobacter jejuni} PDB: 2p56_A (A:) Length = 288 Score = 24.0 bits (52), Expect = 8.0 Identities = 7/40 (17%), Positives = 12/40 (30%) Query: 4 PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL 43 I NF N +I +T + ++K Sbjct: 242 ININNNFTLENKHNNSINDILLTDNTPGVSFYKNQLKADN 281 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.136 0.415 Gapped Lambda K H 0.267 0.0635 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 787,882 Number of extensions: 30710 Number of successful extensions: 59 Number of sequences better than 10.0: 1 Number of HSP's gapped: 59 Number of HSP's successfully gapped: 4 Length of query: 95 Length of database: 4,956,049 Length adjustment: 55 Effective length of query: 40 Effective length of database: 3,096,774 Effective search space: 123870960 Effective search space used: 123870960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.2 bits)