RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780305|ref|YP_003064718.1| hypothetical protein CLIBASIA_00950 [Candidatus Liberibacter asiaticus str. psy62] (95 letters) >3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} Length = 382 Score = 55.7 bits (134), Expect = 2e-09 Identities = 26/54 (48%), Positives = 33/54 (61%) Query: 35 ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88 +R RI L P+ IDD+I +GI VV +LLEL+LAGRL H VSL+ Sbjct: 329 DRTRILALLGPSPVGIDDLIRLSGISPAVVRTILLELELAGRLERHGGSLVSLS 382 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 29.2 bits (64), Expect = 0.24 Identities = 11/54 (20%), Positives = 17/54 (31%), Gaps = 30/54 (55%) Query: 40 KQSLN----NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89 KQ+L ++ ++ DD AP LA + TM Sbjct: 19 KQALKKLQASLKLYADD-------SAPA---------LA----------IKATM 46 >2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 648 Score = 26.1 bits (57), Expect = 2.1 Identities = 4/37 (10%), Positives = 11/37 (29%), Gaps = 2/37 (5%) Query: 26 THYPEYTQCERVRIKQ--SLNNVPIHIDDIIHHTGIE 60 +H Y + +N+ + ++ G Sbjct: 243 SHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFT 279 >1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 2aly_A* 2akw_A* 2amc_A* Length = 350 Score = 25.8 bits (56), Expect = 2.2 Identities = 4/31 (12%), Positives = 12/31 (38%) Query: 19 HTKNINITHYPEYTQCERVRIKQSLNNVPIH 49 + + TH + Q E + + + + + Sbjct: 204 RFEQTDATHEAVFHQLEGLVVGEGIAMAHLK 234 >2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 685 Score = 25.7 bits (56), Expect = 2.7 Identities = 4/37 (10%), Positives = 11/37 (29%), Gaps = 2/37 (5%) Query: 26 THYPEYTQCERVRIKQ--SLNNVPIHIDDIIHHTGIE 60 +H Y + +N+ + ++ G Sbjct: 243 SHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFT 279 >2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 665 Score = 25.7 bits (56), Expect = 2.8 Identities = 4/37 (10%), Positives = 11/37 (29%), Gaps = 2/37 (5%) Query: 26 THYPEYTQCERVRIKQ--SLNNVPIHIDDIIHHTGIE 60 +H Y + +N+ + ++ G Sbjct: 243 SHLMTYHSASCAIAGEGVDINDGKAIAEGLLSQFGFT 279 >2qx2_A Sex pheromone staph-CAM373; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Staphylococcus aureus subsp} Length = 344 Score = 25.5 bits (56), Expect = 3.2 Identities = 6/16 (37%), Positives = 9/16 (56%) Query: 35 ERVRIKQSLNNVPIHI 50 R+R L ++PIH Sbjct: 175 SRLRENDDLKDIPIHF 190 >3n2q_A Sex pheromone staph-CAM373; structural genomics, MCSG, PSI-2, protein structure initiati midwest center for structural genomics; 2.55A {Bacillus cereus} Length = 287 Score = 25.3 bits (55), Expect = 3.8 Identities = 4/16 (25%), Positives = 5/16 (31%) Query: 35 ERVRIKQSLNNVPIHI 50 E + N PI Sbjct: 119 EAINKNDKYNKSPITF 134 >2r7r_A RNA-dependent RNA polymerase; viral protein, RNA-dependent RNA polymerase, single subunit polymerase fold, fingers, PALM, thumb; 2.60A {Simian rotavirus} PDB: 2r7q_A 2r7s_A 2r7t_A 2r7u_A 2r7v_A 2r7w_A* 2r7x_A* 2r7o_A Length = 1095 Score = 25.0 bits (54), Expect = 4.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Query: 14 QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHID 51 Q T +T+N++ Y EYT R + + L H D Sbjct: 346 QLKTEYTENVDDEMYREYTMLIRDEVVKMLEEPVKHDD 383 >3lu0_D DNA-directed RNA polymerase subunit beta'; E. coli RNA polymerase, nucleotidyltransferase, transcription, transferase; 11.20A {Escherichia coli} PDB: 3iyd_D* Length = 1407 Score = 23.9 bits (51), Expect = 8.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 35 ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67 ERV +++ P DI+ G+ A Y+V Sbjct: 1202 ERVERGDVISDGPEAPHDILRLRGVHAVTRYIV 1234 >2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 701 Score = 23.8 bits (51), Expect = 8.7 Identities = 2/19 (10%), Positives = 6/19 (31%) Query: 26 THYPEYTQCERVRIKQSLN 44 +H Y + ++ Sbjct: 243 SHLMTYHSASCAIAGEGVD 261 >3iyd_D DNA-directed RNA polymerase subunit beta; transcription, initiation, class I, activator, RNA polymerase, holoenzyme, sigma70, open complex, CAP, CRP, CAMP-dependent; HET: DNA CMP; 19.80A {Escherichia coli k-12} Length = 1413 Score = 24.0 bits (51), Expect = 8.7 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 35 ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67 ERV +++ P DI+ G+ A Y+V Sbjct: 1202 ERVERGDVISDGPEAPHDILRLRGVHAVTRYIV 1234 >1zrh_A Heparan sulfate glucosamine 3-O-sulfotransferase 1, heparan sulfate D-; SGC, sulfotransferase HS3ST1, structural genomics; HET: A3P; 2.10A {Homo sapiens} PDB: 1vkj_A* Length = 274 Score = 23.7 bits (50), Expect = 9.3 Identities = 8/83 (9%), Positives = 24/83 (28%), Gaps = 5/83 (6%) Query: 3 HPQI-----EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHT 57 HP + E +FF + +H ++ P + K + + ++ Sbjct: 44 HPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSM 103 Query: 58 GIEAPVVYLVLLELDLAGRLCHH 80 ++ ++ + Sbjct: 104 NPSIRLLLILRDPSERVLSDYTQ 126 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.320 0.136 0.415 Gapped Lambda K H 0.267 0.0597 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 861,302 Number of extensions: 33549 Number of successful extensions: 79 Number of sequences better than 10.0: 1 Number of HSP's gapped: 79 Number of HSP's successfully gapped: 17 Length of query: 95 Length of database: 5,693,230 Length adjustment: 61 Effective length of query: 34 Effective length of database: 4,214,346 Effective search space: 143287764 Effective search space used: 143287764 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.3 bits)