RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780305|ref|YP_003064718.1| hypothetical protein CLIBASIA_00950 [Candidatus Liberibacter asiaticus str. psy62] (95 letters) >d1smyd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]} Length = 1504 Score = 23.6 bits (50), Expect = 4.7 Identities = 10/33 (30%), Positives = 13/33 (39%) Query: 35 ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67 + V Q L I ++ G EA YLV Sbjct: 1316 DYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLV 1348 >d1gwma_ b.18.1.19 (A:) Non-catalytic protein 1, Ncp1 {Piromyces equi [TaxId: 99929]} Length = 153 Score = 22.7 bits (48), Expect = 8.6 Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 44 NNVPIHIDDIIHHTG 58 N I I +++H TG Sbjct: 121 NGDRIWIKNLVHSTG 135 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.320 0.136 0.415 Gapped Lambda K H 0.267 0.0636 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 374,779 Number of extensions: 15021 Number of successful extensions: 22 Number of sequences better than 10.0: 1 Number of HSP's gapped: 22 Number of HSP's successfully gapped: 5 Length of query: 95 Length of database: 2,407,596 Length adjustment: 58 Effective length of query: 37 Effective length of database: 1,611,256 Effective search space: 59616472 Effective search space used: 59616472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.1 bits)