>pfam01751 Toprim Toprim domain. This is a conserved region from DNA primase. This corresponds to the Toprim domain common to DnaG primases, topoisomerases, OLD family nucleases and RecR proteins. Both DnaG motifs IV and V are present in the alignment, the DxD (V) motif may be involved in Mg2+ binding and mutations to the conserved glutamate (IV) completely abolish DnaG type primase activity. DNA primase EC:2.7.7.6 is a nucleotidyltransferase it synthesizes the oligoribonucleotide primers required for DNA replication on the lagging strand of the replication fork; it can also prime the leading stand and has been implicated in cell division. This family also includes the atypical archaeal A subunit from type II DNA topoisomerases. Type II DNA topoisomerases catalyse the relaxation of DNA supercoiling by causing transient double strand breaks.

Probab=99.50 E-value=2e-13 Score=119.90 Aligned_cols=89 Identities=37% Similarity=0.630 Sum_probs=76.4 Q ss_pred CCEEEECCHHHHHHHHHHHCCCCEEEEEECCCEECCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHCCEEEECCC Q ss_conf 91899779047877887508998999942511007865578676667440688776548999999999870998999469 Q gi|254780306|r 1 MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATD 80 (837) Q Consensus 1 M~LvIvEsP~kak~I~~~Lg~~y~V~as~GHirdLp~~~~~v~~~~~f~p~y~v~~~~kk~~~~i~~~~k~a~~iilAtD 80 (837) T Consensus 1 ~~l~IVE~~~d~~~i~~~~~~~~~~~~~~G~~~~l~-------------------~~~~~~~~~l~~~~~~~-eViiatD 60 (89) T pfam01751 1 KVLIIVEGPSDAIALAKAGGYKGNVVALLGHLSDVI-------------------PLTKEQLKLLKKLAKKD-EVILATD 60 (89) T ss_pred CEEEEECCHHHHHHHHHHCCCCEEEEEEECEECCCC-------------------CCCHHHHHHHHHHHCCC-EEEEECC T ss_conf 989998988999999962488879998415705765-------------------54246799999862377-4999879 Q ss_pred CCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEE Q ss_conf 970257999999999755125788716999980 Q gi|254780306|r 81 PDREGEAISWHVLDVLRQKNLIEKTKIQRVSFN 113 (837) Q Consensus 81 ~DREGE~Iawhi~e~l~~~~~~~~~~v~R~~f~ 113 (837) T Consensus 61 ~D~eGe~~a~~l~~~l~~~~----~~v~ri~~~ 89 (89) T pfam01751 61 PDREGEAIAWKLLELLKPLG----KKVRRIFLP 89 (89) T ss_pred CCHHHHHHHHHHHHHHHHCC----CCEEEEECC T ss_conf 89489999999999831229----816999669

HHsearch alignment for GI: 254780306 and conserved domain: pfam01751