>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are eukaryotic MDHs localized to the cytoplasm and cytosol. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

Probab=96.28 E-value=0.021 Score=33.90 Aligned_cols=72 Identities=17% Similarity=0.277 Sum_probs=43.1 Q ss_pred CEEEEEECCCCHHHHHHHHHHHHCC----CCEEEEEEEECCCCC----CEEEECCC------CEEEEEECCHHHHCCCCE Q ss_conf 6179998166778999999997449----980789999747658----75600278------158998779436318847 Q gi|254780307|r 2 TFKVAVVGATGNVGREMLNIICERG----FPISEVVALASERSA----GTKVPFGK------ETIDVQDVKSYDFSDTDI 67 (335) Q Consensus 2 ~~kvaIiGatG~vG~el~~lL~~~~----~p~~~l~~~~s~~~~----G~~i~~~~------~~~~~~~~~~~~~~~~Di 67 (335) T Consensus 2 p~kV~VtGAaG~Ig~~l~~~la~g~~~g~~~~i~L~L~Di~~~~~~l~Gv~mel~d~a~p~l~~i~~~~~~~~a~~~aDv 81 (325) T cd01336 2 PIRVLVTGAAGQIAYSLLPMIAKGDVFGPDQPVILHLLDIPPALKALEGVVMELQDCAFPLLKSVVATTDPEEAFKDVDV 81 (325) T ss_pred CEEEEEECCCHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCCCCCEEEEEHHHCCCCCCCCEEECCCHHHHHCCCCE T ss_conf 81999988871889999999975885689970599996677867765526745743786455873522887898368878 Q ss_pred EEECCC Q ss_conf 860687 Q gi|254780307|r 68 CLMSAG 73 (335) Q Consensus 68 vf~a~p 73 (335) T Consensus 82 vii~ag 87 (325) T cd01336 82 AILVGA 87 (325) T ss_pred EEEECC T ss_conf 999488

HHsearch alignment for GI: 254780307 and conserved domain: cd01336