>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are bacterial MDHs, and plant MDHs localized to the choloroplasts. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

Probab=97.13 E-value=0.0032 Score=38.81 Aligned_cols=71 Identities=24% Similarity=0.315 Sum_probs=41.5 Q ss_pred CEEEEEECCCCHHHHHHHHHHHHCC----CCEEEEEEEECCCC----CCEEEECC------CCEEEEEECCHHHHCCCCE Q ss_conf 6179998166778999999997449----98078999974765----87560027------8158998779436318847 Q gi|254780307|r 2 TFKVAVVGATGNVGREMLNIICERG----FPISEVVALASERS----AGTKVPFG------KETIDVQDVKSYDFSDTDI 67 (335) Q Consensus 2 ~~kvaIiGatG~vG~el~~lL~~~~----~p~~~l~~~~s~~~----~G~~i~~~------~~~~~~~~~~~~~~~~~Di 67 (335) T Consensus 2 p~KV~IiGAaG~IG~~la~~la~g~l~g~~~~v~l~L~Di~~~~~~l~G~amDl~~~a~~~~~~v~~~~~~~~a~~~aDv 81 (322) T cd01338 2 PVRVAVTGAAGQIGYSLLFRIASGEMFGPDQPVILQLLELPQALKALEGVAMELEDCAFPLLAEIVITDDPNVAFKDADW 81 (322) T ss_pred CEEEEEECCCCHHHHHHHHHHHHCHHCCCCCEEEEEEECCCCCCCCCCEEEEEHHHCCCCCCCCEEEECCHHHHHCCCCE T ss_conf 70999989996899999999971113079972699997575756667657744532676545877974887898378878 Q ss_pred EEECC Q ss_conf 86068 Q gi|254780307|r 68 CLMSA 72 (335) Q Consensus 68 vf~a~ 72 (335) T Consensus 82 Vvita 86 (322) T cd01338 82 ALLVG 86 (322) T ss_pred EEEEC T ss_conf 99936

HHsearch alignment for GI: 254780307 and conserved domain: cd01338