HHsearch alignment for GI: 254780308 and conserved domain: COG0741

>COG0741 MltE Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell envelope biogenesis, outer membrane].
Probab=97.18  E-value=0.00083  Score=43.68  Aligned_cols=81  Identities=23%  Similarity=0.409  Sum_probs=64.6

Q ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCHHCCCCCC
Q ss_conf             34699999998389988944523100221010256418999987532753156654789999998643877700036752
Q gi|254780308|r  114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF  193 (288)
Q Consensus       114 ~~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d~RR~~ff~~el~a~l~~~~~g~~~~~~~GS~a  193 (288)
T Consensus       139 ~~~~~~~~~~~~~v~~~~v~ai~~~ES~~~~~------------------------------------------a~-s~~  175 (296)
T COG0741         139 YQPLILSAARQYGVDPDLVYAIIRQESAFNPA------------------------------------------AV-SRA  175 (296)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCC------------------------------------------CC-CCC
T ss_conf             26889987876499899999999988614630------------------------------------------10-235


Q ss_pred             CCCCCCCCCHHHHHHCCCCCCCC-CCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             35786665522444215367899-9878878988899999999997
Q gi|254780308|r  194 GEIGQFQFLPVNVVKYAIDADED-GKIDLVKSNIDAIASAAKFLAK  238 (288)
Q Consensus       194 Ga~G~~QFmPs~~~~yavD~dgd-G~~dl~~~~~Da~aS~AnyL~~  238 (288)
T Consensus       176 ga~glmQ~~~~ta~~~~~~~~~~~~~~~l~-dp~~Ni~~G~~yL~~  220 (296)
T COG0741         176 GALGLMQGMPATARRLAYRLGLGKSAADLF-DPAQNIKYGAAYLKS  220 (296)
T ss_pred             CCCHHCCCCHHHHHHHHHHCCCCCCHHHHH-CHHHHHHHHHHHHHH
T ss_conf             531001278798999887026663166652-887789988999999