HHsearch alignment for GI: 254780308 and conserved domain: PRK10859

>PRK10859 putative transglycosylase; Provisional.
Probab=97.82  E-value=0.0019  Score=41.56  Aligned_cols=102  Identities=15%  Similarity=0.153  Sum_probs=66.9

Q ss_pred             HHHHHHHHHHCCCCCHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             89999998643877700036752357866655224442153678999878878988899999999997298885897645
Q gi|254780308|r  171 QFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG  250 (288)
Q Consensus       171 el~a~l~~~~~g~~~~~~~GS~aGa~G~~QFmPs~~~~yavD~dgdG~~dl~~~~~Da~aS~AnyL~~~GW~~g~~~~~~  250 (288)
T Consensus       305 rLLAA~~-YQEShwdp~A~-S~tGvrGlMmLt~~TA~~lGV~-------nr~-DPeqsI~gGarYL~~l~~r~pd~i~e~  374 (507)
T PRK10859        305 RLLAAIA-YQESHWDPQAT-SPTGVRGLMMLTKNTAQSLGIT-------DRT-DAEQSISGGARYLQDMMSKVPETVPED  374 (507)
T ss_pred             HHHHHHH-HHHHCCCCCCC-CCCCCHHHHHHHHHHHHHCCCC-------CCC-CHHHHHHHHHHHHHHHHHHCCCCCCHH
T ss_conf             9999999-88733898782-7631003777358789866998-------878-978889999999999997577568908


Q ss_pred             CHHHHHHHHHHCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             34589999852628999999999999689988
Q gi|254780308|r  251 EKNFAILKHWNASLNYNKTIAYIAAHIDGVPI  282 (288)
Q Consensus       251 ~~n~~~~~~~n~s~~y~~~v~~~a~~~~g~p~  282 (288)
T Consensus       375 dR~wFaLAAYN~G~GHv~DAr~La~~~G~nP~  406 (507)
T PRK10859        375 ERIWFALAAYNMGYAHMLDARALTAKQKGNPD  406 (507)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCC
T ss_conf             88999999873767789999999998088996