HHsearch alignment for GI: 254780308 and conserved domain: TIGR02282

>TIGR02282 MltB lytic murein transglycosylase B; InterPro: IPR011757 This family consists of lytic murein transglycosylases (murein hydrolases) related to MltB (P41052 from SWISSPROT), which is a 38 kDa membrane-bound lipoprotein in Escherichia coli. The N-terminal region of this protein contains a lipoprotein-processing site which is conserved in about half the members of this family. Proteolytic cleavage of MltB produces a fully-active, soluble form of this enzyme known as Slt35 (for soluble lytic transglycosylase). This enzyme catalyzes the cleavage of the glycosidic bonds between N-acetylmuramic acid and N-acetylglucosamine residues in peptidoglycan. Its physiological role is unknown as deletion of the gene shows no obvious phenotype , though it has been suggested to play a role in recycling of muropeptides during cell elongation and/or cell division. The Slt35 enzyme is a monomer with an ellipsoid shape and is composed of three distinct domains known as the alpha, beta and core domains , . The alpha domain contains mainly alpha-helices, while the beta domain consists of a five-stranded antiparallel beta-sheet flanked by a short alpha-helix. The core domain is sandwiched between the alpha and beta domains and its fold is similar to that of lysozyme, but contains a single metal ion binding site in a helix-loop-helix module that is similar to the eukaryotic EF-hand calcium-binding fold, though in this case the loop is slightly longer than usual. Binding of Ca(2+) to this EF hand motif has been shown to be important for thermal stability of the protein . The substrate binding sites are found in the cleft formed by the core domain of the enzyme . Members of this family do not contain the putative peptidoglycan binding domain described by IPR002477 from INTERPRO, which is associated with several other classes of bacterial cell wall lytic enzymes..
Probab=100.00  E-value=0  Score=562.91  Aligned_cols=229  Identities=29%  Similarity=0.476  Sum_probs=214.9

Q ss_pred             HHHHHHHHCCCCHHHHHHHHCCCCCCHHHHHHCCCCCCCCC----CC-------HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999998399989999986087777023332025666677----79-------89998764001357999998532346
Q gi|254780308|r   48 AARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP----VS-------FKDYLDGLSSSEIIAQGIALKKANSR  116 (288)
Q Consensus        48 ~l~~~A~~~Gis~~tl~~~f~~~~~~~~VI~~dr~Qp~ef~----~t-------~~~Y~~~~vs~~Ri~~Gr~~~~~~~~  116 (288)
T Consensus         3 FI~~~va~~~F~~~~l~A~L~~a~~~~~v~~~i~~P~-~~~~~iWkpPsGPnGaW~~YR~~Fi~~kRi~~G~~Fw~~~~~   81 (323)
T TIGR02282         3 FIDELVAKHGFDRAQLEAVLAQAKYKDEVIRLIARPA-ESAKKIWKPPSGPNGAWDEYRAIFITPKRIDDGVKFWKKHED   81 (323)
T ss_pred             HHHHHHHHCCCCHHHHHHHHHHCCCCHHHHHHHCCCC-CCCEEEECCCCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             5788997508998999999983023378999731889-861367608757864525440034663557765999999999


Q ss_pred             HHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCC-CC------------HHHHHHHHHHHHHHHHHCCC
Q ss_conf             999999983899889445231002210102564189999875327-53------------15665478999999864387
Q gi|254780308|r  117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CR------------RAKFFTEQFFYALDLVKKGV  183 (288)
Q Consensus       117 ~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d-~R------------R~~ff~~el~a~l~~~~~g~  183 (288)
T Consensus        82 aL~rAe~~yGVPp~vIVaIiGVET~YG~~~G~yRvlDAL~TLaF~YP~~GdPaklp~~~eRa~fFR~EL~~F~lL~~e~~  161 (323)
T TIGR02282        82 ALERAEREYGVPPEVIVAIIGVETNYGRNTGKYRVLDALTTLAFDYPRSGDPAKLPRKEERATFFRGELGQFLLLAKEEQ  161 (323)
T ss_pred             HHHHHHHHHCCCCEEEEEECCEECCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999985088800265411200101345687414444543135787786733467521477887899999999987427


Q ss_pred             CCHHC-CCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC-CCCCCCCC-------------
Q ss_conf             77000-3675235786665522444215367899987887898889999999999729-88858976-------------
Q gi|254780308|r  184 ISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG-WTKCAGYQ-------------  248 (288)
Q Consensus       184 ~~~~~-~GS~aGa~G~~QFmPs~~~~yavD~dgdG~~dl~~~~~Da~aS~AnyL~~~G-W~~g~~~~-------------  248 (288)
T Consensus       162 lD~~~lkGSYAGAmG~pQFMPSSYR~YAVDfD~dG~iDL~ns~~DAIgSvANyl~~HGGW~~~~~V~~~~~~~~d~~~d~  241 (323)
T TIGR02282       162 LDPLTLKGSYAGAMGIPQFMPSSYRQYAVDFDGDGHIDLFNSVDDAIGSVANYLQAHGGWQRNDPVAVPAALAADAQGDK  241 (323)
T ss_pred             CCHHHHCCCHHHHCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECHHHHHCCCCCCCCCCEEEECCCCCCCCCCC
T ss_conf             87202201111220666665035687611535787414887887637711565310673304881488710588874341


Q ss_pred             -----------------------------------------------------CCCHHHHHHHHHHCHHHHHHHHHHHHH
Q ss_conf             -----------------------------------------------------453458999985262899999999999
Q gi|254780308|r  249 -----------------------------------------------------PGEKNFAILKHWNASLNYNKTIAYIAA  275 (288)
Q Consensus       249 -----------------------------------------------------~~~~n~~~~~~~n~s~~y~~~v~~~a~  275 (288)
T Consensus       242 ~~~~~~~g~~p~~~~~~L~~~G~~P~~G~~~~~~~~~~a~l~~L~~~~g~~YWlGl~NFyaITRYN~S~~YAmAVy~Ls~  321 (323)
T TIGR02282       242 LLAKKFAGEKPHYSLSDLKAAGLAPAAGVDAPVEDEQKAALVDLEEEGGKEYWLGLNNFYAITRYNRSTLYAMAVYQLSQ  321 (323)
T ss_pred             CCHHHHCCCCCCEEHHHHHHCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCEECCCHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             02132147876030788862688877664553214687248871678895103214123566311772436999999996


Q ss_pred             HH
Q ss_conf             96
Q gi|254780308|r  276 HI  277 (288)
Q Consensus       276 ~~  277 (288)
T Consensus       322 ~l  323 (323)
T TIGR02282       322 AL  323 (323)
T ss_pred             HC
T ss_conf             19