Query         gi|254780308|ref|YP_003064721.1| putative membrane-bound lytic murein transglycosylase signal peptide protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 288
No_of_seqs    149 out of 1157
Neff          6.2 
Searched_HMMs 13730
Date          Wed Jun  1 02:26:10 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780308.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1qusa_ d.2.1.6 (A:) 36 kDa so 100.0       0       0  581.4  22.8  237   43-280    19-319 (322)
  2 d1qsaa2 d.2.1.6 (A:451-618) 70  98.8 1.6E-09 1.2E-13   75.4   5.1   84  113-240     2-88  (168)
  3 d1gbsa_ d.2.1.5 (A:) Lysozyme   98.8 6.6E-09 4.8E-13   71.7   7.7  124  105-278    39-181 (185)
  4 d1xsfa1 d.2.1.8 (A:23-108) Pro  64.9     4.3 0.00031   18.5   7.2   66  173-242     9-74  (86)
  5 d1qvba_ c.1.8.4 (A:) beta-Glyc  59.7     5.3 0.00039   17.9   4.1   48  115-182   368-415 (481)
  6 d1c7va_ a.39.1.5 (A:) Calcium   46.4     2.4 0.00017   20.1   0.4   52  170-221     2-58  (68)
  7 d1dlwa_ a.1.1.1 (A:) Protozoan  43.6     9.6  0.0007   16.4   3.6   32   38-69     74-105 (116)
  8 d1idra_ a.1.1.1 (A:) Protozoan  41.9      10 0.00075   16.2   3.7   19  116-134    95-113 (127)
  9 d1yt3a2 a.60.8.3 (A:295-375) R  39.9      11  0.0008   16.0   3.1   62  108-176    10-76  (81)
 10 d1ijwc_ a.4.1.2 (C:) HIN recom  39.8     7.6 0.00055   17.0   2.2   37   96-133     3-39  (47)
 11 d2v94a1 d.12.1.3 (A:1-93) Ribo  39.1     5.2 0.00038   18.0   1.2   31  115-146    34-64  (93)
 12 d1jc2a_ a.39.1.5 (A:) Troponin  31.3     7.2 0.00053   17.1   0.9   52  169-221     8-64  (75)
 13 d1nvma1 a.5.7.1 (A:291-341) 4-  30.9      13 0.00094   15.6   2.2   21  118-138     8-28  (51)
 14 d2g1da1 d.12.1.3 (A:1-98) Ribo  27.8     6.4 0.00047   17.4   0.2   41  115-156    34-76  (98)
 15 d1dlya_ a.1.1.1 (A:) Protozoan  27.8      18  0.0013   14.8   4.1   30   40-69     78-107 (121)
 16 d1am7a_ d.2.1.4 (A:) Lambda ly  27.7     8.6 0.00063   16.7   0.8   45  190-240    58-103 (154)
 17 d2fcea1 a.39.1.5 (A:84-144) Ca  26.4      11 0.00083   15.9   1.3   49  171-220     2-55  (61)
 18 d1ywxa1 d.12.1.3 (A:1-102) Rib  25.2     8.7 0.00063   16.6   0.5   41  116-157    34-76  (102)
 19 d2opoa1 a.39.1.10 (A:6-86) Pol  23.6      10 0.00076   16.2   0.6   49  171-221     7-60  (81)
 20 d1fw4a_ a.39.1.5 (A:) Calmodul  22.0      15  0.0011   15.3   1.1   51  170-221     3-58  (65)
 21 d2icta1 a.35.1.3 (A:8-94) Anti  21.8      23  0.0016   14.1   2.0   24  116-142    44-67  (87)
 22 d1qoxa_ c.1.8.4 (A:) Beta-gluc  21.8      23  0.0017   14.1   2.2   58  115-182   335-392 (449)
 23 d1fi5a_ a.39.1.5 (A:) Troponin  20.4      17  0.0013   14.9   1.2   51  170-221    15-70  (81)

No 1  
>d1qusa_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=0  Score=581.42  Aligned_cols=237  Identities=24%  Similarity=0.424  Sum_probs=218.8

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCHHHHHHCCCCC--------CCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999839998999998608777702333202566--------667779899987640013579999985323
Q gi|254780308|r   43 GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV--------TSPPVSFKDYLDGLSSSEIIAQGIALKKAN  114 (288)
Q Consensus        43 ~~wl~~l~~~A~~~Gis~~tl~~~f~~~~~~~~VI~~dr~Qp--------~ef~~t~~~Y~~~~vs~~Ri~~Gr~~~~~~  114 (288)
                      .+....+...|.++|+++++++++|++++++++||++|++|+        +++++||.+|++++|++.||++|++++++|
T Consensus        19 p~v~~Fi~~la~~~G~s~~~l~~~f~~~k~~~~vi~~~~~q~~~~~~~~p~~~~~~w~~Y~~~~v~~~ri~~g~~~~~~~   98 (322)
T d1qusa_          19 PNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSVKPPSGPNGAWLRYRKKFITPDNVQNGVVFWNQY   98 (322)
T ss_dssp             HHHHHHHHHHHHHHCCCHHHHHHHHTTCCCCHHHHHHHHCC----------CCSCHHHHHHTTTCSHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             87999999999982989999999997284668899987614654446886013676999998857999999999999999


Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHCCCCCHHC-CCCC
Q ss_conf             46999999983899889445231002210102564189999875327-531566547899999986438777000-3675
Q gi|254780308|r  115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CRRAKFFTEQFFYALDLVKKGVISSHA-LGAT  192 (288)
Q Consensus       115 ~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d-~RR~~ff~~el~a~l~~~~~g~~~~~~-~GS~  192 (288)
                      +++|++||++||||++||+|||||||+||+++|+++|++|||||||| +||++||++||+++|+|++++++++.. +|||
T Consensus        99 ~~~l~~~e~~yGV~~~ii~aiwgvET~yG~~~G~~~v~~aLaTLAf~~~rR~~ff~~EL~a~L~i~~~~~~~~~~l~GSw  178 (322)
T d1qusa_          99 EDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSF  178 (322)
T ss_dssp             HHHHHHHHHHHCCCHHHHHHHHHHHHTTTTCCCCEEHHHHHHHHHHSCGGGHHHHHHHHHHHHHHHHHTTCCGGGCEECT
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHCHHHHCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99999999985988778777776450332432777303234556641664143430899999999874276754345674


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC-----------------------
Q ss_conf             235786665522444215367899987887898889999999999729888589764-----------------------
Q gi|254780308|r  193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP-----------------------  249 (288)
Q Consensus       193 aGa~G~~QFmPs~~~~yavD~dgdG~~dl~~~~~Da~aS~AnyL~~~GW~~g~~~~~-----------------------  249 (288)
                      ||||||||||||||++|||||||||++|||++ +|||+|+||||++|||++|+||..                       
T Consensus       179 AGAmG~~QFmPSsy~~yavD~DgDG~~Diwn~-~DaiaS~ANYL~~~GW~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~  257 (322)
T d1qusa_         179 AGAMGYGQFMPSSYKQYAVDFSGDGHINLWDP-VDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLA  257 (322)
T ss_dssp             TCCBTTTTBCHHHHHHHCCCCSSSSCCCTTSH-HHHHHHHHHHHHHTTCCTTCCSEEEEESCCTTSCCEEEEEEEHHHHH
T ss_pred             CCCCCCCCCCHHHHHHHHHHCCCCCCEEECCC-HHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHH
T ss_conf             31247653044899977552379852010363-12375799999981987798568983576654645676445599998


Q ss_pred             -------------------------------CCHHHHHHHHHHCHHHHHHHHHHHHHHHCCC
Q ss_conf             -------------------------------5345899998526289999999999996899
Q gi|254780308|r  250 -------------------------------GEKNFAILKHWNASLNYNKTIAYIAAHIDGV  280 (288)
Q Consensus       250 -------------------------------~~~n~~~~~~~n~s~~y~~~v~~~a~~~~g~  280 (288)
                                                     +.+||+||++||+|..|+++|++||++|.++
T Consensus       258 ~~Gv~~~~~~~~~~~~~~l~l~~g~~~~~~l~~~NF~vI~rYN~S~~YAlaV~~La~~I~~~  319 (322)
T d1qusa_         258 AAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALA  319 (322)
T ss_dssp             HTTCEESSCCTTCCEEEEEEEECSSSEEEEEECHHHHHHHTTSSCHHHHHHHHHHHHHHHHH
T ss_pred             HCCCCCCCCCCCCCCCCEEECCCCCCCEEEEECCCHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             65787677888545464475348888616997578999987318498999999999999863


No 2  
>d1qsaa2 d.2.1.6 (A:451-618) 70 kDa soluble lytic transglycosylase, SLT70 {Escherichia coli [TaxId: 562]}
Probab=98.84  E-value=1.6e-09  Score=75.39  Aligned_cols=84  Identities=17%  Similarity=0.187  Sum_probs=68.6

Q ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCHHCCCCC
Q ss_conf             23469999999838998894452310022101025641899998753275315665478999999864387770003675
Q gi|254780308|r  113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT  192 (288)
Q Consensus       113 ~~~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d~RR~~ff~~el~a~l~~~~~g~~~~~~~GS~  192 (288)
                      .|.+++++..++||||+++|.||.-.||.|=..                                          . -|.
T Consensus         2 ~Y~~~i~~~a~~~gv~~~ll~Ai~~~ES~f~p~------------------------------------------a-~S~   38 (168)
T d1qsaa2           2 AYNDLFKRYTSGKEIPQSYAMAIARQESAWNPK------------------------------------------V-KSP   38 (168)
T ss_dssp             TTHHHHHHHHTTSSSCHHHHHHHHHHHHTTCTT------------------------------------------C-BCT
T ss_pred             CCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCC------------------------------------------C-CCC
T ss_conf             858999999988599999999999981699998------------------------------------------8-888


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCCCCC---CCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             2357866655224442153678999---87887898889999999999729
Q gi|254780308|r  193 FGEIGQFQFLPVNVVKYAIDADEDG---KIDLVKSNIDAIASAAKFLAKLG  240 (288)
Q Consensus       193 aGa~G~~QFmPs~~~~yavD~dgdG---~~dl~~~~~Da~aS~AnyL~~~G  240 (288)
                      +||+|.|||||+|+..++.++..++   ..|++ ++.+.+--.+.||+..-
T Consensus        39 ~GA~GlmQi~p~ta~~~~~~~~~~~~~~~~~l~-dp~~ni~~g~~yl~~~~   88 (168)
T d1qsaa2          39 VGASGLMQIMPGTATHTVKMFSIPGYSSPGQLL-DPETNINIGTSYLQYVY   88 (168)
T ss_dssp             TCCBTTTTBCHHHHHHHHHHHTCCSCCCGGGGG-SHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC-CHHHHHHHHHHHHHHHH
T ss_conf             775443256708888678872146777421112-86999999999999989


No 3  
>d1gbsa_ d.2.1.5 (A:) Lysozyme {Australian black swan (Cygnus atratus) [TaxId: 8868]}
Probab=98.81  E-value=6.6e-09  Score=71.73  Aligned_cols=124  Identities=12%  Similarity=0.154  Sum_probs=82.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999853234699999998389988944523100221010256418999987532753156654789999998643877
Q gi|254780308|r  105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI  184 (288)
Q Consensus       105 ~~Gr~~~~~~~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d~RR~~ff~~el~a~l~~~~~g~~  184 (288)
                      ..-...+.+++..+.++.++|||||++|.||+-.||+|....                                      
T Consensus        39 ~~d~~~~~~y~~~i~~aa~~~~v~~~ll~ai~~~ES~f~~~a--------------------------------------   80 (185)
T d1gbsa_          39 ERDLKAMDRYKTIIKKVGEKLCVEPAVIAGIISRESHAGKVL--------------------------------------   80 (185)
T ss_dssp             HHHHHHHHTSHHHHHHHHHHHTCCHHHHHHHHHHHHGGGTTC--------------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCC--------------------------------------
T ss_conf             865777899999999999982985999999999865899989--------------------------------------


Q ss_pred             CHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC--CC-CCCCCCCCCHHHHHHHHHH
Q ss_conf             70003675235786665522444215367899987887898889999999999729--88-8589764534589999852
Q gi|254780308|r  185 SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG--WT-KCAGYQPGEKNFAILKHWN  261 (288)
Q Consensus       185 ~~~~~GS~aGa~G~~QFmPs~~~~yavD~dgdG~~dl~~~~~Da~aS~AnyL~~~G--W~-~g~~~~~~~~n~~~~~~~n  261 (288)
                       ....|++++|+|.||+||+++..++          +++ +.+.|.-.+.||+..=  +. .-..|.....-..+|..||
T Consensus        81 -~s~~g~~~~A~GLMQi~p~t~~~~g----------~~d-p~~ni~~g~~~L~~~~~~~~~~~~~~~~~~~~~~alaAYN  148 (185)
T d1gbsa_          81 -KNGWGDRGNGFGLMQVDKRSHKPQG----------TWN-GEVHITQGTTILTDFIKRIQKKFPSWTKDQQLKGGISAYN  148 (185)
T ss_dssp             -BTTBCTTSCEETTTTEETTTSCCCS----------CTT-SHHHHHHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHHH
T ss_pred             -CCCCCCCCCCCCCCCCCCCHHHHCC----------CCC-HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             -4989999998561000700544505----------668-8888999999999999997610788774301999999997


Q ss_pred             C----------------HHHHHHHHHHHHHHHC
Q ss_conf             6----------------2899999999999968
Q gi|254780308|r  262 A----------------SLNYNKTIAYIAAHID  278 (288)
Q Consensus       262 ~----------------s~~y~~~v~~~a~~~~  278 (288)
                      .                ...|+..|...+....
T Consensus       149 aG~g~V~~~~~~~~~~~~~~Yv~~Vl~ra~~y~  181 (185)
T d1gbsa_         149 AGAGNVRSYARMDIGTTHDDYANDVVARAQYYK  181 (185)
T ss_dssp             HCGGGCCCSTTTTTTSGGGCHHHHHHHHHHHHH
T ss_pred             HCCHHHHHHCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             372225440479998404678999999999998


No 4  
>d1xsfa1 d.2.1.8 (A:23-108) Probable resuscitation-promoting factor RpfB {Mycobacterium tuberculosis [TaxId: 1773]}
Probab=64.93  E-value=4.3  Score=18.51  Aligned_cols=66  Identities=21%  Similarity=0.129  Sum_probs=44.4

Q ss_pred             HHHHHHHHCCCCCHHCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             9999986438777000367523578666552244421536789998788789888999999999972988
Q gi|254780308|r  173 FYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT  242 (288)
Q Consensus       173 ~a~l~~~~~g~~~~~~~GS~aGa~G~~QFmPs~~~~yavD~dgdG~~dl~~~~~Da~aS~AnyL~~~GW~  242 (288)
                      .+.|.-||-|..-.-..|  -|..|--||.|+||..|+--.- -++.|. -++.+=++-+-+.+...||.
T Consensus         9 W~~la~CESggn~~~ntg--nG~YGg~QFs~~TW~~~GG~~y-a~~~~~-As~~eQi~~A~~l~~~qG~~   74 (86)
T d1xsfa1           9 WDAIAGCEAGGNWAINTG--NGYYGGVQFDQGTWEANGGLRY-APRADL-ATREEQIAVAEVTRLRQGWG   74 (86)
T ss_dssp             HHHHHHHHTSSCTTCCCS--SSBCTTTCCBHHHHHHTTGGGT-CSSTTT-SCHHHHHHHHHHHHHHHSST
T ss_pred             HHHHHHHHCCCCCCCCCC--CCCCCEECCCHHHHHHHCCCCC-CCCCCC-CCHHHHHHHHHHHHHHCCCC
T ss_conf             999999763899714689--8650113047889988188657-888003-99999999999999974877


No 5  
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]}
Probab=59.70  E-value=5.3  Score=17.93  Aligned_cols=48  Identities=23%  Similarity=0.369  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             46999999983899889445231002210102564189999875327531566547899999986438
Q gi|254780308|r  115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG  182 (288)
Q Consensus       115 ~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d~RR~~ff~~el~a~l~~~~~g  182 (288)
                      +.+|.++.++|++|      |+=.|..+|..              .|.+|.+|+++.|.++++-+++|
T Consensus       368 ~~~L~~~~~~Y~~P------i~ITENG~~~~--------------~D~~Ri~yl~~hL~~~~~Ai~dG  415 (481)
T d1qvba_         368 YLLLKELYNRYGVD------LIVTENGVSDS--------------RDALRPAYLVSHVYSVWKAANEG  415 (481)
T ss_dssp             HHHHHHHHHHHCCE------EEEEECCCCCT--------------TCSSHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHCCCC------EEEECCCCCCC--------------CCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999998860999------89979988766--------------67589999999999999999879


No 6  
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
Probab=46.41  E-value=2.4  Score=20.06  Aligned_cols=52  Identities=23%  Similarity=0.390  Sum_probs=31.7

Q ss_pred             HHHHHHHHHHHC---CCCCHHCCCCCCCCCCCCCCCHHHHHH--CCCCCCCCCCCCC
Q ss_conf             789999998643---877700036752357866655224442--1536789998788
Q gi|254780308|r  170 EQFFYALDLVKK---GVISSHALGATFGEIGQFQFLPVNVVK--YAIDADEDGKIDL  221 (288)
Q Consensus       170 ~el~a~l~~~~~---g~~~~~~~GS~aGa~G~~QFmPs~~~~--yavD~dgdG~~dl  221 (288)
                      +||..+.+..+.   |.|+...+..-...+|..-.-+.....  -.+|.||||++|.
T Consensus         2 eel~~~F~~~D~d~~G~I~~~el~~~l~~~g~~~~s~~e~~~~~~~~D~d~dG~i~~   58 (68)
T d1c7va_           2 EEILRAFKVFDANGDGVIDFDEFKFIMQKVGEEPLTDAEVEEAMKEADEDGNGVIDI   58 (68)
T ss_dssp             HHHHHHHHHHSCSGGGEECHHHHHHHSSTTTTCCCCHHHHHHHHHHHCSSGGGSEEH
T ss_pred             HHHHHHHHHHCCCCCCEECHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCEEH
T ss_conf             899999998869984917499999999984899999999999999867999991819


No 7  
>d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}
Probab=43.63  E-value=9.6  Score=16.37  Aligned_cols=32  Identities=13%  Similarity=0.144  Sum_probs=16.2

Q ss_pred             CHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             83208999999999999839998999998608
Q gi|254780308|r   38 TADRFGEWKSAARARAVREGMSPKTAKHLFAD   69 (288)
Q Consensus        38 ~~~~F~~wl~~l~~~A~~~Gis~~tl~~~f~~   69 (288)
                      +...|+.|+.-+.+...+.|++...++.+++-
T Consensus        74 ~~~~fd~~~~~l~~al~e~~v~~~~~~e~~~~  105 (116)
T d1dlwa_          74 SNAQFTTVIGHLRSALTGAGVAAALVEQTVAV  105 (116)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             99999999999999999829999999999999


No 8  
>d1idra_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
Probab=41.89  E-value=10  Score=16.20  Aligned_cols=19  Identities=21%  Similarity=0.281  Sum_probs=6.9

Q ss_pred             HHHHHHHHHHCCCHHHHHH
Q ss_conf             6999999983899889445
Q gi|254780308|r  116 RLLINLKKEYGVPPGILMA  134 (288)
Q Consensus       116 ~~L~~ie~~yGV~~~ii~A  134 (288)
                      ..|..+=++.|||.+.+..
T Consensus        95 ~~l~~al~e~~v~~~~~~e  113 (127)
T d1idra_          95 GHLADALTAAGVPSETITE  113 (127)
T ss_dssp             HHHHHHHHHTTCCHHHHHH
T ss_pred             HHHHHHHHHCCCCHHHHHH
T ss_conf             9999999980979999999


No 9  
>d1yt3a2 a.60.8.3 (A:295-375) Ribonuclease D {Escherichia coli [TaxId: 562]}
Probab=39.94  E-value=11  Score=16.02  Aligned_cols=62  Identities=13%  Similarity=0.140  Sum_probs=35.5

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCC-----HHHCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             99853234699999998389988944523100221-----0102564189999875327531566547899999
Q gi|254780308|r  108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHF-----GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL  176 (288)
Q Consensus       108 r~~~~~~~~~L~~ie~~yGV~~~ii~AiwGiET~y-----G~~~G~~~vl~aLaTLA~d~RR~~ff~~el~a~l  176 (288)
                      |+.++.-+..++.+.++.||+|++|+.==-+|.-.     +.-....|       -...|=|.+++...|.+.|
T Consensus        10 K~~~K~lk~~v~~~Ae~~~IapelLaskkdle~ll~~~~~~~~~~~~P-------~ll~GWR~elvg~~l~~lL   76 (81)
T d1yt3a2          10 RKAFKAIKSLITDVSETHKISAELLASRRQINQLLNWHWKLKPQNNLP-------ELISGWRGELMAEALHNLL   76 (81)
T ss_dssp             HHHHHHHHHHHHHHHHHHTCCHHHHCCHHHHHHHHHHHTTCSCCSSCC-------GGGSHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHCCHHHHHHHHHHHHHCCCCCCCC-------HHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999883999999438999999999987027876787-------7775540999999999998


No 10 
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic}
Probab=39.83  E-value=7.6  Score=16.99  Aligned_cols=37  Identities=14%  Similarity=-0.000  Sum_probs=28.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             76400135799999853234699999998389988944
Q gi|254780308|r   96 DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM  133 (288)
Q Consensus        96 ~~~vs~~Ri~~Gr~~~~~~~~~L~~ie~~yGV~~~ii~  133 (288)
                      +..+++..+...++++..- ..-.+|.+.|||.+..|-
T Consensus         3 ~~~lt~~q~~~a~~l~~~G-~s~~~iA~~~gVSr~TiY   39 (47)
T d1ijwc_           3 PRAINKHEQEQISRLLEKG-HPRQQLAIIFGIGVSTLY   39 (47)
T ss_dssp             CCSSCHHHHHHHHHHHHTT-CCHHHHHHHHTCCHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHCC-CCHHHHHHHHCCCHHHHH
T ss_conf             8859999999999999889-979999999796999998


No 11 
>d2v94a1 d.12.1.3 (A:1-93) Ribosomal protein S24e {Pyrococcus abyssi [TaxId: 29292]}
Probab=39.08  E-value=5.2  Score=18.00  Aligned_cols=31  Identities=13%  Similarity=0.134  Sum_probs=25.3

Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHC
Q ss_conf             46999999983899889445231002210102
Q gi|254780308|r  115 SRLLINLKKEYGVPPGILMALWGLETHFGETM  146 (288)
Q Consensus       115 ~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~  146 (288)
                      ..+-+.+.+.||++++.++ +-++.|.||...
T Consensus        34 ~ei~~kla~~~~~~~~~vv-v~~~~t~fG~~~   64 (93)
T d2v94a1          34 KDVKGKLVAMLDLNPETTV-IQYIRSYFGSYK   64 (93)
T ss_dssp             HHHHHHHHHHHTCCGGGEE-EEEEECCTTCSE
T ss_pred             HHHHHHHHHHHCCCCCEEE-EEECCCCCCCCE
T ss_conf             9999999998788978899-981761789965


No 12 
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
Probab=31.26  E-value=7.2  Score=17.13  Aligned_cols=52  Identities=23%  Similarity=0.477  Sum_probs=29.2

Q ss_pred             HHHHHHHHHHHHC---CCCCHHCCCCCCCCCCCCCCCHHHHHH--CCCCCCCCCCCCC
Q ss_conf             4789999998643---877700036752357866655224442--1536789998788
Q gi|254780308|r  169 TEQFFYALDLVKK---GVISSHALGATFGEIGQFQFLPVNVVK--YAIDADEDGKIDL  221 (288)
Q Consensus       169 ~~el~a~l~~~~~---g~~~~~~~GS~aGa~G~~QFmPs~~~~--yavD~dgdG~~dl  221 (288)
                      ..||..+++..+.   |.|+...+...--.+|. .+-+.....  -.+|.|+||+++.
T Consensus         8 eeel~~~F~~fD~~~~G~I~~~el~~~l~~lg~-~~~~~e~~~~~~~~D~d~dg~I~~   64 (75)
T d1jc2a_           8 EEELANCFRIFDKNADGFIDIEELGEILRATGE-HVIEEDIEDLMKDSDKNNDGRIDF   64 (75)
T ss_dssp             HHHHHHHHHHHCCSTTSSEEHHHHHHHHHHSSS-CCCHHHHHHHHHHHCSSSCSEECH
T ss_pred             HHHHHHHHHHHCCCCCCEECHHHHHHHHHHCCC-CCCHHHHHHHHHHHCCCCCCCEEH
T ss_conf             999999999983898592839999889986487-764999999999848899980849


No 13 
>d1nvma1 a.5.7.1 (A:291-341) 4-hydroxy-2-oxovalerate aldolase DmpG, communication domain {Pseudomonas sp. [TaxId: 306]}
Probab=30.89  E-value=13  Score=15.60  Aligned_cols=21  Identities=10%  Similarity=0.014  Sum_probs=15.8

Q ss_pred             HHHHHHHHCCCHHHHHHHHHC
Q ss_conf             999999838998894452310
Q gi|254780308|r  118 LINLKKEYGVPPGILMALWGL  138 (288)
Q Consensus       118 L~~ie~~yGV~~~ii~AiwGi  138 (288)
                      -+++.++||||++-|+-=.|-
T Consensus         8 a~raa~~ygv~~rdil~ElGr   28 (51)
T d1nvma1           8 AEIAAAKYNLKTLDILVELGH   28 (51)
T ss_dssp             HHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCHHHHHHHHHH
T ss_conf             999999929899999999711


No 14 
>d2g1da1 d.12.1.3 (A:1-98) Ribosomal protein S24e {Thermoplasma acidophilum [TaxId: 2303]}
Probab=27.80  E-value=6.4  Score=17.44  Aligned_cols=41  Identities=15%  Similarity=0.157  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHCCCCCHHH--CCCCCHHHHHH
Q ss_conf             4699999998389988944523100221010--25641899998
Q gi|254780308|r  115 SRLLINLKKEYGVPPGILMALWGLETHFGET--MGKTPLLSTLA  156 (288)
Q Consensus       115 ~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~--~G~~~vl~aLa  156 (288)
                      ..+-+++.+.||++++.++ +-++.|.||..  +|-.-|-++..
T Consensus        34 ~ei~~kla~~~~~~~~~vv-v~~~~t~fG~~~stG~a~IYd~~e   76 (98)
T d2g1da1          34 EEIKELIAKHEGVDKELVI-VDNNKQLTGKHEIEGYTKIYADKP   76 (98)
T ss_dssp             HHHHHHHHHHHHSCSTTEE-CCCCCCCSSSSEEEEEEEEESHHH
T ss_pred             HHHHHHHHHHHCCCCCEEE-EECCEECCCCCEEEEEEEEECCHH
T ss_conf             9999999999789968799-974770679964899999988999


No 15 
>d1dlya_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Green alga (Chlamydomonas eugametos) [TaxId: 3054]}
Probab=27.76  E-value=18  Score=14.80  Aligned_cols=30  Identities=13%  Similarity=0.127  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHHHHHHCC
Q ss_conf             208999999999999839998999998608
Q gi|254780308|r   40 DRFGEWKSAARARAVREGMSPKTAKHLFAD   69 (288)
Q Consensus        40 ~~F~~wl~~l~~~A~~~Gis~~tl~~~f~~   69 (288)
                      ..|+.|+.-+.+...+.|++.+.++.++.-
T Consensus        78 ~~f~~~~~~l~~al~~~~v~~~~~~e~~~~  107 (121)
T d1dlya_          78 VHFQAVARHLSDTLTELGVPPEDITDAMAV  107 (121)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             999999999999999819899999999999


No 16 
>d1am7a_ d.2.1.4 (A:) Lambda lysozyme {Bacteriophage lambda [TaxId: 10710]}
Probab=27.66  E-value=8.6  Score=16.67  Aligned_cols=45  Identities=18%  Similarity=0.147  Sum_probs=27.9

Q ss_pred             CCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCC-HHHHHHHHHHHHHHCC
Q ss_conf             67523578666552244421536789998788789-8889999999999729
Q gi|254780308|r  190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS-NIDAIASAAKFLAKLG  240 (288)
Q Consensus       190 GS~aGa~G~~QFmPs~~~~yavD~dgdG~~dl~~~-~~Da~aS~AnyL~~~G  240 (288)
                      |....|.|-=||||+||..++....-+    .|+- .-|-++  -..|++.|
T Consensus        58 ~~~StAaGrYQfl~~Tw~~~~~~~gl~----~F~P~~QD~~a--~~ll~~rg  103 (154)
T d1am7a_          58 KLKSTGAGRYQLLSRWWDAYRKQLGLK----DFSPKSQDAVA--LQQIKERG  103 (154)
T ss_dssp             TEEECCBTTTTBCHHHHHHHHHHHTCC----CCCHHHHHHHH--HHHHHHTT
T ss_pred             CCCCCHHHHHHCCHHHHHHHHHHCCCC----CCCHHHHHHHH--HHHHHHCC
T ss_conf             766333321450699999999853899----98988999999--99998168


No 17 
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}
Probab=26.37  E-value=11  Score=15.91  Aligned_cols=49  Identities=24%  Similarity=0.444  Sum_probs=24.4

Q ss_pred             HHHHHHHHHHC---CCCCHHCCCCCCCCCCCCCCCHHHHHHC--CCCCCCCCCCC
Q ss_conf             89999998643---8777000367523578666552244421--53678999878
Q gi|254780308|r  171 QFFYALDLVKK---GVISSHALGATFGEIGQFQFLPVNVVKY--AIDADEDGKID  220 (288)
Q Consensus       171 el~a~l~~~~~---g~~~~~~~GS~aGa~G~~QFmPs~~~~y--avD~dgdG~~d  220 (288)
                      |+..+++..+.   |.|+...+.+..-.+|.. +.+..+...  -+|-|+||+++
T Consensus         2 el~~aF~~fD~~~~G~I~~~el~~~l~~~g~~-~~~~ei~~l~~~~D~d~dg~I~   55 (61)
T d2fcea1           2 DFVKAFQVFDKESTGKVSVGDLRYMLTGLGEK-LTDAEVDELLKGVEVDSNGEID   55 (61)
T ss_dssp             HHHHHHHHHCTTCCSCEEHHHHHHHHHHTTCC-CCHHHHHHHHTTCCCCTTSEEC
T ss_pred             HHHHHHHHHCCCCCCEEEHHHHHHHHHHCCCC-CCHHHHHHHHHHCCCCCCCCEE
T ss_conf             69999999777999748379999999982999-9899999999980889899593


No 18 
>d1ywxa1 d.12.1.3 (A:1-102) Ribosomal protein S24e {Methanococcus maripaludis [TaxId: 39152]}
Probab=25.21  E-value=8.7  Score=16.63  Aligned_cols=41  Identities=15%  Similarity=0.217  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHCCCCCHHH--CCCCCHHHHHHH
Q ss_conf             699999998389988944523100221010--256418999987
Q gi|254780308|r  116 RLLINLKKEYGVPPGILMALWGLETHFGET--MGKTPLLSTLAT  157 (288)
Q Consensus       116 ~~L~~ie~~yGV~~~ii~AiwGiET~yG~~--~G~~~vl~aLaT  157 (288)
                      .+-+++.+.||+++..|+ +-++.|.||..  +|-.-|-++...
T Consensus        34 ei~~kla~~~~~~~~~vv-v~~~~t~fG~~~stG~a~IYd~~e~   76 (102)
T d1ywxa1          34 DVKMKLVAVLNANKQVLV-VDTLDQIFGKLEAEGYAKIYNDEKA   76 (102)
T ss_dssp             HHHHHHHHHHTSCSTTEE-EEEEEECSSSSEEEEEEEECSCHHH
T ss_pred             HHHHHHHHHHCCCCCEEE-EECCEECCCCCEEEEEEEEECCHHH
T ss_conf             999999997794968899-9747705799758999999889999


No 19 
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}
Probab=23.56  E-value=10  Score=16.17  Aligned_cols=49  Identities=31%  Similarity=0.427  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHC---CCCCHHCCCCCCCCCCCCCCCHHHHHHC--CCCCCCCCCCCC
Q ss_conf             89999998643---8777000367523578666552244421--536789998788
Q gi|254780308|r  171 QFFYALDLVKK---GVISSHALGATFGEIGQFQFLPVNVVKY--AIDADEDGKIDL  221 (288)
Q Consensus       171 el~a~l~~~~~---g~~~~~~~GS~aGa~G~~QFmPs~~~~y--avD~dgdG~~dl  221 (288)
                      ++..+.+.++.   |.|+...+...-..+|+  ..+......  .+|-||||.+|.
T Consensus         7 e~~~~F~~~D~d~~G~I~~~El~~~l~~lg~--~~~~ei~~~~~~~D~d~~G~I~~   60 (81)
T d2opoa1           7 DRERIFKRFDTNGDGKISSSELGDALKTLGS--VTPDEVRRMMAEIDTDGDGFISF   60 (81)
T ss_dssp             HHHHHHHHHCTTCSSEEEHHHHHHHHHTTTT--CCHHHHHHHHHHHCTTCSSEECH
T ss_pred             HHHHHHHHHCCCCCCCCCHHHHHHHHHHHHC--CCHHHHHHHHHHHCCCCCCEEEH
T ss_conf             9999999987898997859999999998643--88999999999857999982829


No 20 
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}
Probab=22.03  E-value=15  Score=15.25  Aligned_cols=51  Identities=25%  Similarity=0.377  Sum_probs=25.2

Q ss_pred             HHHHHHHHHHHC---CCCCHHCCCCCCCCCCCCCCCHHHHHH--CCCCCCCCCCCCC
Q ss_conf             789999998643---877700036752357866655224442--1536789998788
Q gi|254780308|r  170 EQFFYALDLVKK---GVISSHALGATFGEIGQFQFLPVNVVK--YAIDADEDGKIDL  221 (288)
Q Consensus       170 ~el~a~l~~~~~---g~~~~~~~GS~aGa~G~~QFmPs~~~~--yavD~dgdG~~dl  221 (288)
                      .||..+.++.+.   |.|+.+.+..-.-.+|+. +-+.....  -.+|-|+||++|.
T Consensus         3 eel~~aF~~fD~d~~G~I~~~el~~~l~~lg~~-~~~~e~~~l~~~~D~d~~g~I~~   58 (65)
T d1fw4a_           3 EEIREAFRVFDKDGNGYISAAELRHVMTNLGEK-LTDEEVDEMIREADIDGDGQVNY   58 (65)
T ss_dssp             HHHHHHHHHHCTTCSSEECHHHHHHHHHHTTCC-CCHHHHHHHHHTTCTTCSSSEEH
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCC-CCHHHHHHHHHHCCCCCCCCEEH
T ss_conf             999999999867999967799999999995899-98999999999819899996939


No 21 
>d2icta1 a.35.1.3 (A:8-94) Antitoxin HigA {Escherichia coli [TaxId: 562]}
Probab=21.81  E-value=23  Score=14.14  Aligned_cols=24  Identities=21%  Similarity=0.462  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHCCCCC
Q ss_conf             699999998389988944523100221
Q gi|254780308|r  116 RLLINLKKEYGVPPGILMALWGLETHF  142 (288)
Q Consensus       116 ~~L~~ie~~yGV~~~ii~AiwGiET~y  142 (288)
                      ..+.++++-|||++++++   ++|++|
T Consensus        44 ~~~~kla~~lgvs~~~~L---~lq~~~   67 (87)
T d2icta1          44 EMAIKLSVVIGSSPQMWL---NLQNAW   67 (87)
T ss_dssp             HHHHHHHHHTCSCHHHHH---HHHHHH
T ss_pred             HHHHHHHHHHCCCHHHHH---HHHHHH
T ss_conf             999999999891999998---218987


No 22 
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]}
Probab=21.79  E-value=23  Score=14.11  Aligned_cols=58  Identities=24%  Similarity=0.286  Sum_probs=29.8

Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             46999999983899889445231002210102564189999875327531566547899999986438
Q gi|254780308|r  115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG  182 (288)
Q Consensus       115 ~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d~RR~~ff~~el~a~l~~~~~g  182 (288)
                      +.+|+.+.++|+.|+     |+=.|...|..-+. +.    ----.|.+|.+|.+..|.+.++-+++|
T Consensus       335 ~~~L~~i~~~y~~p~-----i~ITENG~a~~d~~-~~----~~~i~D~~Ri~yl~~hL~~~~~Ai~dG  392 (449)
T d1qoxa_         335 YDLLRYTADKYGNPT-----LYITENGACYNDGL-SL----DGRIHDQRRIDYLAMHLIQASRAIEDG  392 (449)
T ss_dssp             HHHHHHHHHHTTSCC-----EEEEECCCCCCCCC-CT----TSSCCCHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHCCCE-----EEEECCCCCCCCCC-CC----CCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             899999999868981-----89951676667887-85----665468889999999999999999879


No 23 
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}
Probab=20.42  E-value=17  Score=14.85  Aligned_cols=51  Identities=22%  Similarity=0.337  Sum_probs=26.8

Q ss_pred             HHHHHHHHHHHC---CCCCHHCCCCCCCCCCCCCCCHHHHHHC--CCCCCCCCCCCC
Q ss_conf             789999998643---8777000367523578666552244421--536789998788
Q gi|254780308|r  170 EQFFYALDLVKK---GVISSHALGATFGEIGQFQFLPVNVVKY--AIDADEDGKIDL  221 (288)
Q Consensus       170 ~el~a~l~~~~~---g~~~~~~~GS~aGa~G~~QFmPs~~~~y--avD~dgdG~~dl  221 (288)
                      .+|..+.+..+.   |.|+...+...--.+|.+ .-+......  .+|-|+||+++.
T Consensus        15 e~l~~~F~~~D~d~~G~I~~~el~~~l~~~g~~-~~~~ev~~~~~~~D~d~dg~I~~   70 (81)
T d1fi5a_          15 EELSDLFRMFDKNADGYIDLEELKIMLQATGET-ITEDDIEELMKDGDKNNDGRIDY   70 (81)
T ss_dssp             HHHHHHHHHHCSSCSSEECHHHHHHHHHTSSSC-CCHHHHHHHHHHHCSSSSSSEEH
T ss_pred             HHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCC-CCHHHHHHHHHHHCCCCCCCEEH
T ss_conf             999999999868999924389999888841788-77999999999978998994909


Done!