BLAST/PSIBLAST alignment of GI: 254780308 and GI: 15967070 at iteration 1
>gi|15967070|ref|NP_387423.1| putative membrane-bound lytic murein transglycosylase signal peptide protein [Sinorhizobium meliloti 1021] Length = 273
>gi|307302532|ref|ZP_07582289.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C] Length = 273
>gi|15076343|emb|CAC47896.1| Membrane-bound lytic murein transglycosylase [Sinorhizobium meliloti 1021] Length = 273
>gi|306903202|gb|EFN33792.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C] Length = 273
 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 148/245 (60%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +    F  W S  +  A   G+SP       A++ Y   TI  DR    S  +S   +
Sbjct: 29  CGNDGSGFSAWLSEFKREAAGNGISPSVVDQALANVSYSRATIRADRGQ-KSFKLSLDQF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       II++G  L+  N+RL  ++++ YGVP G L+A+WG+ET FG  +GK   LS 
Sbjct: 88  MQKRGGQMIISRGKKLRAQNARLFQSIEQRYGVPAGPLIAIWGMETGFGSFLGKEHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+ +FT Q + AL LV++G +S  A GA  GEIGQ QFLPVNV+KY +D D
Sbjct: 148 VSTLAYDCRRSDYFTNQLYAALQLVERGDLSPAARGAAHGEIGQTQFLPVNVLKYGVDGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            +G +D+V+S  DA+AS A FL   GW    GYQPGE NFA ++ WNA+  Y + IA I 
Sbjct: 208 GNGHVDMVRSKADALASTANFLRGHGWQPGGGYQPGEVNFAAIQGWNAASVYQQAIAIIG 267

Query: 275 AHIDG 279
           A IDG
Sbjct: 268 AEIDG 272