BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780308|ref|YP_003064721.1| putative membrane-bound lytic
murein transglycosylase signal peptide protein [Candidatus
Liberibacter asiaticus str. psy62]
         (288 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780308|ref|YP_003064721.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039985|gb|ACT56781.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 288

 Score =  262 bits (669), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 288/288 (100%), Positives = 288/288 (100%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP
Sbjct: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN
Sbjct: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK
Sbjct: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180

Query: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG
Sbjct: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240

Query: 241 WTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT 288
           WTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT
Sbjct: 241 WTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT 288


>gi|222087909|ref|YP_002546447.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
 gi|221725357|gb|ACM28513.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
          Length = 273

 Score =  252 bits (643), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 111/266 (41%), Positives = 155/266 (58%), Gaps = 1/266 (0%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           M   +    +     A     CS+T+  F  W    +  A  +G+S  T    FA++ Y 
Sbjct: 8   MAALVAVGLLLGTPFAANAASCSNTSAGFDNWVREFKQEAQGQGISQSTLDRAFANVHYN 67

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             TI  DR   +   +SF +++       II++G ++K+AN+ L   ++K YGVPPG ++
Sbjct: 68  QPTIRADRGQKS-FKLSFDEFMKKRGGQTIISRGKSMKQANAALFSRIEKRYGVPPGPII 126

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF 193
           A+WG+ET FG  MG    LS ++TLA+DCRR+ +FT+Q + AL LV +G +S  A GA  
Sbjct: 127 AIWGMETGFGSFMGDQNTLSAVSTLAFDCRRSAYFTDQLYAALKLVGEGYLSPSARGAAH 186

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GEIGQ QF+P NVV Y +D D DGK+DLV S  DA++S A FL   GW   A YQPGE N
Sbjct: 187 GEIGQTQFMPKNVVLYGVDGDGDGKVDLVGSRADALSSTANFLKGHGWQAGAPYQPGEPN 246

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDG 279
           F+ +  WN +  Y + IAYI   IDG
Sbjct: 247 FSAIGGWNDARVYQEAIAYIGKQIDG 272


>gi|148255756|ref|YP_001240341.1| putative transglycolase [Bradyrhizobium sp. BTAi1]
 gi|146407929|gb|ABQ36435.1| putative exported protein of unknown function with transglycolase
           [Bradyrhizobium sp. BTAi1]
          Length = 271

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 91/275 (33%), Positives = 141/275 (51%), Gaps = 5/275 (1%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           +I  ++    + A  +T    A +   C      F  W +  +  A  +G+S        
Sbjct: 1   MIRRVLSAAALCAAVMTNCASAQSAVPCGT--GNFDAWLAEFKTEAAAKGISQNAINAAL 58

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
             +    + + RDR        +F++   G      + +G  + K    +L  +++ YGV
Sbjct: 59  TGVTPDQSVLNRDRGQ-KVFSQTFEE-FSGRMVPPRLTRGSNMMKQYGSVLSRIEQTYGV 116

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS- 186
           P  +L+A+WGLET FG  +GK P +  LATLAYDCRRA+ F  +   AL +V +G +   
Sbjct: 117 PGEVLVAIWGLETDFGVNVGKFPTIRALATLAYDCRRAEQFRGELLDALRIVDRGDLQPA 176

Query: 187 HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
              GA  GEIGQ QF+P + +KYA+D D +G+ DL++S  D +AS A +L   GW K   
Sbjct: 177 EMRGAWAGEIGQTQFMPSSWIKYAVDFDGNGRRDLIRSAPDVLASTANYLKGYGWQKGKD 236

Query: 247 YQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           ++PG  NFA+++ WN S  Y +TIA  A  +   P
Sbjct: 237 WEPGSPNFAVIQQWNKSDVYARTIATFATQLARAP 271


>gi|146340952|ref|YP_001206000.1| putative transglycolase [Bradyrhizobium sp. ORS278]
 gi|146193758|emb|CAL77775.1| conserved hypothetical protein; putative signal peptide; putative
           transglycolase [Bradyrhizobium sp. ORS278]
          Length = 271

 Score =  245 bits (625), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 94/282 (33%), Positives = 146/282 (51%), Gaps = 12/282 (4%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ +    +S    ++ ++A +      AT    C   +  F  W +  +  A  +G+S 
Sbjct: 1   MTVR---FLSASACLFVLIALSS----PATAAVPCG--SGNFDSWLAEFKTEAAAKGISQ 51

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T       L    + + RD         +F++   G      + +G  + K    +L  
Sbjct: 52  PTINAALNGLTSDPSVLNRDHSQ-KVFSQTFEE-FSGRMVPPRLTRGSNMLKQYGSVLSR 109

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +++ YGVP  +L+A+WGLET FG  +GK P + +LATLAYDCRRA+ F  +   AL +V 
Sbjct: 110 IEQAYGVPGEVLVAIWGLETDFGVNVGKFPTIRSLATLAYDCRRAEQFRGELLDALRIVD 169

Query: 181 KGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G +      GA  GEIGQ QF+P + +KYA+D D +GK DL++S  D +AS A +L   
Sbjct: 170 RGDLQPAEMRGAWAGEIGQTQFMPSSWIKYAVDFDGNGKRDLIRSAPDVLASTANYLKGY 229

Query: 240 GWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           GW K   ++PG  NFA+++ WN S  Y +TIA  A  +   P
Sbjct: 230 GWQKGKDWEPGSPNFAVIQQWNKSEVYARTIATFATQLAHAP 271


>gi|300024543|ref|YP_003757154.1| lytic murein transglycosylase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526364|gb|ADJ24833.1| lytic murein transglycosylase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 281

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 95/283 (33%), Positives = 151/283 (53%), Gaps = 6/283 (2%)

Query: 1   MSFKK-YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMS 59
           M     +  I+ L +   + +   +       Q  C +    F  W    ++RA  +G+ 
Sbjct: 1   MRLNSSFSRIASLRVALVLASLCASATAGVAAQ--CGNGPQGFDAWLQGFKSRAAAQGIK 58

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
           P+T     + + Y  T I  DR   +   +SF+ +     +  +I +G +L + +   L 
Sbjct: 59  PETVSRALSGVTYDPTVIRLDRSQHS-FKLSFQQFYARRVNGALINRGKSLMRTHRATLD 117

Query: 120 NLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDL 178
            ++K +GVP  +++A+WGLETH+G     +  +L +LATLAYDCRR++FFT Q   A+ +
Sbjct: 118 RIEKRFGVPGAVIVAIWGLETHYGADASARYSILRSLATLAYDCRRSEFFTGQLLDAIRI 177

Query: 179 VKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLA 237
           V +G +S   + G   GEIGQ QFLP   V+YA+D D +G  DLV+S  D +AS A FLA
Sbjct: 178 VGRGDLSPSQMRGGWAGEIGQTQFLPTPYVRYAVDFDGNGHRDLVRSVPDILASTANFLA 237

Query: 238 KLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             GW +   +QPG  N+ ++  WN +  Y +TIA +A  + G 
Sbjct: 238 SHGWQRGGSWQPGSANYGVIGQWNKAEVYQRTIAAMATQLAGG 280


>gi|182680266|ref|YP_001834412.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636149|gb|ACB96923.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 283

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 89/284 (31%), Positives = 145/284 (51%), Gaps = 6/284 (2%)

Query: 1   MSFKKYLLISLLMMVYP---MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREG 57
           M  +    +S  +        LA ++           C      F  +    +  A  +G
Sbjct: 1   MESRPGFPLSGAVPSTISGVALAASLMLGLSPAHAATC-RDPRGFEAFLDDMKHEASAQG 59

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRL 117
           +S  T      ++ Y  + +++D         SF+ +   + SS  + +G AL K  + +
Sbjct: 60  ISSSTIASALDNVSYDPSIVSKDHGQH-VFRQSFEQFSGRMVSSYRLHKGAALIKQYAGV 118

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
              +++++GVP  I++A+WGLET FG   G TP    LATLA+DCRR+  F  +   AL 
Sbjct: 119 FNRIEQQFGVPAPIIVAIWGLETDFGAVNGNTPTFRALATLAFDCRRSPMFQSELIDALR 178

Query: 178 LVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           +V++G +      GA  GEIGQ QF+P +  K+A+D   +G+ DL+    D +AS A FL
Sbjct: 179 VVQRGDLPPSAMRGAWAGEIGQTQFMPSSYYKFAVDFSGNGRRDLIHDVPDVLASTANFL 238

Query: 237 AKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
           +  GW + AG+ PG+ NF ++K WN +  Y++TIAY A  ++G 
Sbjct: 239 SSYGWKRGAGWAPGQPNFPVIKEWNKADVYSRTIAYFATRLNGG 282


>gi|116254440|ref|YP_770278.1| hypothetical protein RL4716 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115259088|emb|CAK10199.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 273

 Score =  240 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 109/272 (40%), Positives = 157/272 (57%), Gaps = 1/272 (0%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
            ++  ++     A A+     A     C + +  F  W +  +  A   G+S       F
Sbjct: 2   RMTTFLLAAFTAACALHALPAAAQGAQCGNNSSGFNAWVADFKQEAAANGVSRSVLDRAF 61

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A++ Y   TIA DR   +   +SF  ++     + II++G ++K +N  L  ++++ +GV
Sbjct: 62  ANVNYNRPTIAADRGQKS-FKLSFDAFMQKRGGATIISRGRSMKASNKALFASIERRFGV 120

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G L+A+WG+ET FG  MG    LS ++TLAYDCRR ++FT+Q + AL LV +G +S  
Sbjct: 121 PAGPLIAIWGMETGFGSYMGNQHTLSAVSTLAYDCRRTEYFTDQLYAALQLVAEGYLSPQ 180

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           A GA  GEIGQ QFLP NVV++  D D DG++D+V S  DA+AS A FL   GW   AGY
Sbjct: 181 AKGAAHGEIGQTQFLPRNVVRFGADGDGDGRVDMVGSRADALASTANFLKGHGWRAGAGY 240

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           QPGE NF  ++ WNA+  Y + IAYI   IDG
Sbjct: 241 QPGEPNFVAIQGWNAASVYQQAIAYIGQQIDG 272


>gi|241206916|ref|YP_002978012.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860806|gb|ACS58473.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 290

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 112/275 (40%), Positives = 158/275 (57%), Gaps = 2/275 (0%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQ-FICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           +L+      +    A  V     A  Q   C + +  FG W +  +  A   G+S     
Sbjct: 16  FLMRMTTFFLAAFTAAGVLHALPAAAQGAQCGNNSSGFGAWVADFKQEAAANGVSRSVLD 75

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             FA++ Y   TIA DR   +   +SF  ++     + +I++G ++K AN  L  ++++ 
Sbjct: 76  RAFANVNYNRPTIAADRGQKS-FKLSFDAFMQKRGGATVISRGRSMKAANKALFASIERR 134

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           +GVP G L+A+WG+ET FG  MG    LS ++TLAYDCRR+ +FT+Q + AL LV +G +
Sbjct: 135 FGVPAGPLVAIWGMETGFGSYMGNQHTLSAVSTLAYDCRRSDYFTDQLYAALQLVSEGYL 194

Query: 185 SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           S  A GA  GEIGQ QFLP NVV++  D D DG++D+V S  DA+AS A FL   GW   
Sbjct: 195 SPQAKGAAHGEIGQTQFLPRNVVRFGADGDGDGRVDMVGSRADALASTANFLKGHGWRAG 254

Query: 245 AGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           AGYQPGE NF  ++ WNA+  Y + IAYI   IDG
Sbjct: 255 AGYQPGEPNFVAIQGWNAASVYQQAIAYIGQQIDG 289


>gi|222150224|ref|YP_002551181.1| hypothetical protein Avi_4364 [Agrobacterium vitis S4]
 gi|221737206|gb|ACM38169.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 316

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 105/269 (39%), Positives = 149/269 (55%), Gaps = 2/269 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                  A A     +A     C +T+  F +W    +  AV  G+S       FA++ Y
Sbjct: 50  FFAIAFTALATLATAQAANAAQCGNTSAGFEQWVEGFKREAVGRGISQSVLDRSFANVRY 109

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF +++       II++G ++K+AN+ L  ++++ +GVP G +
Sbjct: 110 NVPTIRADRGQKS-FKLSFDEFMKKRGGQTIISRGKSMKRANAPLFASIERRFGVPAGPI 168

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  MG    LS ++TL YDCRR+ +F EQ + AL LV  G +  ++ GA 
Sbjct: 169 IAIWGMETGFGSYMGNEHTLSAVSTLTYDCRRSDYFREQLYAALKLVADGDLDVNSRGAA 228

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLP NV  Y +D D D  IDL+ S  DA++S A FL   GW    GYQPGE 
Sbjct: 229 HGEIGQTQFLPKNVTLYGVDGDGDRHIDLIHSRADALSSTANFLKGHGWQPGLGYQPGEP 288

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           NF+ +  WNA+  Y + IAYI   ID  P
Sbjct: 289 NFSAIGGWNAATVYQQAIAYIGKQID-AP 316


>gi|159185238|ref|NP_355437.2| hypothetical protein Atu2489 [Agrobacterium tumefaciens str. C58]
 gi|159140500|gb|AAK88222.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 271

 Score =  238 bits (608), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 109/271 (40%), Positives = 157/271 (57%), Gaps = 1/271 (0%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +  +  +   +A              C +T+  F  W SA +  A   G+S       F+
Sbjct: 1   MRAMKAILAGVAMVSVLAATPVMAAQCGNTSAGFDAWVSAFKQEAAGRGVSASVLDRAFS 60

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
            + Y   TI  DR   +   +SF+ ++       II++G  +KK N+ L  ++++ YGVP
Sbjct: 61  GVSYNQATIRADRGQHS-FKLSFEQFMQKRGGQTIISRGKTMKKNNAALFASIERTYGVP 119

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
            G L+A+WG+ET FG  MG    LS +ATL++DCRR+ +FTEQ + AL LV  G ++ +A
Sbjct: 120 AGPLLAIWGMETGFGGFMGNQHTLSAVATLSFDCRRSDYFTEQLYAALKLVGSGSLNVNA 179

Query: 189 LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            GA  GEIGQ QFLP+NVV+Y +D D DG+IDLV S  DA+AS A FL   GW + AGYQ
Sbjct: 180 KGAAHGEIGQTQFLPLNVVRYGVDFDRDGRIDLVGSRADALASTANFLVGHGWQRGAGYQ 239

Query: 249 PGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            G+ +FA ++ WNA+  Y + IA+I   IDG
Sbjct: 240 QGQPSFAAIQGWNAASVYQQAIAFIGKAIDG 270


>gi|260432642|ref|ZP_05786613.1| membrane-bound lytic murein transglycosylase B [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416470|gb|EEX09729.1| membrane-bound lytic murein transglycosylase B [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 374

 Score =  238 bits (607), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 90/312 (28%), Positives = 147/312 (47%), Gaps = 34/312 (10%)

Query: 9   ISLLMMVYPMLAQAV--TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHL 66
           +  L +   +L      T   +AT   +       +  W +  +ARA  +G+S  T    
Sbjct: 1   MFTLGLGSGVLTACAGGTTENRATVSRMKPVPNSGWDAWVAGFKARAAGQGISRSTIDRA 60

Query: 67  FADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYG 126
           F    YL   I RDR  V     S +DYL   +S E I +G  + + ++  L  ++  YG
Sbjct: 61  FQGAGYLPGVIERDRNQVE-FKRSLEDYLAIAASDERINKGRQMLQRHNGTLTQIESRYG 119

Query: 127 VPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS 186
           V   I++A+WGLE+ +GE  G  P++S L+TLAYD RR  FF +Q   AL +++ G  + 
Sbjct: 120 VDKEIVVAIWGLESRYGERRGDVPVISALSTLAYDGRRGAFFEKQLIAALKILQNGDTTP 179

Query: 187 -HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKC 244
            +  G+  G +G  QF+P + + YA+D   DG+ D+      D++AS A +L++ GW + 
Sbjct: 180 ENMTGSWAGAMGHTQFIPTSYLAYAVDFTGDGRRDIWSDDPTDSLASTAAYLSRAGWVRG 239

Query: 245 AGY------------------QPGEK--------NFAILKHWNASLNYNKTIAYIAAHID 278
             +                  QP +         NF ++K +N S +Y   + ++A  I 
Sbjct: 240 QPWGGEVGSPAASSGTPVAILQPQKPGPRIAVFRNFQVIKRYNNSDSYAIGVGHLADRIA 299

Query: 279 GVPIGK---GYD 287
           G P  +   G D
Sbjct: 300 GGPPFRASFGPD 311


>gi|190893955|ref|YP_001980497.1| membrane-bound lytic murein transglycosylase [Rhizobium etli CIAT
           652]
 gi|190699234|gb|ACE93319.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CIAT 652]
 gi|327191231|gb|EGE58274.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CNPAF512]
          Length = 274

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 110/275 (40%), Positives = 156/275 (56%), Gaps = 2/275 (0%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
             +  L +     +      P  A     C +T+  F  W +  +  A   G+S      
Sbjct: 1   MRMTKLFLAAAAAIGVLHAVPAFAQGP-QCGNTSAGFDAWVADFKQTAAANGVSQSVLSR 59

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
            FA++ Y   TIA DR   +   +SF  ++     + +I++G ++K AN  L  ++++ +
Sbjct: 60  AFANVNYNKPTIAADRGQKS-FKLSFDAFMQKRGGAAVISRGRSMKAANQALFASIERRF 118

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GVP G L+A+WG+ET FG  MG    LS ++TLAYDCRR+ +FT+Q + AL LV +G +S
Sbjct: 119 GVPAGPLIAIWGMETGFGSYMGNQHTLSAVSTLAYDCRRSDYFTDQLYAALQLVSEGYLS 178

Query: 186 SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245
             A GA  GEIGQ QFLP NVV++  D D DG++D+V S  DA+AS A FL   GW   A
Sbjct: 179 PQAKGAAHGEIGQTQFLPRNVVRFGADGDGDGRVDMVGSRADALASTANFLKGHGWRAGA 238

Query: 246 GYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
           GYQPGE NF  ++ WNA+  Y + IAYI   IDG 
Sbjct: 239 GYQPGEPNFVAIQGWNAASVYQQAIAYIGQQIDGG 273


>gi|86359679|ref|YP_471571.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CFN 42]
 gi|86283781|gb|ABC92844.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CFN 42]
          Length = 274

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 112/269 (41%), Positives = 157/269 (58%), Gaps = 2/269 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQ-FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           + +    A  V Q   A  Q   C +T+  F  W +  +  A   G+S       FA++ 
Sbjct: 6   LFLAAAAAMGVLQAVPAFAQGPQCGNTSAGFDAWVADFKQTAAANGVSQSVLSRAFANVN 65

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y   TIA DR   +   +SF  ++     + +I++G ++K AN  L  ++++ +GVP G 
Sbjct: 66  YNKPTIAADRGQKS-FKLSFDAFMQKRGGAAVISRGRSMKAANQALFASIERRFGVPAGP 124

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGA 191
           L+A+WG+ET FG  MG    LS ++TLAYDCRR+ +FT+Q + AL LV +G +S  A GA
Sbjct: 125 LIAIWGMETGFGSYMGNQHTLSAVSTLAYDCRRSDYFTDQLYAALQLVSEGYLSPQAKGA 184

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             GEIGQ QFLP NVV++  D D DG++D+V S  DA+AS A FL   GW   AGYQPGE
Sbjct: 185 AHGEIGQTQFLPRNVVRFGADGDGDGRVDMVGSRADALASTANFLKGHGWRAGAGYQPGE 244

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  ++ WNA+  Y + IAYI   IDG 
Sbjct: 245 PNFTAIQGWNAASVYQQAIAYIGQQIDGG 273


>gi|307316137|ref|ZP_07595581.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|306897977|gb|EFN28719.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
          Length = 273

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 112/265 (42%), Positives = 153/265 (57%), Gaps = 2/265 (0%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
              L   V  P  A +   C +    F  W S  +  A   G+SP       A++ Y   
Sbjct: 11  LAALISTVVLPA-AASAAQCGNDGSGFSAWLSEFKREAAGNGISPSVVDQALANVSYSRA 69

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
           TI  DR   +   +S   ++       II++G  L+  N+RL  ++++ YGVP G L+A+
Sbjct: 70  TIRADRGQKS-FKLSLDQFMQKRGGQVIISRGKKLRAQNARLFQSIEQRYGVPAGPLIAI 128

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGE 195
           WG+ET FG  +GK   LS ++TLAYDCRR+ +FT Q + AL LV++G +S  A GA  GE
Sbjct: 129 WGMETGFGSFLGKEHTLSAVSTLAYDCRRSDYFTNQLYAALQLVERGDLSPAARGAAHGE 188

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFA 255
           IGQ QFLPVNV+KY +D D +G +D+V+S  DA+AS A FL   GW    GYQPGE NFA
Sbjct: 189 IGQTQFLPVNVLKYGVDGDGNGHVDMVRSKADALASTANFLRGHGWQPGGGYQPGEVNFA 248

Query: 256 ILKHWNASLNYNKTIAYIAAHIDGV 280
            ++ WNA+  Y + IA I A IDG 
Sbjct: 249 AIQGWNAASVYQQAIAIIGAEIDGG 273


>gi|15967070|ref|NP_387423.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Sinorhizobium meliloti 1021]
 gi|307302532|ref|ZP_07582289.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
 gi|15076343|emb|CAC47896.1| Membrane-bound lytic murein transglycosylase [Sinorhizobium
           meliloti 1021]
 gi|306903202|gb|EFN33792.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
          Length = 273

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 112/265 (42%), Positives = 153/265 (57%), Gaps = 2/265 (0%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
              L   V  P  A +   C +    F  W S  +  A   G+SP       A++ Y   
Sbjct: 11  LAALISTVVLPA-AASAAQCGNDGSGFSAWLSEFKREAAGNGISPSVVDQALANVSYSRA 69

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
           TI  DR   +   +S   ++       II++G  L+  N+RL  ++++ YGVP G L+A+
Sbjct: 70  TIRADRGQKS-FKLSLDQFMQKRGGQMIISRGKKLRAQNARLFQSIEQRYGVPAGPLIAI 128

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGE 195
           WG+ET FG  +GK   LS ++TLAYDCRR+ +FT Q + AL LV++G +S  A GA  GE
Sbjct: 129 WGMETGFGSFLGKEHTLSAVSTLAYDCRRSDYFTNQLYAALQLVERGDLSPAARGAAHGE 188

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFA 255
           IGQ QFLPVNV+KY +D D +G +D+V+S  DA+AS A FL   GW    GYQPGE NFA
Sbjct: 189 IGQTQFLPVNVLKYGVDGDGNGHVDMVRSKADALASTANFLRGHGWQPGGGYQPGEVNFA 248

Query: 256 ILKHWNASLNYNKTIAYIAAHIDGV 280
            ++ WNA+  Y + IA I A IDG 
Sbjct: 249 AIQGWNAASVYQQAIAIIGAEIDGG 273


>gi|209551480|ref|YP_002283397.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209537236|gb|ACI57171.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 273

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 110/274 (40%), Positives = 157/274 (57%), Gaps = 2/274 (0%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
             +  L +     +      P  A     C +T+  F  W +  +  A   G+S      
Sbjct: 1   MRMTKLFLAAAAAMGVLHAVPAFAQGP-QCGNTSAGFEAWVADFKQTAAANGVSQAVLSR 59

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
            FA++ Y   TIA DR   +   +SF  ++     + +I++G ++K AN  L  ++++ +
Sbjct: 60  AFANVNYNKPTIAADRGQKS-FKLSFDAFMQKRGGTAVISRGRSMKAANQALFASIERRF 118

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GVP G L+A+WG+ET FG  MG    LS ++TLAYDCRR+ +FT+Q + AL LV +G +S
Sbjct: 119 GVPAGPLIAIWGMETGFGSYMGNQHTLSAVSTLAYDCRRSDYFTDQLYAALQLVSEGYLS 178

Query: 186 SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245
             A GA  GEIGQ QFLP NVV++  D D DG++D+V S  DA+AS A FL   GW   A
Sbjct: 179 PQAKGAAHGEIGQTQFLPRNVVRFGADGDGDGRVDMVGSRADALASTANFLKGHGWRAGA 238

Query: 246 GYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           GYQPGE NF  ++ WNA+  Y ++IAYI   IDG
Sbjct: 239 GYQPGEPNFVAIQGWNAASVYQQSIAYIGQQIDG 272


>gi|316935455|ref|YP_004110437.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
 gi|315603169|gb|ADU45704.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
          Length = 272

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 85/264 (32%), Positives = 136/264 (51%), Gaps = 2/264 (0%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
              +  A+     +      +     F  + S+  A A + G+S          +     
Sbjct: 6   LAFVTCALGGALLSAAPAEAARCGGDFNTFVSSISAEAAQAGVSQSVISQALGGVTPDPA 65

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            +A DR+   +   +F+ Y+        I  G A+   ++ LL  +++++GVPP I++A+
Sbjct: 66  VLAFDRRQRGTFNKTFEQYVATRVGPGRIKTGRAMLMRHASLLSRVERQFGVPPQIVVAI 125

Query: 136 WGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATF 193
           WGLE+ FG+  MGK P+   LAT+A+DCRR + F  +   AL +V++G ++    +GA  
Sbjct: 126 WGLESDFGKGDMGKLPVFRVLATMAHDCRRTELFQGELLAALQIVQRGDLTLRDMVGAYA 185

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GE+GQ QFLP + +KY +D D +G +DL  S  D +AS A  L   GW     Y+ G  N
Sbjct: 186 GELGQTQFLPSSYIKYGVDFDGNGHVDLRHSVPDVLASTANLLKTAGWKAGGSYEEGTAN 245

Query: 254 FAILKHWNASLNYNKTIAYIAAHI 277
           F  ++ WN +L Y KTIAY A  +
Sbjct: 246 FEAMREWNRALVYRKTIAYFADRL 269


>gi|27379835|ref|NP_771364.1| hypothetical protein blr4724 [Bradyrhizobium japonicum USDA 110]
 gi|27352988|dbj|BAC49989.1| blr4724 [Bradyrhizobium japonicum USDA 110]
          Length = 274

 Score =  235 bits (600), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 90/263 (34%), Positives = 141/263 (53%), Gaps = 5/263 (1%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
             ++   + A     C   +  F  W +  +  A  +G+S +      A +    + + R
Sbjct: 16  TTSILSAQPALAAVACG--SGNFDAWLADFKTDAAAKGISQQAIAAGLAGVTLDQSVLNR 73

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR        +F++   G      + +G  + K    +L  +++ YGVP  +L+A+WGLE
Sbjct: 74  DRSQ-KVFTQTFEE-FSGRMVPPRMTRGSNMMKQYGSVLSRIEQTYGVPGEVLVAIWGLE 131

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQ 198
           T FG   GK   + +LATLAYDCRRA+ F  +   AL +V++G ++     GA  GE+GQ
Sbjct: 132 TDFGVNTGKFATIRSLATLAYDCRRAEQFRGELMDALRIVQRGDLAPADMKGAWAGELGQ 191

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILK 258
            QF+P + +KYA+D D +GK DL+ +  D +AS A +LA  GW +   +QPG  NFA+L+
Sbjct: 192 TQFMPSSWMKYAVDFDGNGKRDLLHNAPDVLASTANYLAGYGWQRGKDWQPGSPNFAVLQ 251

Query: 259 HWNASLNYNKTIAYIAAHIDGVP 281
            WN S  Y+KT+AY A  +   P
Sbjct: 252 QWNKSEVYSKTVAYFATQLARAP 274


>gi|39934378|ref|NP_946654.1| lytic murein transglycosylase [Rhodopseudomonas palustris CGA009]
 gi|192289901|ref|YP_001990506.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
 gi|39648227|emb|CAE26746.1| putative transglycolase [Rhodopseudomonas palustris CGA009]
 gi|192283650|gb|ACF00031.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
          Length = 272

 Score =  235 bits (599), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 88/269 (32%), Positives = 142/269 (52%), Gaps = 2/269 (0%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           +L +   ++  A+     +T     +     F  + ++  A A + G+S          +
Sbjct: 1   MLKLRLALVTCALGGALLSTAPAEAARCGGDFNSFIASFSADAAQAGISQGVISQALGGV 60

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
                 +A DR+   +   SF+ Y+     +  I  G A+   ++ LL  +++++GVPP 
Sbjct: 61  TEDPGVLAFDRRQRGTFNKSFEQYVSTRVGAGRIKAGRAMLMRHASLLSRIERQFGVPPQ 120

Query: 131 ILMALWGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHA 188
           I++A+WGLET +G+  MGK P+   LATLA+DCRR + F  +   AL ++++G ++    
Sbjct: 121 IVVAIWGLETDYGKGDMGKLPVFRVLATLAHDCRRTELFQGELLAALQILQRGDLTLRDM 180

Query: 189 LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +GA  GEIGQ QFLP + +KY +D D +G +DL  S  D +AS A  L   GW     Y+
Sbjct: 181 VGAYAGEIGQTQFLPSSYIKYGVDYDGNGHVDLRHSVPDVLASTANLLKSAGWKAGGSYE 240

Query: 249 PGEKNFAILKHWNASLNYNKTIAYIAAHI 277
            G  NF  ++ WN +L Y KTIAY A  +
Sbjct: 241 EGSANFEAMREWNRALVYRKTIAYFADKL 269


>gi|325293843|ref|YP_004279707.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
 gi|325061696|gb|ADY65387.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
          Length = 259

 Score =  235 bits (598), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 108/257 (42%), Positives = 150/257 (58%), Gaps = 1/257 (0%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
                       C +T+  F  W  A +  A   G+S       F+ + Y   TI  DR 
Sbjct: 3   SVLAATPVVAAQCGNTSAGFDAWVGAFKQEAASRGVSASVLDRAFSGVSYNQPTIRADRG 62

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
             +   +SF  ++       II++G  +KK N+ L  +++K YGVP G L+A+WG+ET F
Sbjct: 63  QHS-FKLSFDQFMQKRGGQTIISRGKTMKKNNAALFASIEKAYGVPAGPLLAIWGMETGF 121

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFL 202
           G  MG    LS +ATL++DCRR+ +FTEQ + AL LV  G ++ +A GA  GEIGQ QFL
Sbjct: 122 GGFMGNQHTLSAVATLSFDCRRSDYFTEQLYAALKLVGSGSLNVNAKGAAHGEIGQTQFL 181

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNA 262
           P+NVV+Y +D D DG+IDLV S  DA+AS A FL   GW + AGYQ G+ N+A ++ WNA
Sbjct: 182 PLNVVRYGVDFDRDGRIDLVGSRADALASTANFLVGHGWQRGAGYQQGQTNYAAIQGWNA 241

Query: 263 SLNYNKTIAYIAAHIDG 279
           +  Y + IA+I   IDG
Sbjct: 242 ASVYQQAIAFIGKAIDG 258


>gi|86751226|ref|YP_487722.1| lytic murein transglycosylase [Rhodopseudomonas palustris HaA2]
 gi|86574254|gb|ABD08811.1| Lytic murein transglycosylase [Rhodopseudomonas palustris HaA2]
          Length = 272

 Score =  235 bits (598), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 87/266 (32%), Positives = 141/266 (53%), Gaps = 2/266 (0%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
             +L+ A+     A      +     F  + ++  A A + G+S          +     
Sbjct: 6   LALLSCAIGCALLAAAPAQAARCGGDFNAFIASMSAEAAQAGVSRDVISEALGGVTPDPA 65

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            +A DR+   +   +F+ Y+     +  I  G A+ + ++ LL  +++++GVPP IL+A+
Sbjct: 66  VLAFDRRQRGTFNKTFEQYVATRVGAGRIKSGRAMLQRHASLLSRIERQFGVPPQILVAI 125

Query: 136 WGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATF 193
           WGLE+ FG+  +GK P+   LAT+A+DCRR + F  +   AL +V++G ++    +GA  
Sbjct: 126 WGLESDFGKGDIGKLPVFRVLATMAHDCRRTELFQGELLAALKIVQRGDLTMRDMVGAYA 185

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GE+GQ QFLP + +KY +D D +G +DL  S  D +AS A  L   GW     Y+ G  N
Sbjct: 186 GELGQTQFLPSSYIKYGVDFDGNGHVDLRHSVPDVLASTANLLKTAGWRAGGSYEEGTPN 245

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDG 279
           F  ++ WN +L Y KTIAY A  + G
Sbjct: 246 FEAMREWNRALVYRKTIAYFADQLIG 271


>gi|75676622|ref|YP_319043.1| lytic murein transglycosylase [Nitrobacter winogradskyi Nb-255]
 gi|74421492|gb|ABA05691.1| lytic murein transglycosylase [Nitrobacter winogradskyi Nb-255]
          Length = 272

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 86/253 (33%), Positives = 129/253 (50%), Gaps = 2/253 (0%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
           +T    +     F  + +     A   G+S          +      ++ DR+   +   
Sbjct: 20  STAVSAAQCGGDFDTFVAEMSREAAANGVSQGVISQALGGVHQDQAVLSFDRRQRGTFRK 79

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGK 148
           SF+ Y+    +   I  G A+   +  LL  ++K++GVPP I++A+WGLET FG   MGK
Sbjct: 80  SFEQYVATRVTGGRIKGGKAMLTRHGSLLSRIEKQFGVPPEIIVAIWGLETDFGRGDMGK 139

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVV 207
            P+   LAT+A+DCRR + F  +   AL +V++G +  S  +GA  GEIGQ QFLP + +
Sbjct: 140 LPVFRVLATMAHDCRRTELFQRELLAALRIVQRGDLRLSDMVGAYAGEIGQTQFLPSSYI 199

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYN 267
           KY +D D +G +DL  S  D +AS A  L   GW     Y  G  NF +++ WN S  Y 
Sbjct: 200 KYGVDFDGNGHVDLRHSVPDVLASTANLLKVNGWKAGGDYHQGSPNFEVMREWNRSEIYR 259

Query: 268 KTIAYIAAHIDGV 280
           +TI Y A  + G 
Sbjct: 260 RTIGYFADKLAGR 272


>gi|328545779|ref|YP_004305888.1| Lytic murein transglycosylase [polymorphum gilvum SL003B-26A1]
 gi|326415519|gb|ADZ72582.1| Lytic murein transglycosylase [Polymorphum gilvum SL003B-26A1]
          Length = 273

 Score =  233 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 96/263 (36%), Positives = 138/263 (52%), Gaps = 2/263 (0%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
           +  L               C D    F  W  A +  A   G+   T +   A + Y   
Sbjct: 10  FAPLVSLCLFFVPPAAAARCGDGPAGFPVWLEAFKREAPGHGLKGHTVEAALAGVTYDPQ 69

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            +  DR   +   +SF+ +      + +IA+G  L +  + LL  ++K YGVPP +L+A+
Sbjct: 70  VVRLDRSQKS-FKLSFEQFYARRVDNAMIARGQRLARDYAGLLGRIEKTYGVPPAVLIAI 128

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFG 194
           WGLET +G   GK  +L +LATLAYDCRR+ FFT +   AL +V++G ++     GA  G
Sbjct: 129 WGLETGYGANSGKMSVLRSLATLAYDCRRSAFFTNELVAALKIVQRGDMAPAEMRGAWAG 188

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNF 254
           EIGQ QFL  + + YA+D D DG+ DL++S  D +AS A +L   GW     + PG  N 
Sbjct: 189 EIGQTQFLASSYLNYAVDGDRDGRRDLIRSVPDVLASTANYLKAKGWRAGQPWGPGTANH 248

Query: 255 AILKHWNASLNYNKTIAYIAAHI 277
           A+LK WN +  Y KTIA +A  I
Sbjct: 249 AVLKEWNRAEVYVKTIAVMAEKI 271


>gi|296448573|ref|ZP_06890446.1| lytic murein transglycosylase [Methylosinus trichosporium OB3b]
 gi|296253913|gb|EFH01067.1| lytic murein transglycosylase [Methylosinus trichosporium OB3b]
          Length = 276

 Score =  233 bits (594), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 100/281 (35%), Positives = 146/281 (51%), Gaps = 6/281 (2%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           MS   +    +L     +     +    A     C  +A+ F  W  + +  A   G+S 
Sbjct: 1   MSGHSHFRGIVLAAALLV----GSGAGAAEGGVDCGRSAEGFEPWLDSFKREAAAAGISQ 56

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
              +  FAD+ Y  + I+ DR        SF+ +   +++S  I +G  L + ++ L   
Sbjct: 57  HAIQASFADVYYDRSVISHDRGQ-KVFRQSFEQFSARMANSFRINKGRQLLQRHAGLFRQ 115

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +++ YGVP  +L+A+WGLET FG   G    +  LATLAYDCRRA+ F  +   AL +V 
Sbjct: 116 IEQRYGVPGPVLVAIWGLETDFGSFNGSFATIRALATLAYDCRRAERFRGELLDALRIVD 175

Query: 181 KGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G +S     GA  GEIGQ QF+P + +K+A+D + DG  DLV    D +AS A FL   
Sbjct: 176 RGDLSPDKMRGAWAGEIGQTQFMPSSYLKFAVDFNGDGSRDLVHDTADVLASTANFLHGS 235

Query: 240 GWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
           GW   AG+  GE NF +L  WN +  Y+KTIA +A  IDG 
Sbjct: 236 GWKAGAGWDEGEPNFPVLLEWNKAKVYSKTIALLADRIDGR 276


>gi|56698438|ref|YP_168812.1| peptidoglycan-binding protein, putative [Ruegeria pomeroyi DSS-3]
 gi|56680175|gb|AAV96841.1| peptidoglycan-binding protein, putative [Ruegeria pomeroyi DSS-3]
          Length = 385

 Score =  233 bits (593), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 84/312 (26%), Positives = 139/312 (44%), Gaps = 33/312 (10%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATT----QFICSDTADRFGEWKSAARARAVRE 56
           M  +++  + L  +                     Q   +     +  W +  R+RA  +
Sbjct: 1   MINRRFFTLGLGALSLSACGGGAPLTASTPAAAPAQSWPTVPNAGWEAWVAGFRSRASAQ 60

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G++  T    F    ++   I RDR        S +DYL   +S E IA G  + + +  
Sbjct: 61  GINATTLDRAFRGAGFIPKVIERDRNQTE-FKRSLEDYLAIAASDERIATGRQMLQQHGA 119

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           LL  ++  YGV   I+ A+WGLE+ +G   G  P++S L+TLAYD RR  FF +Q   AL
Sbjct: 120 LLTRIEAHYGVDKEIVTAIWGLESRYGARRGDVPIVSALSTLAYDGRRGAFFEKQLIAAL 179

Query: 177 DLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAK 234
            +++ G  S  +  G+  G +G  QF+P + + YA+D   DG+ D+      DA+AS A 
Sbjct: 180 KILQNGDTSPQNMTGSWAGAMGHTQFIPTSYLAYAVDFTGDGRRDIWSEDPTDALASTAA 239

Query: 235 FLAKLGWTKCAGY------------------QPGEK--------NFAILKHWNASLNYNK 268
           +LA  GW +   +                  QP E         NF+++K +N S +Y  
Sbjct: 240 YLANAGWVRGQPWGGEVGSAAANSGSPSAVLQPQEPGPKIAVFKNFSVIKRYNNSDSYAI 299

Query: 269 TIAYIAAHIDGV 280
            + +++  + G 
Sbjct: 300 GVGHLSDRLKGG 311


>gi|91978426|ref|YP_571085.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisB5]
 gi|91684882|gb|ABE41184.1| Lytic murein transglycosylase [Rhodopseudomonas palustris BisB5]
          Length = 272

 Score =  232 bits (591), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 87/266 (32%), Positives = 136/266 (51%), Gaps = 2/266 (0%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
             +   AV     A      +     F  + SA  A A + G+S          +     
Sbjct: 6   LALKICAVGGALLAAAPAQAARCGGDFNTFMSAFSAEAAQAGVSQGVISQALGGVTPDPA 65

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            +A DR+   +   +F+ Y+        I  G A+ + ++ LL  +++++GVPP I++A+
Sbjct: 66  VLAFDRRQRGTFNKTFEQYVATRVGPGRIKTGRAMLQRHASLLSRIERQFGVPPQIVVAI 125

Query: 136 WGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATF 193
           WGLE+ FG+  +GK P+   LAT+A+DCRR + F  +   AL +V++G +     +GA  
Sbjct: 126 WGLESDFGKGDIGKLPVFRVLATMAHDCRRTELFQGELLAALKIVQRGDLELRDMVGAYA 185

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GE+GQ QFLP + +KY +D D +G +DL  S  D +AS A  L   GW     Y+ G  N
Sbjct: 186 GELGQTQFLPSSYIKYGVDFDGNGHVDLRHSVPDVLASTANLLKTAGWRAGGSYEEGTPN 245

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDG 279
           F  ++ WN +L Y KTI Y A  + G
Sbjct: 246 FEAMREWNRALVYRKTIGYFADQLVG 271


>gi|254511690|ref|ZP_05123757.1| peptidoglycan binding domain protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221535401|gb|EEE38389.1| peptidoglycan binding domain protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 344

 Score =  232 bits (590), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 84/279 (30%), Positives = 135/279 (48%), Gaps = 29/279 (10%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
               +  W +  + RA  +G+S  T    F    YL   I RDR  V     S +DYL  
Sbjct: 5   PNAGWDAWVAGFKTRAAAQGISQTTLNRAFQGAGYLPEVIERDRNQVE-FKRSLEDYLAI 63

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
            +S E I+ G  +   ++  L  ++ +YGV   I++A+WGLE+ +G   G  P++S  +T
Sbjct: 64  AASDERISTGKQMLARHAATLSQIEAKYGVDKEIVVAVWGLESRYGARRGDVPVISATST 123

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADED 216
           LAYD RR  FF +Q   AL ++++G  S  +  G+  G +G  QF+P + + YA+D   D
Sbjct: 124 LAYDGRRGAFFEKQLLAALQIIQEGDTSPANMTGSWAGAMGHTQFIPTSYLAYAVDFTGD 183

Query: 217 GKIDLVK-SNIDAIASAAKFLAKLGWTKCAGYQ------------------PG-----EK 252
           G+ D+      D++AS A +LA+ GW +   +                   PG      +
Sbjct: 184 GRRDIWSEDPADSLASTAAYLARAGWVRGQPWGGEVGTVSGTPVAVLQPQMPGPRIAVFR 243

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVPIGK---GYDT 288
           NF ++K +N S +Y   + ++A  I G P  +   G D 
Sbjct: 244 NFQVIKRYNNSDSYAIGVGHLADRIAGGPPFQASFGPDA 282


>gi|163757436|ref|ZP_02164525.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Hoeflea phototrophica DFL-43]
 gi|162284938|gb|EDQ35220.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Hoeflea phototrophica DFL-43]
          Length = 272

 Score =  231 bits (589), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 116/278 (41%), Positives = 163/278 (58%), Gaps = 7/278 (2%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ K   L  +L     +LA  ++ P  +     C + +  F  W    +  A R G+S 
Sbjct: 1   MTIKSGKL--MLWSAATLLAMGLSTPAMSAQ---CGNNSAGFPAWIEQFKKEAARAGISD 55

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +T    FA++ Y   TI+ DR   +   +SF+ ++    ++ II+QG  LK+ N+RL   
Sbjct: 56  RTISRAFANVRYASKTISLDRNQRS-FKLSFEQFMQKRGANSIISQGKKLKQRNARLFNA 114

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           L+++YGVP G L+A+WG+E+ FG   G    +S +ATLAYDCRR+ FFTEQ +  L L++
Sbjct: 115 LEQKYGVPAGPLIAIWGMESGFGRFSGNQHTMSAVATLAYDCRRSAFFTEQLYAQLQLIQ 174

Query: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           KG +S    GA  GEIGQ QFLP NVV++ +D D +G I+L  S  DA+AS A FL   G
Sbjct: 175 KGWLSPDFKGAAHGEIGQTQFLPANVVRFGVDGDRNGSINL-GSTADALASTANFLRGHG 233

Query: 241 WTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
           W +  GYQPGE NF  +K WNA+  Y K IA I A ID
Sbjct: 234 WKRGGGYQPGETNFRAIKGWNAAGVYQKAIAKIGAEID 271


>gi|299131994|ref|ZP_07025189.1| lytic murein transglycosylase [Afipia sp. 1NLS2]
 gi|298592131|gb|EFI52331.1| lytic murein transglycosylase [Afipia sp. 1NLS2]
          Length = 280

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 93/273 (34%), Positives = 141/273 (51%), Gaps = 7/273 (2%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
            +SLL +    L         +  Q         F  + S     AV  G+SP      F
Sbjct: 11  KLSLLALSLGFLGAGGLMSSASAAQ-----CGGDFNAFVSTFSREAVAAGISPSVVSQSF 65

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A +      +  DR+   +   +F+ Y+     ++ I  G  + + N+ LL  +++ +GV
Sbjct: 66  AGVTEDPEVLRFDRRQRYTFNKTFEQYVSTRVGAQRIKSGRFMMQKNASLLSRIEQRFGV 125

Query: 128 PPGILMALWGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS 186
           PP I++A+WGLE+ FG+  MGK P++ TLATLA+DCRR + F  +   AL +V++G +  
Sbjct: 126 PPQIIVAIWGLESDFGKGDMGKRPVIKTLATLAHDCRRTELFQGELLAALKIVQRGDLRL 185

Query: 187 HA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245
              +GA  GEIGQ QFLP + +KY +D D +G +DL  S  D +AS A  L   G+   A
Sbjct: 186 DDLVGAFAGEIGQTQFLPSSYIKYGVDFDGNGHVDLRHSVPDVLASTANLLHTSGFKAGA 245

Query: 246 GYQPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
            Y  G  NF  ++ WN ++ Y KTIAY A  + 
Sbjct: 246 DYHEGSANFDAMREWNRAVIYRKTIAYFADKLA 278


>gi|254474002|ref|ZP_05087395.1| lytic murein transglycosylase [Pseudovibrio sp. JE062]
 gi|211956891|gb|EEA92098.1| lytic murein transglycosylase [Pseudovibrio sp. JE062]
          Length = 288

 Score =  229 bits (584), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 87/253 (34%), Positives = 135/253 (53%), Gaps = 2/253 (0%)

Query: 28  KATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSP 87
            +     C DT   F  W ++ +     +G+S  T     + + Y    I  DR   +  
Sbjct: 37  SSAQAATCGDTGAGFDRWLASYKNTLQSQGISKATINKSLSGITYNRKVIGYDRNQKS-F 95

Query: 88  PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
            +SF+++     ++ +I +G  L K ++ L   ++ E+GVP  I+ A+WGLET +G  +G
Sbjct: 96  KLSFEEFYKLRVNNALINKGRKLMKKHNALFTRIENEFGVPREIITAIWGLETGYGRGIG 155

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNV 206
           K   +  LATLAYDCRRA FF  + ++AL +V+KG +      GA  GE+GQ QFL  + 
Sbjct: 156 KMNTIRALATLAYDCRRADFFRNELYHALLIVQKGDLQPSEMKGAWAGELGQTQFLASSY 215

Query: 207 VKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNY 266
           +K+AID   DGK DL+ +  D +AS A FL   GW     + PG  N+ +++ WN +  Y
Sbjct: 216 IKFAIDYSGDGKRDLLYNTADTLASTAHFLMSYGWQPGQPWGPGTPNYEVIRSWNRAGVY 275

Query: 267 NKTIAYIAAHIDG 279
            KTI  +A  +  
Sbjct: 276 VKTIQIMAEKLSN 288


>gi|218677792|ref|ZP_03525689.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CIAT 894]
          Length = 285

 Score =  228 bits (582), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 106/273 (38%), Positives = 152/273 (55%), Gaps = 4/273 (1%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
             +  L +     +      P  A     C +T+  F  W +  +  A   G+S      
Sbjct: 1   MRMTKLFLAAAAAMGVLHAVPAFAQGP-QCGNTSAGFDAWVADFKQTAAANGVSQSVLSR 59

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
            FA++ Y   TIA DR   +   +SF  ++     + +I++G ++K AN  L  ++++ +
Sbjct: 60  AFANVNYNKPTIAADRGQKS-FKLSFDAFMQKRGGAAVISRGRSMKAANQALFASIERRF 118

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GVP G L+A+WG+ET FG  MG    LS ++TLAYDCRR+++FT+Q + AL LV +G +S
Sbjct: 119 GVPAGPLIAIWGMETGFGSYMGNQHTLSAVSTLAYDCRRSEYFTDQLYAALQLVSEGYLS 178

Query: 186 SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245
             A GA  GEIGQ QFLP NVV++  D D DG++D+V S  DA+AS A FL   GW   A
Sbjct: 179 PQAKGAAHGEIGQTQFLPRNVVRFGADGDGDGRVDMVGSRADALASTANFLKGHGWRAGA 238

Query: 246 GYQPGEKNFAILKHWNASLNYNKTIAYI--AAH 276
           GYQPGE NF  ++ WNA+  Y   IA    A  
Sbjct: 239 GYQPGEPNFVAIQGWNAASVYQHAIALYRPADR 271


>gi|86138137|ref|ZP_01056712.1| peptidoglycan-binding protein, putative [Roseobacter sp. MED193]
 gi|85825164|gb|EAQ45364.1| peptidoglycan-binding protein, putative [Roseobacter sp. MED193]
          Length = 394

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 84/289 (29%), Positives = 139/289 (48%), Gaps = 24/289 (8%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           + +    K      +       + +W      RA  +G++  T +  F +  YL   + R
Sbjct: 40  SASRPVAKPGLPADLQPTPNAGYDKWVEGFYTRAQAKGITEATLRTGFRNAGYLPGVVKR 99

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR        + +DYL    S E +++G A  + + + L+ L+ +YGV   I+ A+WGLE
Sbjct: 100 DRNQTE-FKRTLEDYLSIAVSDERVSKGRAAYQKHRKTLLALEAKYGVDASIIAAIWGLE 158

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQ 198
           + +GE  G  P++S  +TLAYD RR  FF +Q   AL +++ G IS++ + G+  G +G 
Sbjct: 159 SFYGERRGDLPVVSATSTLAYDGRRGAFFEKQLIAALKILQNGDISANKMTGSWAGAMGH 218

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAKFLAKLGWTKCAGY---------- 247
            QF+P +   +A+D   DG+ D+      DA+AS A +LA+ GWT+   +          
Sbjct: 219 TQFIPTSYQAFAVDFTGDGRRDIWSEDPTDALASTAAYLARNGWTRGQSWGREVTGAAAA 278

Query: 248 -----QPGEK------NFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
                Q G        NF  +K +N S  Y   + ++A  I G P  +G
Sbjct: 279 GALQPQAGGPSFAVTGNFKAIKRYNNSDAYAIGVGHLADRIAGGPPLRG 327


>gi|115523066|ref|YP_779977.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
 gi|115517013|gb|ABJ04997.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
          Length = 269

 Score =  228 bits (581), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 80/246 (32%), Positives = 128/246 (52%), Gaps = 2/246 (0%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
                F  + +     A   G+S          +      ++ DR+   +   +F+ Y+ 
Sbjct: 23  RCGGDFQGFVAEMSREAAAAGISQGVINAALGGVTQDPAVLSFDRRQRGTFNKTFEQYIA 82

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTL 155
                  I  G A+ + ++ LL  +++++GVPP IL+A+WGLE+ FG+  +GK P++ TL
Sbjct: 83  TRVGPGRINTGRAMLQRHASLLSRIERQFGVPPEILVAIWGLESDFGKGDIGKMPVIRTL 142

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           AT+A+DCRR + F  +   AL +V++G +     +GA  GE+GQ QFLP + +KY +D D
Sbjct: 143 ATMAHDCRRTELFQGELLAALKIVQRGDLPLKDLIGAYAGELGQTQFLPSSYIKYGVDYD 202

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            +G +DL  S  D +AS A  L   GW     Y+ G  NF  ++ WN +  Y KTI Y A
Sbjct: 203 GNGHVDLRHSVPDVLASTANLLKTAGWRAGGSYEEGSANFEAMREWNRATIYRKTIGYFA 262

Query: 275 AHIDGV 280
             +   
Sbjct: 263 DRLAAG 268


>gi|84515467|ref|ZP_01002829.1| peptidoglycan-binding protein, putative [Loktanella vestfoldensis
           SKA53]
 gi|84510750|gb|EAQ07205.1| peptidoglycan-binding protein, putative [Loktanella vestfoldensis
           SKA53]
          Length = 311

 Score =  228 bits (580), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 82/299 (27%), Positives = 136/299 (45%), Gaps = 20/299 (6%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+  +  +I+ L         +       T   +       +  W +  R RA+ +G+S 
Sbjct: 1   MTTDRRFIIAALGASVLAGCASRRDTSGTTPPDLLPQRNAGYDAWVAGFRRRALAQGVSS 60

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T    F ++ +L   + RDR        + ++YL   +S E IA+G A    ++ +L  
Sbjct: 61  TTFDAAFQNVGFLPGVVTRDRNQTE-FRRTLQEYLAIAASDERIAKGRAAYARHASVLNA 119

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++  YGV   I+ A+WGLE+ +G   G  P+++  +TLAY+ RR  FF  Q   AL +++
Sbjct: 120 IEARYGVNRYIVTAIWGLESFYGARQGNIPVIAATSTLAYEGRRGAFFEAQTLQALRILQ 179

Query: 181 KGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAKFLAK 238
            G IS     G+  G +G  QF+P    ++A+D   DG+ D+      DA+ASAA +LA+
Sbjct: 180 AGDISPARMTGSWAGAMGHTQFIPTTYAEFAVDFTGDGRRDIWAVDPSDALASAANYLAR 239

Query: 239 LGWTKCAGYQPGEK-----------------NFAILKHWNASLNYNKTIAYIAAHIDGV 280
            GW    G+                      NF  +K +N S  Y   + ++A  I G 
Sbjct: 240 SGWQTGIGWGRENPRGTLEPQRGGPRFTTTANFRAIKRYNNSDAYAIGVGHLADRIAGG 298


>gi|227823833|ref|YP_002827806.1| putative lytic murein transglycosylase [Sinorhizobium fredii
           NGR234]
 gi|227342835|gb|ACP27053.1| putative lytic murein transglycosylase [Sinorhizobium fredii
           NGR234]
          Length = 273

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 105/265 (39%), Positives = 155/265 (58%), Gaps = 3/265 (1%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
           +  +++ A+     +  Q  C   A  F  W +  +  A   G+S        A++ Y  
Sbjct: 11  LAALISTAILPAAASAAQ--CGSNAGGFSAWVAEFKREAAGNGISSSALNAALANVSYSR 68

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
            TI  DR   +   +S   ++       II++G  ++  N+ L  ++++ YGVP G L+A
Sbjct: 69  ATIRADRGQKS-FKLSLDQFMQKRGGQAIISRGRKMRAQNAGLFDSIEQRYGVPAGPLIA 127

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFG 194
           +WG+ET FG  MGK   LS ++TLAYDCRR+ +FT+Q + AL LV++G +S  A GA  G
Sbjct: 128 IWGMETGFGSFMGKEHTLSAVSTLAYDCRRSAYFTDQLYAALQLVERGDLSPAARGAAHG 187

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNF 254
           EIGQ QFLP+NV+K+ +D D +G +D+V+S  DA+AS A FL   GW    GYQPGE N+
Sbjct: 188 EIGQTQFLPLNVLKFGVDGDGNGHVDMVRSKADALASTANFLRGHGWQPGGGYQPGEVNY 247

Query: 255 AILKHWNASLNYNKTIAYIAAHIDG 279
           A ++ WNA+  Y + IA I A IDG
Sbjct: 248 AAIQGWNAASVYQQAIAIIGAEIDG 272


>gi|90422503|ref|YP_530873.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisB18]
 gi|90104517|gb|ABD86554.1| Lytic murein transglycosylase [Rhodopseudomonas palustris BisB18]
          Length = 269

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 82/245 (33%), Positives = 126/245 (51%), Gaps = 2/245 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
               F  + ++    A  +G+S          +      ++ DR+   +   SF+ Y+  
Sbjct: 24  CGGDFQTFVASISREAAAQGISQGVIAQALGGVTQDPAVLSFDRRQRGTFNKSFEQYVST 83

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLA 156
                 I  G A+   ++ LL  +++++GVPP IL+A+WGLET +G   MGK P+   LA
Sbjct: 84  RVGPGRIKTGQAMLIRHASLLSRIERQFGVPPQILVAIWGLETDYGTGDMGKLPVFRVLA 143

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           T+A+DCRR + F  +   AL +V++G +     +GA  GEIGQ QFLP + +KY +D D 
Sbjct: 144 TMAHDCRRTELFQGELLAALQIVQRGDLGLRDMVGAYAGEIGQTQFLPSSYIKYGVDFDG 203

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
           +G +DL  S  D +AS A  L   GW     Y+ G  NF  ++ WN +  Y KTI Y A 
Sbjct: 204 NGHVDLRHSVPDVLASTANLLKTAGWRAGGSYEEGSANFEAMREWNRATIYRKTIGYFAD 263

Query: 276 HIDGV 280
            +   
Sbjct: 264 RLARG 268


>gi|90420746|ref|ZP_01228652.1| lytic murein transglycosylase [Aurantimonas manganoxydans SI85-9A1]
 gi|90335037|gb|EAS48798.1| lytic murein transglycosylase [Aurantimonas manganoxydans SI85-9A1]
          Length = 275

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 98/280 (35%), Positives = 151/280 (53%), Gaps = 6/280 (2%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M  +    ++ L  +   LA  +           C ++   F +WK      AVR G+S 
Sbjct: 1   MKVR----LTSLRTLAASLALTIGLGAAPALAAQCGNSGGGFNQWKQEFAQEAVRAGISQ 56

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T +       Y +  I  DR   +   +S + ++   + +  + +G  + + N+ LL +
Sbjct: 57  GTVQSALMPTSYSNQVIKLDRNQHSM-NISLEAFMQRRAPASFVNKGKRIIQQNAGLLNS 115

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++K YGVP  I++A+WG+ET FG   G   + ++LATLAYDCRR+ FFTE+   AL +V 
Sbjct: 116 IEKSYGVPKEIIVAIWGMETGFGANSGSMNIFNSLATLAYDCRRSAFFTEELLAALAIVD 175

Query: 181 KGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G +    + GA  GEIGQ QFL  N +++A+D D +G+ DL+ S  D +AS A FL + 
Sbjct: 176 RGDMKPSQMKGAWAGEIGQTQFLAKNYLRFAVDGDGNGRRDLINSKADVLASTANFLRQH 235

Query: 240 GWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           GW   AGYQ GE NFAIL+ WN +  Y K +A  A+ +  
Sbjct: 236 GWRPGAGYQQGEPNFAILRDWNRAGVYQKALALFASKLAN 275


>gi|114563484|ref|YP_750997.1| lytic murein transglycosylase [Shewanella frigidimarina NCIMB 400]
 gi|114334777|gb|ABI72159.1| lytic murein transglycosylase [Shewanella frigidimarina NCIMB 400]
          Length = 415

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 92/342 (26%), Positives = 137/342 (40%), Gaps = 63/342 (18%)

Query: 1   MSFKKYL---LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREG 57
           M+ K+     + S+ +    + A AV+                 F       + +A   G
Sbjct: 1   MAHKRRFSVFIASMFVSSTLLSACAVSASPDPVADVTPVQEHPDFATCVINLQQKAKTAG 60

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRL 117
           +S +      A+L+++   I  D +       SF DY +   +   + QG  +   +  L
Sbjct: 61  ISQQIIDTTVANLKFVPRVIELDNQQPE-FTTSFGDYFNKRVTPWRVEQGTKMMAKHGPL 119

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L  L KEYGVP   ++A WGLET+FG   G  P+L +LATLA D RR+ +FT +   AL 
Sbjct: 120 LAKLTKEYGVPGQYIVAFWGLETNFGSYKGSMPVLDSLATLACDPRRSDYFTGELLQALK 179

Query: 178 LVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           L ++     S  +G+  G +G  QF+P N  KYA+D D DG  DL  S +DA+ SAA FL
Sbjct: 180 LKQQYNFADSKMVGSWAGAMGHTQFMPTNYRKYAVDGDGDGIADLWNSEVDALTSAANFL 239

Query: 237 AKLGWTKCAG--------------------------YQP--------------------- 249
             LGW                               +Q                      
Sbjct: 240 QHLGWKADERWGREVLLPVDYPFAYLGGKHPLPLVKWQELNIKQANGQPLSTPDMQAALY 299

Query: 250 -----------GEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                      G  NF ++  WN S  Y   + ++A  I+G 
Sbjct: 300 LPAGHTGPAFLGYDNFNVIMRWNRSEFYAIAVGHLADRINGS 341


>gi|163732767|ref|ZP_02140212.1| peptidoglycan binding domain protein [Roseobacter litoralis Och
           149]
 gi|161394127|gb|EDQ18451.1| peptidoglycan binding domain protein [Roseobacter litoralis Och
           149]
          Length = 376

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 81/304 (26%), Positives = 140/304 (46%), Gaps = 25/304 (8%)

Query: 1   MSFKKYLLISLLMMVY-PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMS 59
           M+ + +   +L + +     + +++    A    +       +  W +  + RA   G+S
Sbjct: 3   MTRRNFNFGALALAISGCAASPSLSPSTTALPDDLRPIPNSAYDVWVANFQQRARTAGIS 62

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
             T +  F    YL   + RDR        S +DYL    S E +AQG   ++  + +L 
Sbjct: 63  DDTLRRAFQGTGYLPGVVRRDRNQTE-FKRSLEDYLSIAVSDERVAQGRDARRQYASVLE 121

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            L+  YGV   I+ A+WGLE+ +G   G  P++S  +TLA+D RR  FF +Q   AL +V
Sbjct: 122 TLEARYGVDANIITAIWGLESFYGARRGNVPVVSATSTLAFDGRRGAFFEKQLIEALRIV 181

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLA 237
           + G I++   +G+  G +G  QF+P +   +A+D   DG+ D+      DA+ASAA +L 
Sbjct: 182 QSGDITADRLVGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWSDDPSDALASAAAYLE 241

Query: 238 KLGWTKCAGYQPG---------------------EKNFAILKHWNASLNYNKTIAYIAAH 276
           + GW +   +                         +NF ++K +N S  Y   + +++  
Sbjct: 242 RNGWVRGQRWGNEVTGASSGTIIQPQENGPRFAVNQNFRVIKRYNNSDAYAIGVGHLSDR 301

Query: 277 IDGV 280
           I G 
Sbjct: 302 IAGR 305


>gi|146338449|ref|YP_001203497.1| putative transglycolase [Bradyrhizobium sp. ORS278]
 gi|146191255|emb|CAL75260.1| conserved hypothetical protein; putative transglycolase
           [Bradyrhizobium sp. ORS278]
          Length = 271

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 91/267 (34%), Positives = 138/267 (51%), Gaps = 2/267 (0%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
             +L  A      A      +     F  + +   A A   G+S  T     + +     
Sbjct: 5   LALLFAASFSAYVAAGSAQAARCGGDFNTFIANVSAEAQSAGVSAGTVSQALSGVTLDPA 64

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            +A DR+   +   SF+ Y+     +  +  G A+ + ++ LL  ++++YGVP  IL+A+
Sbjct: 65  VLAFDRRQRYTFNKSFEQYVSTRVGAGRVNGGRAMLQRHAALLSKIEQQYGVPRQILVAI 124

Query: 136 WGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATF 193
           WGLET FG+  MGK P++ TLATLA+DCRR + F  +   AL +V++G +     +GA  
Sbjct: 125 WGLETDFGKGDMGKLPVIRTLATLAHDCRRTELFQTELLAALKIVERGDLGLRDLIGAFA 184

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GEIGQ QFLP + +KY +D D DG++DL  S  D +AS A  L   G+     Y  G  N
Sbjct: 185 GEIGQTQFLPSSYIKYGVDFDGDGRVDLRHSTADVLASTANLLHSNGFKMGQPYDEGSAN 244

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDGV 280
           F  ++ WN ++ Y KTI Y A  + G 
Sbjct: 245 FDAMREWNRAVIYRKTIGYYADQLMGR 271


>gi|126740201|ref|ZP_01755890.1| peptidoglycan-binding protein, putative [Roseobacter sp. SK209-2-6]
 gi|126718656|gb|EBA15369.1| peptidoglycan-binding protein, putative [Roseobacter sp. SK209-2-6]
          Length = 382

 Score =  227 bits (577), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 88/312 (28%), Positives = 135/312 (43%), Gaps = 31/312 (9%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQP------KKATTQFICSDTADRFGEWKSAARARAVREG 57
           ++     L        + +          K      +       +  W ++ + RA   G
Sbjct: 5   RRSFAFGLGAFGLAACSDSSVTTPGQPVVKPGLPADLRPVPNAGYDAWVASFQGRAQAAG 64

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRL 117
           +S  T +  F    YL   I RDR        + +DYL    S E + +G A  + +   
Sbjct: 65  ISDATFRAAFRGAGYLPGVIKRDRNQTE-FKRTLEDYLSIAVSDERLTKGRAAYQRHGGT 123

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L  L+ EYGV   I+ A+WGLE+ +GE  G  P++S  +TLAYD RR  FF +Q   AL 
Sbjct: 124 LRRLEAEYGVAAEIITAIWGLESFYGERRGDVPVISATSTLAYDGRRGSFFEKQLIAALK 183

Query: 178 LVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAKF 235
           +++ G IS     G+  G +G  QF+P +   YA+D   DG+ D+      DA+AS A +
Sbjct: 184 ILQNGDISPARMTGSWAGAMGHTQFIPTSYQAYAVDFTGDGRRDIWSEDPSDALASTAAY 243

Query: 236 LAKLGWTKCAGY----------------QPGEK------NFAILKHWNASLNYNKTIAYI 273
           LA+ GWT+   +                Q G        NF  +K +N S  Y   + ++
Sbjct: 244 LARNGWTRGLRWGGEAGAGAPSGTVIQPQEGGPKFAVTSNFRAIKRYNNSDAYAIGVGHL 303

Query: 274 AAHIDGVPIGKG 285
           A  I G    +G
Sbjct: 304 ADRIAGAGPLRG 315


>gi|254466552|ref|ZP_05079963.1| putative transglycolase [Rhodobacterales bacterium Y4I]
 gi|206687460|gb|EDZ47942.1| putative transglycolase [Rhodobacterales bacterium Y4I]
          Length = 410

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 93/318 (29%), Positives = 144/318 (45%), Gaps = 34/318 (10%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATT------QFICSDTADRFGEWKSAARARAV 54
           M+  +      L   + + A + T P   ++        +       +  W +A R+RA 
Sbjct: 30  MNITRRHFGFGLA-AFGLTACSSTVPAGGSSRSTGLPADLRPVPNAGYDRWVAAFRSRAE 88

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+S  T +  F    YL   I RDR        S +DYL    S E +A+G A    +
Sbjct: 89  ARGISQFTLRAAFRGAGYLPGVIKRDRNQTE-FKRSLEDYLSIAVSDERLAKGRAAFARH 147

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
              L  L++ YGV   I+ A+WGLE+ FGE  G  P++S  +TLAYD RR  FF +Q   
Sbjct: 148 GATLQALERAYGVDAEIICAIWGLESFFGERRGDVPVISATSTLAYDGRRGAFFEKQLLA 207

Query: 175 ALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASA 232
           AL++++ G I+     G+  G +G  QF+P +   +A+D   DG+ D+      DA+AS 
Sbjct: 208 ALNILQSGDITPARMTGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWSEDPSDALAST 267

Query: 233 AKFLAKLGWTKCAGYQ-----PGEK------------------NFAILKHWNASLNYNKT 269
           A +L + GWT+   +      PG                    NF  +K +N S  Y   
Sbjct: 268 AAYLQRNGWTRGLKWGGEAGAPGTPAGRILQPQAGGPKFAVTSNFNAIKRYNNSDAYAIG 327

Query: 270 IAYIAAHID-GVPIGKGY 286
           + ++A  I  G P+  G+
Sbjct: 328 VGHLADRIAGGGPLRTGF 345


>gi|148257979|ref|YP_001242564.1| hypothetical protein BBta_6768 [Bradyrhizobium sp. BTAi1]
 gi|146410152|gb|ABQ38658.1| hypothetical protein BBta_6768 [Bradyrhizobium sp. BTAi1]
          Length = 272

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 135/246 (54%), Gaps = 2/246 (0%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
                F  + ++  A A   G+S  T     + +      +A DR+   +   SF+ Y+ 
Sbjct: 27  RCGGDFNTFVASFSAEAQSAGVSSATISQALSGVTLDPAVLAFDRRQRYTFNKSFEQYVA 86

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTL 155
                  I  G A+ + ++ LL  ++++YGVP  IL+A+WGLET FG+  MGK P++ TL
Sbjct: 87  TRVGPGRINGGRAMLQRHAALLSRIEQQYGVPRQILIAIWGLETDFGKGDMGKLPVIRTL 146

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA+DCRR + F  +   AL +V++G ++    +GA  GEIGQ QFLP + +KY +D D
Sbjct: 147 ATLAHDCRRTELFQTELMAALKIVERGDLTLRDLIGAFAGEIGQTQFLPSSYIKYGVDFD 206

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++DL  S  D +AS A  L   G+   A Y  G  NF  ++ WN ++ Y KTI Y A
Sbjct: 207 GDGRVDLRHSTADVLASTANLLHSNGFKMGAPYDEGSANFDAMREWNRAVIYRKTIGYFA 266

Query: 275 AHIDGV 280
             + G 
Sbjct: 267 DQLVGR 272


>gi|260577199|ref|ZP_05845175.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259020579|gb|EEW23899.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 271

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 98/274 (35%), Positives = 146/274 (53%), Gaps = 3/274 (1%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
              + L   + P++   +     A     C +T+  F  WK+     A   G+  +    
Sbjct: 1   MRFVFLHKFIMPIITAVLLTSAPAAQAATCGNTSSGFEAWKAEMADEAASAGVGKRGI-A 59

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
                 Y   TI  DR   +    +   +L    +  I++QG      +     +L++ +
Sbjct: 60  ALMGASYATRTIGADRNQKS-FKYTLAKFLQVRGADTIVSQGRKRLAQSPEFYASLERRF 118

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GVP G+++A+ G+ET FG  MG + ++S +ATLAYDCRR +FFT     AL LV +G IS
Sbjct: 119 GVPAGVVIAIHGMETGFGGFMGDSNVVSAIATLAYDCRRTEFFTGHLLAALKLVDQGTIS 178

Query: 186 SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245
           +  +GA  GE+G  QFLP NV++Y +D D DG+IDL  +  DA+AS A +LA  GW   A
Sbjct: 179 AATIGAKHGEVGHTQFLPGNVLRYGVDGDGDGRIDL-SNQSDALASTANYLAAKGWRPGA 237

Query: 246 GYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           G+Q GE NFA++K WNA+  Y + IA + A I G
Sbjct: 238 GFQKGEPNFAVIKEWNAATVYQEAIAIMGARIGG 271


>gi|85715945|ref|ZP_01046922.1| lytic murein transglycosylase [Nitrobacter sp. Nb-311A]
 gi|85697143|gb|EAQ35024.1| lytic murein transglycosylase [Nitrobacter sp. Nb-311A]
          Length = 272

 Score =  226 bits (576), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 87/252 (34%), Positives = 127/252 (50%), Gaps = 2/252 (0%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
           +T    +     F  + SA    A  +G+S          ++     +  DR+   +   
Sbjct: 20  STDVSAAQCGGDFNGFVSAMSREAAADGISQNVISQALGGVQRDQAVLNFDRRQRGTFRK 79

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGK 148
           SF+ Y     +   I  G A+   +  LL  ++K++GVPP I++A+WGLET FG   MGK
Sbjct: 80  SFEQYAATRVTGGRIKGGKAMLARHGSLLSRIEKQFGVPPEIVVAIWGLETDFGRGDMGK 139

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVV 207
            P+   LAT+A+DCRR + F  +   AL +V++G +     +GA  GEIGQ QFLP + +
Sbjct: 140 LPVFRVLATMAHDCRRTELFQRELLAALKIVQRGDLRLGDMIGAYAGEIGQTQFLPSSYI 199

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYN 267
           KY ID D +G +DL  S  D +AS A  L   GW     Y  G  NF  ++ WN S  Y 
Sbjct: 200 KYGIDFDGNGHVDLRHSVPDVLASTANLLRVNGWKAGGDYHQGSANFEAMREWNRSEVYR 259

Query: 268 KTIAYIAAHIDG 279
           +TI   A  + G
Sbjct: 260 RTIGLFADKLAG 271


>gi|92118361|ref|YP_578090.1| lytic murein transglycosylase [Nitrobacter hamburgensis X14]
 gi|91801255|gb|ABE63630.1| Lytic murein transglycosylase [Nitrobacter hamburgensis X14]
          Length = 272

 Score =  225 bits (573), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 87/271 (32%), Positives = 131/271 (48%), Gaps = 2/271 (0%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           +L     +                 +     F  + SA    A  +G+S          +
Sbjct: 1   MLRYGLALTVGVWLAGGLLGGAAQAAQCGGDFNGFLSAMSREAAADGISQGVISQALGGV 60

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
           +     +  DR+   +   SF+ Y      +  I  G A+   ++ LL  ++K++GVPP 
Sbjct: 61  QQDQAVLNFDRRQRGTFRKSFEQYAATRVGAGRIKGGKAMLMRHASLLSRIEKQFGVPPE 120

Query: 131 ILMALWGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHA 188
           IL+A+WGLE+ FG   MGK P+   LAT+A+DCRR + F  +   AL +V++G +  +  
Sbjct: 121 ILVAIWGLESDFGRGDMGKLPVFRVLATMAHDCRRTELFQRELLAALKIVQRGDLRLNDM 180

Query: 189 LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +GA  GEIGQ QFLP + +KY +D D +G +DL  S  D +AS A  L   GW     Y 
Sbjct: 181 VGAYAGEIGQTQFLPSSYIKYGVDYDGNGHVDLRHSVPDVLASTANLLRANGWKAGGDYH 240

Query: 249 PGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            G  NF  ++ WN S  Y +TI Y A  + G
Sbjct: 241 QGSANFEAMREWNRSEVYRRTIGYFADKLAG 271


>gi|209884285|ref|YP_002288142.1| lytic murein transglycosylase [Oligotropha carboxidovorans OM5]
 gi|209872481|gb|ACI92277.1| lytic murein transglycosylase [Oligotropha carboxidovorans OM5]
          Length = 271

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 91/275 (33%), Positives = 143/275 (52%), Gaps = 7/275 (2%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
              +  L++ + +          A  Q         F  + S+    A+  G+SP     
Sbjct: 1   MRKLFGLVISFGLFGAISAATPAAAAQ-----CGGDFNSFISSFSREAIAAGISPNVVSQ 55

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
             A + +    ++ DR+   +   SF++Y     S++ I  G  + + N+ LL  ++K +
Sbjct: 56  ALAGVTHDPAVLSFDRRQRGTFKKSFEEYAATRVSAQRIKSGRLMLQKNASLLSRIEKRF 115

Query: 126 GVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           GVPP I++A+WGLET +G+  MGK  ++ TLATLA+DCRR + F  +   AL +V++G +
Sbjct: 116 GVPPEIIVAIWGLETDYGKGDMGKRSVIRTLATLAHDCRRTELFQGELLAALKIVQRGDL 175

Query: 185 SSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
               + GA  GEIGQ QFLP + +KY +D D +G +DL  S  D +AS A  L   G+  
Sbjct: 176 RLDDMVGAFAGEIGQTQFLPSSYIKYGVDFDGNGHVDLRHSVPDVLASTANLLHVSGFKN 235

Query: 244 CAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
            A Y  G  NF  ++ WN ++ Y KTIAY A  + 
Sbjct: 236 GADYHEGSANFEAMREWNRAVIYRKTIAYFADKLA 270


>gi|27382455|ref|NP_773984.1| hypothetical protein bll7344 [Bradyrhizobium japonicum USDA 110]
 gi|27355626|dbj|BAC52609.1| bll7344 [Bradyrhizobium japonicum USDA 110]
          Length = 268

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 88/265 (33%), Positives = 134/265 (50%), Gaps = 4/265 (1%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            + A           Q   +     F  + +   + A   G+S       F+ +      
Sbjct: 5   ALAAACFVGLAGGPAQA--ARCGGDFNGFVAGMASEAQGAGVSASVTSAAFSGITQDGAV 62

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           +A DR+   +   SF+ Y+        I  G AL + ++ LL  +++++GVP  IL+A+W
Sbjct: 63  LAFDRRQRYTFNKSFEQYVSTRVGPGRINGGKALLQRHAALLSRIEQQFGVPRYILVAIW 122

Query: 137 GLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFG 194
           GLE+ FG+  +GK P++ TLATLA+DCRR   F  +   AL +V++G +     +GA  G
Sbjct: 123 GLESDFGKGDIGKLPVIRTLATLAHDCRRTDLFQGELLAALKIVQRGDLPLRDLIGAYAG 182

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNF 254
           EIGQ QFLP + +KY +D D DG +DL  S  D +AS A  L   G+     Y  G  NF
Sbjct: 183 EIGQTQFLPSSYIKYGVDFDGDGHVDLRHSVPDVLASTANLLHTSGFKMGQPYGEGTANF 242

Query: 255 AILKHWNASLNYNKTIAYIAAHIDG 279
             ++ WN ++ Y KTI Y A  + G
Sbjct: 243 EAMREWNRAVIYRKTIGYFADRLAG 267


>gi|312114594|ref|YP_004012190.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219723|gb|ADP71091.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
          Length = 268

 Score =  224 bits (570), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 91/266 (34%), Positives = 133/266 (50%), Gaps = 6/266 (2%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            + A  ++ P        C      F  + +     AV  G+S                 
Sbjct: 5   IVAAVLLSLPVPVAQAAQCG---GDFSGFIAQVSRDAVAAGISRSVIDSGLGGAGLDQAV 61

Query: 77  IARDRKMVTSPP-VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
           +A DRK  +S    +F+ +         I +G  + + ++ LL  +++ +GVPP +++A+
Sbjct: 62  LAFDRKQRSSFSSPNFEAFAAKRVHPARIKRGREMLQRHAALLSRIQQRFGVPPQLVVAI 121

Query: 136 WGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATF 193
           WGLET FG   MG  P++ TLATLA+DCRR + F  +   AL +V++G +  S   GA  
Sbjct: 122 WGLETDFGSGDMGNRPVIRTLATLAWDCRRTELFQRELIAALKIVQRGDLPLSDLKGAYA 181

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GEIGQ QFLP + +KY +D D +G +DL  S  D +AS A  L   GW   A Y  G  N
Sbjct: 182 GEIGQTQFLPSSYIKYGVDFDGNGHVDLRHSVPDVLASTANLLKVNGWRAGASYGEGSAN 241

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDG 279
           F +L+ WN S  Y KTI Y A  + G
Sbjct: 242 FQVLREWNRSEVYRKTIVYFAGRLAG 267


>gi|78484843|ref|YP_390768.1| lytic murein transglycosylase [Thiomicrospira crunogena XCL-2]
 gi|78363129|gb|ABB41094.1| Lytic murein transglycosylase [Thiomicrospira crunogena XCL-2]
          Length = 409

 Score =  223 bits (567), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 91/344 (26%), Positives = 138/344 (40%), Gaps = 66/344 (19%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ K Y    +L   + +L        KA        +   F  W    +  A  +G+S 
Sbjct: 1   MTPKFYRHFFMLFTAFSILIG-----PKAYAYTPPPQSESDFQTWLVEFKKSAYEQGISK 55

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T K  F D+      +  DR+       +F  Y +   +   I  G  L +     L  
Sbjct: 56  TTLKKAFKDVHLNQRVLELDRRQPE-FTRTFWQYFNRAVTDWRIQTGQELYEKYRPQLRE 114

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           + ++YGVP   L+A WG+ET+FG   G TP++ +LATL+YD RR++FF ++   AL +++
Sbjct: 115 VTRKYGVPGRFLIAFWGMETNFGGYTGNTPIIESLATLSYDPRRSEFFQKELMAALKIIQ 174

Query: 181 KGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G I    + G+  G +GQ QF+P N +KYA+DAD+ GK DL  S  D   S   FL  L
Sbjct: 175 EGNIKPEQMKGSWAGAMGQCQFMPSNYLKYAVDADDSGKRDLWNSLDDVFHSMGNFLNTL 234

Query: 240 GWTKCAGYQPG-------------EKNFAILKHW-------------------------- 260
           GW K   +                 K    L+ W                          
Sbjct: 235 GWQKQENWGREVTLPEGFDLALADGKTERPLQEWKDMGLTLADGRELPVEDMKAKLLLPY 294

Query: 261 -------------------NASLNYNKTIAYIAAHIDG-VPIGK 284
                              N S +Y   + ++A  I G  P+ K
Sbjct: 295 DYRGPVFLVFHNFDVIKRWNRSDSYALAVGHLADRIVGRAPLSK 338


>gi|110678455|ref|YP_681462.1| peptidoglycan binding domain-containing protein [Roseobacter
           denitrificans OCh 114]
 gi|109454571|gb|ABG30776.1| peptidoglycan binding domain protein [Roseobacter denitrificans OCh
           114]
          Length = 377

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 81/297 (27%), Positives = 133/297 (44%), Gaps = 29/297 (9%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDT-----ADRFGEWKSAARARAVREGMSPKTAKHL 66
           L  +   L+     P          D         +  W ++ + RA   G++  T +  
Sbjct: 10  LGALALALSGCTASPTGRPATTALPDDLRPVRNSAYDAWVASFQQRARAAGITDDTLRRA 69

Query: 67  FADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYG 126
           F    YL   + RDR        S +DYL    S E +AQG   ++  + +L  L+  YG
Sbjct: 70  FQGTGYLPGVVRRDRNQTE-FKRSLEDYLSIAVSDERVAQGRDARRQYASVLETLEARYG 128

Query: 127 VPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS 186
           V   I+ A+WGLE+ +G   G  P++S  +TLA+D RR  FF +Q   AL +V+ G I++
Sbjct: 129 VDANIITAIWGLESFYGARRGNVPVVSATSTLAFDGRRGAFFEKQLIEALRIVQSGDITA 188

Query: 187 HA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKC 244
              +G+  G +G  QF+P +   +A+D   DG+ D+      DA+ASAA +L + GW + 
Sbjct: 189 DRLVGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWSDDPSDALASAAAYLERNGWVRG 248

Query: 245 AGYQPG---------------------EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             +                         +NF ++K +N S  Y   + +++  I G 
Sbjct: 249 QRWGNEVTGAASGTIIQPQENGPRFAVNQNFRVIKRYNNSDAYAIGVGHLSDRIAGR 305


>gi|110635671|ref|YP_675879.1| lytic murein transglycosylase [Mesorhizobium sp. BNC1]
 gi|110286655|gb|ABG64714.1| lytic murein transglycosylase [Chelativorans sp. BNC1]
          Length = 271

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 107/272 (39%), Positives = 155/272 (56%), Gaps = 14/272 (5%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           L + L +  P LA +            C +    F  WK+A    A   G S        
Sbjct: 14  LFAFLFLGSPALAAS------------CGNGGGGFEAWKAAFIQEAAARGASRTALD-AL 60

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A   Y   TIA DR       +S + ++    ++ II++G  +KK ++ L   +++++GV
Sbjct: 61  ARTSYATKTIAADRGQ-KGFKLSLESFMQKRGANVIISRGKTMKKRHAALFDRIERQFGV 119

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G L+A+WG+ET FG  MG    LS +ATLAYDCRR++FFT+  + AL L+ +G++S  
Sbjct: 120 PAGPLIAIWGMETGFGGFMGNQHTLSAVATLAYDCRRSEFFTDHLYAALTLIDRGMLSPA 179

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           A+GA  GEIGQ QFLP N +++A+D D +G+ID++ S  DA+AS A FL   GW   AGY
Sbjct: 180 AVGAAHGEIGQTQFLPGNALRFAVDGDGNGRIDMIGSTADALASTANFLRAHGWQPGAGY 239

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           Q G+ NF  ++ WNA+  Y + IA IA  IDG
Sbjct: 240 QQGQPNFVAIQGWNAASVYQQAIAIIAKEIDG 271


>gi|259415629|ref|ZP_05739550.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
 gi|259348859|gb|EEW60621.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
          Length = 380

 Score =  222 bits (565), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 80/295 (27%), Positives = 133/295 (45%), Gaps = 25/295 (8%)

Query: 10  SLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFAD 69
             L     +   +           +       + +W +  R RA R+G S       F  
Sbjct: 15  FGLASCTGVSTTSGPSGASGLAADLRPARNAGYDKWVADFRERAARQGFSQDLLSRAFRG 74

Query: 70  LEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPP 129
             YL   + RDR        + +DYL    S E +++G A    +   L  +++ YGV  
Sbjct: 75  TGYLPGVVKRDRNQTE-FSRTLEDYLSIAVSDERVSKGRAAYARHRATLDAIERRYGVEA 133

Query: 130 GILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HA 188
            ++ A+WGLE+++GE  G  P++S+ +TLAYD RR   F +Q   AL +++ G I+  + 
Sbjct: 134 HVVAAVWGLESYYGERRGNVPVISSTSTLAYDGRRGALFEKQLIAALKILRNGDIAPQNM 193

Query: 189 LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGY 247
            G+  G +G  QF+P + + +A+D   DG+ D+      DA+AS A +L++ GW K   +
Sbjct: 194 TGSWAGAMGHTQFIPTSYLSFAVDFTGDGRRDIWSDDPSDALASTAAYLSRNGWQKGVKW 253

Query: 248 ----------------QPGEK------NFAILKHWNASLNYNKTIAYIAAHIDGV 280
                           QPG        NF  LK +N S +Y   + +++  I G 
Sbjct: 254 GAENGPGAPSGSVIQPQPGGPQFVTTANFRALKRYNNSDSYAIGVGHLSDRIAGG 308


>gi|150398375|ref|YP_001328842.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
 gi|150029890|gb|ABR62007.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
          Length = 273

 Score =  221 bits (562), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 99/247 (40%), Positives = 146/247 (59%), Gaps = 1/247 (0%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           ++     + +   C +    F  W S  +  A   G++P   +   A++ Y   TI  DR
Sbjct: 16  SIAVLPGSASAAQCGNDGSGFSAWLSEFKREAAGNGINPSVVEQALANVSYSRATIRADR 75

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
              +   +S   ++       II++G  L+  N+RL  ++++ YGVP G L+A+WG+ET 
Sbjct: 76  GQKS-FKLSLDQFMQKRGGQVIISRGKKLRAQNARLFQSIEQRYGVPAGPLIAIWGMETG 134

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQF 201
           FG  +GK   LS ++TLAYDCRR+ +FT Q + AL LV++G +S  A GA  GEIGQ QF
Sbjct: 135 FGSFLGKEHTLSAVSTLAYDCRRSDYFTNQLYAALQLVERGDLSPAARGAAHGEIGQTQF 194

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWN 261
           LPVNV+KY +D D +G +D+V+S  DA+AS A FL   GW    GYQPG+ NFA ++ WN
Sbjct: 195 LPVNVLKYGVDGDGNGHVDMVRSKADALASTANFLRGHGWQPGGGYQPGQVNFAAIQGWN 254

Query: 262 ASLNYNK 268
           A+  Y +
Sbjct: 255 AASVYQQ 261


>gi|254438235|ref|ZP_05051729.1| lytic murein transglycosylase subfamily, putative [Octadecabacter
           antarcticus 307]
 gi|198253681|gb|EDY77995.1| lytic murein transglycosylase subfamily, putative [Octadecabacter
           antarcticus 307]
          Length = 398

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 84/314 (26%), Positives = 146/314 (46%), Gaps = 30/314 (9%)

Query: 1   MSF-KKYLLISLLMMVYPMLAQAVTQPKKATTQFICSD----TADRFGEWKSAARARAVR 55
           M+  +++ L +   +     A      +  T Q + +D        F +W +  ++RA  
Sbjct: 19  MNMNRRHFLATCATLSMAACAGNAPTAQLITAQDLPADLRPAQNAGFIDWVARFKSRAGS 78

Query: 56  EGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANS 115
            G+S  T    FAD  YL   +ARD   + +   + ++YL   +S E I +G A    ++
Sbjct: 79  AGISSATIDAAFADAGYLRGVVARDGSQIQT-RRTLEEYLSIATSDERIRKGRAAFSRHA 137

Query: 116 RLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYA 175
                ++ +YGV   I+ A+WG+E+ +GE  G+ P++S  ATLA+D RR  F+  Q   A
Sbjct: 138 TTFSAIETQYGVDAYIVAAIWGMESQYGEKRGQIPVISATATLAFDGRRGNFYESQLLAA 197

Query: 176 LDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAA 233
           L ++++G  +    +G+  G +G  QF+P +   +A+D   DG+ D+      DA+AS A
Sbjct: 198 LRILQRGDTTPAQLVGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWGDDPADALASTA 257

Query: 234 KFLAKLGWTKCAGYQPG----------------------EKNFAILKHWNASLNYNKTIA 271
            +LA+ GW     +                          +NF ++K +N S  Y   + 
Sbjct: 258 SYLARNGWRSGLKWGAEAGTDGPSGRTIQPQSGGVRFTVTRNFDVVKTYNNSDLYALGVG 317

Query: 272 YIAAHIDGVPIGKG 285
           Y+A  I G    +G
Sbjct: 318 YLADRIAGAGPLQG 331


>gi|118588715|ref|ZP_01546123.1| hypothetical protein SIAM614_18454 [Stappia aggregata IAM 12614]
 gi|118438701|gb|EAV45334.1| hypothetical protein SIAM614_18454 [Stappia aggregata IAM 12614]
          Length = 268

 Score =  220 bits (561), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 91/273 (33%), Positives = 152/273 (55%), Gaps = 8/273 (2%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
             L+S ++  + +L+              C +    F  WK A  A +   G+  +  + 
Sbjct: 1   MRLLSAVVFGFVLLSAPSAWSA------SCGNGPGGFEAWKQAFIANSQSYGLKQRVVES 54

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
              +++Y    ++ DR   +   +SF  +     ++ +I +G  L K  +R+   ++K+Y
Sbjct: 55  SLKNVKYSKKVVSLDRNQKS-FKLSFNQFYAKRVNNAMIRRGKQLGKTYARIFRGIEKKY 113

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK-KGVI 184
           GVP  I++++WGLET++G   G  P+L +LATLAYDCRR+ FFT +   AL +V+ + + 
Sbjct: 114 GVPAPIILSIWGLETNYGSFSGNMPVLQSLATLAYDCRRSDFFTAELIAALTIVQSRDMQ 173

Query: 185 SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
            +   GA  GE+GQ QFL  + V+YA+D D DG+ DL++S  D +AS A +LA+ GW + 
Sbjct: 174 PAEMKGAWAGELGQTQFLATSYVRYAVDYDRDGRKDLIRSIPDVLASTANYLAQKGWRRG 233

Query: 245 AGYQPGEKNFAILKHWNASLNYNKTIAYIAAHI 277
            G+ PG  N+ +LK WN +  Y +TI+ +A  I
Sbjct: 234 QGWGPGTANYNVLKQWNKASVYVETISVMAGQI 266


>gi|260433325|ref|ZP_05787296.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417153|gb|EEX10412.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 264

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 101/268 (37%), Positives = 150/268 (55%), Gaps = 4/268 (1%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           ++ +  +++     P  A     C +    F  WK+    +A + G+S +  +   A   
Sbjct: 1   MLRIAILVSALSGLPALAQAAP-CGNDGSGFEAWKTDFAKQARKAGVSKRGLQ-ALAQTR 58

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y   TIA DR   +    + + ++    +  I+AQG   K  N +    L+++YGVP GI
Sbjct: 59  YATGTIAADRNQKS-FKYTLEKFMRLRGADTIVAQGRKRKARNPQFYAALERQYGVPAGI 117

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGA 191
           L+A+ G+ET FG  MG + ++S + TLAYDCRR++FF      AL LV +G I+    GA
Sbjct: 118 LIAIHGMETGFGSFMGDSQVVSAITTLAYDCRRSEFFVPHAIGALKLVDQGSITMATKGA 177

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             GE+G  QFLP N ++Y +DA  DG++D   +  DA+AS A FL K GW    GYQPGE
Sbjct: 178 KHGELGHTQFLPGNALRYGVDATGDGRVDFY-NMTDALASTANFLRKKGWKPGRGYQPGE 236

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDG 279
            NFA+++ WNA+  Y + IA +AA IDG
Sbjct: 237 PNFAVIQQWNAASVYQQAIAIMAARIDG 264


>gi|254460521|ref|ZP_05073937.1| lytic murein transglycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206677110|gb|EDZ41597.1| lytic murein transglycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 375

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 86/310 (27%), Positives = 141/310 (45%), Gaps = 26/310 (8%)

Query: 1   MSF-KKYLLISLLMMVYPMLAQAVTQP-----KKATTQFICSDTADRFGEWKSAARARAV 54
           M+  ++   ++L           + Q             +       +  W ++ + RA 
Sbjct: 1   MTITRRTFALTLGAFGLSACRGTIAQTTSRSKSTGLAPDMRPQPNAGYDAWVASFKNRAS 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+S  T    F    YL   + RDR        S +DYL   +S E +++G A    +
Sbjct: 61  GYGLSSATIAAGFRGTGYLPGVVKRDRNQTE-FKRSLEDYLSIAASDERVSKGRAAFARH 119

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
              L  L+ +YGV   I+ A+WGLE+ FGE  G  P++S+ +TLA+D RR  FF +Q   
Sbjct: 120 RSTLNALETKYGVDATIICAIWGLESQFGERKGNIPVISSTSTLAFDGRRGAFFEKQLVA 179

Query: 175 ALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASA 232
           AL +++ G I++   LG+  G +G  QF+P +   +A+D   DG+ D+      DA+AS 
Sbjct: 180 ALKIIQNGDITADRLLGSWAGAMGHTQFMPTSYAGFAVDFTGDGRRDIWSADPSDALAST 239

Query: 233 AKFLAKLGWTKCAGY-----------QPGEK------NFAILKHWNASLNYNKTIAYIAA 275
           A +L + GW++   +           QPG        NF  +K +N S  Y   I +++ 
Sbjct: 240 AAYLQRNGWSRGVRWGAESSSGTLQPQPGGPKFSTTGNFRTIKRYNNSDAYAIGIGHLSD 299

Query: 276 HIDGVPIGKG 285
            I G    +G
Sbjct: 300 RIGGAGPLRG 309


>gi|163742343|ref|ZP_02149730.1| peptidoglycan-binding protein, putative [Phaeobacter gallaeciensis
           2.10]
 gi|161384293|gb|EDQ08675.1| peptidoglycan-binding protein, putative [Phaeobacter gallaeciensis
           2.10]
          Length = 370

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 86/304 (28%), Positives = 136/304 (44%), Gaps = 27/304 (8%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           + L        + ++ +        +       +  W +  R RA   G++  T    F 
Sbjct: 3   LGLGACSGGGTSTSLPRTAGGLPADLRPVPNAAYDAWVAGFRQRASAAGINNSTLNTAFR 62

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
              YL   I RDR        S +DYL   +S E +++G A    +   L  L++ YGV 
Sbjct: 63  GAGYLPGVIKRDRNQTE-FKRSLEDYLSIAASDERVSKGRAAYARHRSTLNALEQTYGVD 121

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SH 187
             I+ A+WGLE+ FGE  G  P++S  +TLA+D RR  FF +Q   AL +++ G IS + 
Sbjct: 122 AEIITAIWGLESFFGERRGDVPVISATSTLAFDGRRGAFFEKQLIAALKILQNGDISAAR 181

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAKFLAKLGWTKCAG 246
             G+  G +G  QF+P +   +A+D   DG+ D+      DA+AS A +LA+ GWT+   
Sbjct: 182 MTGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWSEDPSDALASTAAYLARNGWTRGLR 241

Query: 247 Y-----------------QPGEK------NFAILKHWNASLNYNKTIAYIAAHI-DGVPI 282
           +                 Q G        NF  +K +N S  Y   + ++A  I  G P+
Sbjct: 242 WGREVTGTAAASGTLIQPQAGGPKFAVTSNFRAIKRYNNSDAYAIGVGHLADRIGGGGPL 301

Query: 283 GKGY 286
              +
Sbjct: 302 RSSF 305


>gi|99078546|ref|YP_611804.1| lytic murein transglycosylase [Ruegeria sp. TM1040]
 gi|99035684|gb|ABF62542.1| putative peptidoglycan-binding protein [Ruegeria sp. TM1040]
          Length = 381

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 83/310 (26%), Positives = 140/310 (45%), Gaps = 31/310 (10%)

Query: 1   MSFKKYLLISLLMMVYPMLAQ------AVTQPKKATTQFICSDTADRFGEWKSAARARAV 54
           M+ +++  ++    +            +      +  Q +       + +W +A R RA 
Sbjct: 1   MNRRQFGAVAAAFGLASCAGPVTTAGRSRPSGTSSLPQDLRPIRNADYAKWVAAFRERAE 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
           R+G S       F    YL   + RDR        + +DYL    S E + +G A    +
Sbjct: 61  RQGFSQDLLSRAFRGTGYLPGVVKRDRNQTE-FSRTLEDYLSIAVSDERVRKGRAAYARH 119

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
              L  +++ YGV   ++ A+WGLE+++GE  G  P++S  +TLAYD RR   F +Q   
Sbjct: 120 RGTLDAIERRYGVEAHVIAAVWGLESYYGERRGNVPVISATSTLAYDGRRGALFEKQLIA 179

Query: 175 ALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASA 232
           AL +++ G I+  +  G+  G +G  QF+P + + +A+D   DG+ D+      DA+AS 
Sbjct: 180 ALKILRNGDIAPRNMTGSWAGAMGHTQFIPTSYLSFAVDFTGDGRRDIWSDDPSDALAST 239

Query: 233 AKFLAKLGWTKCAGY----------------QPGEK------NFAILKHWNASLNYNKTI 270
           A +LA+ GW K   +                QPG        NF  LK +N S +Y   +
Sbjct: 240 AAYLARNGWQKGLKWGGETGPGAPSGSVIQPQPGGPEFVTTGNFRALKRYNNSDSYAIGV 299

Query: 271 AYIAAHIDGV 280
            +++  I G 
Sbjct: 300 GHLSDRIAGG 309


>gi|254477979|ref|ZP_05091364.1| peptidoglycan binding domain protein [Ruegeria sp. R11]
 gi|214028564|gb|EEB69400.1| peptidoglycan binding domain protein [Ruegeria sp. R11]
          Length = 351

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 86/268 (32%), Positives = 127/268 (47%), Gaps = 26/268 (9%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
               +  W  A + RA+  G+S  T    F    YL   I RDR        S +DYL  
Sbjct: 14  PNAAYDAWVDAFKPRALAAGISQNTLNAAFRGTGYLHGVIKRDRNQTE-FKRSLEDYLSI 72

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
            +S E + +G A    +   L  L++ YGV   I+ A+WGLE+ FGE  G  P++S  +T
Sbjct: 73  AASDERVGKGRAAFARHRSTLAALEQAYGVDAEIIAAIWGLESFFGERKGDVPVISATST 132

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADED 216
           LA+D RR  FF +Q   AL ++++G I+     G+  G +G  QF+P +   +A+D   D
Sbjct: 133 LAFDGRRGAFFEKQLIAALRILQRGDITPARMTGSWAGAMGHTQFIPTSYQAFAVDFTGD 192

Query: 217 GKIDLVK-SNIDAIASAAKFLAKLGWTKCAGY-----------------QPGEK------ 252
           GK D+      DA+AS A +LA+ GWT+   +                 QPG        
Sbjct: 193 GKRDIWSEDPSDALASTAAYLARNGWTRGQAWGREITGDTSATGTVIQPQPGGPRFAVTG 252

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGV 280
           NF  +K +N S  Y   + ++A  I G 
Sbjct: 253 NFRAIKRYNNSDAYAIGVGHLADRIAGG 280


>gi|163739149|ref|ZP_02146561.1| peptidoglycan binding domain protein [Phaeobacter gallaeciensis
           BS107]
 gi|161387549|gb|EDQ11906.1| peptidoglycan binding domain protein [Phaeobacter gallaeciensis
           BS107]
          Length = 391

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 85/293 (29%), Positives = 134/293 (45%), Gaps = 27/293 (9%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           + ++ +        +       +  W +  R RA   G++  T    F    YL   I R
Sbjct: 35  STSLPRTAGGLPADLRPVPNAAYDAWVAGFRQRASAAGINNSTLNTAFRGAGYLPGVIKR 94

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR        S +DYL   +S E +++G A    +   L  L++ YGV   I+ A+WGLE
Sbjct: 95  DRNQTE-FKRSLEDYLSIAASDERVSKGRAAYARHRGTLNALEQTYGVDAEIITAIWGLE 153

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQ 198
           + FGE  G  P++S  +TLA+D RR  FF +Q   AL +++ G IS +   G+  G +G 
Sbjct: 154 SFFGERRGDVPVISATSTLAFDGRRGAFFEKQLIAALKILQNGDISAARMTGSWAGAMGH 213

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAKFLAKLGWTKCAGY---------- 247
            QF+P +   +A+D   DG+ D+      DA+AS A +LA+ GWT+   +          
Sbjct: 214 TQFIPTSYQAFAVDFTGDGRRDIWSEDPSDALASTAAYLARNGWTRGLRWGREVTGTAAA 273

Query: 248 -------QPGEK------NFAILKHWNASLNYNKTIAYIAAHI-DGVPIGKGY 286
                  Q G        NF  +K +N S  Y   + ++A  I  G P+   +
Sbjct: 274 SGTLIQPQAGGPKFAVTSNFRAIKRYNNSDAYAIGVGHLADRIGGGGPLRSSF 326


>gi|323139375|ref|ZP_08074426.1| lytic murein transglycosylase [Methylocystis sp. ATCC 49242]
 gi|322395368|gb|EFX97918.1| lytic murein transglycosylase [Methylocystis sp. ATCC 49242]
          Length = 271

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 99/281 (35%), Positives = 148/281 (52%), Gaps = 12/281 (4%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ ++ L  + L +V+            A     C ++A  FG W    +  A  EGMS 
Sbjct: 1   MNVRQTLTAAALFLVW----------TNAAGAAACGNSAAGFGAWLEDFKQEAASEGMSR 50

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
                  AD  Y    I+RDR        SF+ +   L +   + +G AL + ++ LL  
Sbjct: 51  HVIDAALADASYDRAVISRDRGQ-KIFRQSFEKFSARLITPARLNRGRALLQRHANLLRQ 109

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++  YGVP  +L+++WGLET +G   G    +  LATLAYDCRR+  FT++   AL +V+
Sbjct: 110 IEARYGVPGPVLVSIWGLETGYGADNGNFKTMQALATLAYDCRRSAQFTQELKDALKIVQ 169

Query: 181 KGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G +S     G   GEIGQ QF+P + +K+A+D D DG+ DL+ S  DA+AS A FL   
Sbjct: 170 RGDMSPAQMRGDWAGEIGQTQFMPSSYLKHAVDFDGDGRRDLIHSTADALASTANFLRGS 229

Query: 240 GWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
           GW   AG++ GE NF +   WN +  Y +T+A +A  + G 
Sbjct: 230 GWRPDAGWEEGEPNFPVFLEWNQARVYARTLALLATKLSGG 270


>gi|260426140|ref|ZP_05780119.1| lytic murein transglycosylase [Citreicella sp. SE45]
 gi|260420632|gb|EEX13883.1| lytic murein transglycosylase [Citreicella sp. SE45]
          Length = 270

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 99/274 (36%), Positives = 147/274 (53%), Gaps = 6/274 (2%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           +  LL+    +LA A+T    A     C + A  F  WK    A A R G+  +  + L 
Sbjct: 1   MSRLLLKAVAVLATAITFAGGAQAA-TCGNNAGGFEAWKREFAAEAQRAGVGQRGIQALM 59

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGL--SSSEIIAQGIALKKANSRLLINLKKEY 125
            +  Y  +TIA DR        S  D++     S       G    + N +    +++ Y
Sbjct: 60  -NASYSTSTIAADRNQ-KGVKYSLNDFIRIRLGSVDGFAKTGRGRVQRNPQFYAAIEQRY 117

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GVP GIL+++ G+ET FG TMG  P++S+++T+AYDCRR+ FFT     AL +V +G+++
Sbjct: 118 GVPAGILVSIHGMETGFGRTMGNVPVVSSISTVAYDCRRSSFFTPHALAALQMVDRGMLA 177

Query: 186 SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245
            +  GA  GE+G  QFLP N ++Y +D + DG++D      DA+AS A FL + GW    
Sbjct: 178 PNQKGAAHGELGHTQFLPGNALRYGVDGNGDGRVDFYNEW-DALASTANFLRQKGWQPGQ 236

Query: 246 GYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            Y  G +NF +L  WNA+  Y + IA +AA IDG
Sbjct: 237 PYNEGTRNFRVLNEWNAATVYQQAIALVAARIDG 270


>gi|254486853|ref|ZP_05100058.1| peptidoglycan binding domain protein [Roseobacter sp. GAI101]
 gi|214043722|gb|EEB84360.1| peptidoglycan binding domain protein [Roseobacter sp. GAI101]
          Length = 386

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 83/315 (26%), Positives = 143/315 (45%), Gaps = 36/315 (11%)

Query: 1   MSF-KKYLLISLLMMVYPMLAQA------VTQPKKATTQFICSDTADRFGEWKSAARARA 53
           MS  ++   I L  +       A       ++   A    +   +   +  W +A + RA
Sbjct: 1   MSISRRGFTIGLAALGLSACDSAGRGQVFASRSDGALPDDLRPQSNGAYDAWVAAFKPRA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
             +G+S  T +  FA   YL   + RDR        + +DYL   +S E +++G A    
Sbjct: 61  RAQGISDSTLRRGFAGAGYLPGVVKRDRNQTE-FSRTLEDYLAIAASEERVSKGRAAFAR 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +   L  ++  YGV   ++ A+WGLE+ +GE  G  P++S  +TLA+D RR  FF +Q  
Sbjct: 120 HRDTLRQIEARYGVAAEVVTAVWGLESFYGERRGNVPVISATSTLAFDGRRGAFFEKQLI 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIAS 231
            AL ++++G +S+    G+  G +G  QF+P +   +A+D + DG+ D+   +  D++AS
Sbjct: 180 AALKILERGDVSASGLTGSWAGAMGHTQFIPTSYQAFAVDFNGDGRRDIWSENPADSLAS 239

Query: 232 AAKFLAKLGWTKCAGYQPG--------------------------EKNFAILKHWNASLN 265
            A +LAK GW     +                              +NF  +K +N S N
Sbjct: 240 TAAYLAKSGWQSGQKWGGEMGTPAAGSATPVSVLQPDAGGPRFAVFRNFQAIKRYNNSDN 299

Query: 266 YNKTIAYIAAHIDGV 280
           Y   + +++  I G 
Sbjct: 300 YAIGVGHLSDRIAGG 314


>gi|306841606|ref|ZP_07474303.1| lytic murein transglycosylase [Brucella sp. BO2]
 gi|306844809|ref|ZP_07477394.1| lytic murein transglycosylase [Brucella sp. BO1]
 gi|306274981|gb|EFM56751.1| lytic murein transglycosylase [Brucella sp. BO1]
 gi|306288352|gb|EFM59715.1| lytic murein transglycosylase [Brucella sp. BO2]
          Length = 275

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 105/267 (39%), Positives = 149/267 (55%), Gaps = 2/267 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                ++A  +           C + A  +  W       A   G+         A+ +Y
Sbjct: 10  WTAVAVIAVGMMTGAGIAEAAQCGNNAAGYNAWLQQTMKEAASRGIGKAGIN-ALANTKY 68

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF+ ++    +  II +G A+K+ N+ L  N++K YGVP G L
Sbjct: 69  AQATIRADRSQKS-FKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANIEKRYGVPAGPL 127

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +  +S  A+GA 
Sbjct: 128 IAIWGMETGFGAYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDREDLSPAAIGAM 187

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW + AGYQPGE 
Sbjct: 188 HGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGWQRGAGYQPGEP 247

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+A ++ WNA+  Y + IA +   IDG
Sbjct: 248 NYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|237816192|ref|ZP_04595187.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
 gi|237788654|gb|EEP62867.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
          Length = 291

 Score =  215 bits (548), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 104/267 (38%), Positives = 148/267 (55%), Gaps = 2/267 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                ++A  +           C + A  +  W       A   G+         A+ +Y
Sbjct: 26  WTAAAVIAVGMMAGAGIAEAAQCGNNAAGYNAWLQQTMKEAASRGIGKAGIN-ALANTKY 84

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF+ ++    +  II +G A+K+ N+ L  N++K YGVP G L
Sbjct: 85  AQATINADRNQKS-FKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANIEKRYGVPAGPL 143

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +  +S  A+GA 
Sbjct: 144 IAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDREDLSPAAIGAM 203

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW +  GYQPGE 
Sbjct: 204 HGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGWQRGGGYQPGEP 263

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+A ++ WNA+  Y + IA +   IDG
Sbjct: 264 NYAAIQGWNAAQVYQRAIAVMGKAIDG 290


>gi|254719814|ref|ZP_05181625.1| lytic murein transglycosylase [Brucella sp. 83/13]
 gi|265984833|ref|ZP_06097568.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|306839512|ref|ZP_07472320.1| lytic murein transglycosylase [Brucella sp. NF 2653]
 gi|264663425|gb|EEZ33686.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|306405457|gb|EFM61728.1| lytic murein transglycosylase [Brucella sp. NF 2653]
          Length = 275

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 105/267 (39%), Positives = 149/267 (55%), Gaps = 2/267 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                ++A  +           C + A  +  W       A   G+         A+ +Y
Sbjct: 10  WTAAAVIAVGMMTGAGIAEAAQCGNNAAGYNAWLQQTMKEAASRGIGKAGIN-ALANTKY 68

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF+ ++    +  II +G A+K+ N+ L  N++K YGVP G L
Sbjct: 69  AQATINADRNQKS-FKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANIEKRYGVPAGPL 127

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +  +S  A+GA 
Sbjct: 128 IAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDREDLSPAAIGAM 187

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW + AGYQPGE 
Sbjct: 188 HGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGWQRGAGYQPGEP 247

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+A ++ WNA+  Y + IA +   IDG
Sbjct: 248 NYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|225628379|ref|ZP_03786413.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
 gi|225616225|gb|EEH13273.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
          Length = 291

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 105/267 (39%), Positives = 149/267 (55%), Gaps = 2/267 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                ++A  +           C + A  +  W       A   G+         A+ +Y
Sbjct: 26  WTAAAVIAVGMMAGAGIAEAAQCGNNAAGYNAWLQQTMKEAASRGIGKAGIN-ALANTKY 84

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF+ ++    +  II +G A+K+ N+ L  N++K YGVP G L
Sbjct: 85  AQATINADRNQKS-FKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANIEKRYGVPAGPL 143

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +  +S  A+GA 
Sbjct: 144 IAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDREDLSPAAIGAM 203

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW + AGYQPGE 
Sbjct: 204 HGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGWQRGAGYQPGEP 263

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+A ++ WNA+  Y + IA +   IDG
Sbjct: 264 NYAAIQGWNAAQVYQRAIAVMGKAIDG 290


>gi|255262350|ref|ZP_05341692.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
 gi|255104685|gb|EET47359.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
          Length = 262

 Score =  215 bits (547), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 93/268 (34%), Positives = 144/268 (53%), Gaps = 6/268 (2%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           ++     +A     P  A     C + A  F  WKS     A  +G+  +      A   
Sbjct: 1   MLKSLAFIAAVFATPAIAAQ---CGNDASGFDRWKSQFSQEAAAQGVGQRGLN-ALASAR 56

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y   TIA DR   +    S + +++   ++ I+ QG      N R    ++  YGVP  +
Sbjct: 57  YATRTIAADRNQKS-FRYSLEKFMEIRGATTIVRQGRQRIAQNPRFYRAIEARYGVPAEV 115

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGA 191
           ++A+ G+ET FG  MG + ++S + TLAYDCRR++FF+     AL LV  G ++++  GA
Sbjct: 116 IVAIHGMETGFGRFMGDSNVVSAITTLAYDCRRSEFFSGHALGALKLVDGGGLAANTQGA 175

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             GE+G  QFLP N ++Y +DA+ DG++DL  +  D++AS A FL + GW    GYQ G+
Sbjct: 176 MHGELGHTQFLPGNALRYGVDANGDGRVDL-TNLTDSLASTANFLRQKGWRLGQGYQEGQ 234

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDG 279
            NF +++ WNA+  Y KTIA +A  + G
Sbjct: 235 PNFRVIQEWNAAGVYQKTIAIMAGQMAG 262


>gi|153008409|ref|YP_001369624.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
 gi|151560297|gb|ABS13795.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
          Length = 275

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 102/267 (38%), Positives = 147/267 (55%), Gaps = 2/267 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                +LA  +           C + A  +  W       A   G+          + +Y
Sbjct: 10  WTAAAVLAVGMMTGTGIAEAAQCGNNAAGYNAWLQQTMKEAASRGIGKAAI-GALGNTKY 68

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF+ ++    +  II +G A K+ N+ L   ++K YGVP G L
Sbjct: 69  AQATINADRNQKS-FKLSFEQFMQKRGADTIIKRGRAQKQQNAALFAAIEKRYGVPAGPL 127

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  +GK   LS +ATLAYDCRR+ +FT+Q + AL L+ +  ++ +A+GA 
Sbjct: 128 LAIWGMETGFGAYLGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDRQDLNPNAVGAM 187

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLPVNV+KY +D D  G ID+ +S  DA+ S A FL   GW + AGYQPGE 
Sbjct: 188 HGEIGQTQFLPVNVLKYGVDGDGSGHIDMARSKADALYSTANFLVGHGWQRGAGYQPGEP 247

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+  ++ WNA+  Y + IA +   IDG
Sbjct: 248 NYGAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|62290691|ref|YP_222484.1| lytic murein transglycosylase [Brucella abortus bv. 1 str. 9-941]
 gi|82700606|ref|YP_415180.1| lytic murein transglycosylase [Brucella melitensis biovar Abortus
           2308]
 gi|189024904|ref|YP_001935672.1| lytic murein transglycosylase [Brucella abortus S19]
 gi|254689980|ref|ZP_05153234.1| lytic murein transglycosylase, putative [Brucella abortus bv. 6
           str. 870]
 gi|254694471|ref|ZP_05156299.1| lytic murein transglycosylase, putative [Brucella abortus bv. 3
           str. Tulya]
 gi|254698131|ref|ZP_05159959.1| lytic murein transglycosylase, putative [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254731015|ref|ZP_05189593.1| lytic murein transglycosylase, putative [Brucella abortus bv. 4
           str. 292]
 gi|256258235|ref|ZP_05463771.1| lytic murein transglycosylase, putative [Brucella abortus bv. 9
           str. C68]
 gi|260547071|ref|ZP_05822809.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260755516|ref|ZP_05867864.1| lytic Murein transglycosylase [Brucella abortus bv. 6 str. 870]
 gi|260758739|ref|ZP_05871087.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260762573|ref|ZP_05874910.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884538|ref|ZP_05896152.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|261214788|ref|ZP_05929069.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|297249084|ref|ZP_06932792.1| membrane-bound lytic murein transglycosylase B [Brucella abortus
           bv. 5 str. B3196]
 gi|62196823|gb|AAX75123.1| lytic murein transglycosylase, hypothetical [Brucella abortus bv. 1
           str. 9-941]
 gi|82616707|emb|CAJ11792.1| lytic murein transglycosylase, putative [Brucella melitensis biovar
           Abortus 2308]
 gi|189020476|gb|ACD73198.1| lytic murein transglycosylase, putative [Brucella abortus S19]
 gi|260095436|gb|EEW79314.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260669057|gb|EEX55997.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260672999|gb|EEX59820.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675624|gb|EEX62445.1| lytic Murein transglycosylase [Brucella abortus bv. 6 str. 870]
 gi|260874066|gb|EEX81135.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|260916395|gb|EEX83256.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|297174217|gb|EFH33574.1| membrane-bound lytic murein transglycosylase B [Brucella abortus
           bv. 5 str. B3196]
          Length = 275

 Score =  215 bits (546), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 104/267 (38%), Positives = 148/267 (55%), Gaps = 2/267 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                ++A  +           C + A  +  W       A   G+         A+ +Y
Sbjct: 10  WTAAAVIAVGMMAGAGIAEAAQCGNNAAGYNAWLQQTMKEAASRGIGKAGIN-ALANTKY 68

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF+ ++    +  II +G A+K+ N+ L  N++K YGVP G L
Sbjct: 69  AQATINADRNQKS-FKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANIEKRYGVPAGPL 127

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +  +S  A+GA 
Sbjct: 128 IAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDREDLSPAAIGAM 187

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW +  GYQPGE 
Sbjct: 188 HGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGWQRGGGYQPGEP 247

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+A ++ WNA+  Y + IA +   IDG
Sbjct: 248 NYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|23502681|ref|NP_698808.1| lytic murein transglycosylase [Brucella suis 1330]
 gi|148559968|ref|YP_001259664.1| putative lytic murein transglycosylase [Brucella ovis ATCC 25840]
 gi|161619747|ref|YP_001593634.1| lytic murein transglycosylase [Brucella canis ATCC 23365]
 gi|163845405|ref|YP_001623060.1| lytic murein transglycosylase [Brucella suis ATCC 23445]
 gi|225853270|ref|YP_002733503.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|254700469|ref|ZP_05162297.1| lytic murein transglycosylase [Brucella suis bv. 5 str. 513]
 gi|254703592|ref|ZP_05165420.1| lytic murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|254708826|ref|ZP_05170637.1| lytic murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|254714666|ref|ZP_05176477.1| lytic murein transglycosylase [Brucella ceti M644/93/1]
 gi|254717564|ref|ZP_05179375.1| lytic murein transglycosylase [Brucella ceti M13/05/1]
 gi|256030352|ref|ZP_05443966.1| lytic murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|256045425|ref|ZP_05448317.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256114400|ref|ZP_05455125.1| lytic murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160522|ref|ZP_05458211.1| lytic murein transglycosylase [Brucella ceti M490/95/1]
 gi|256255728|ref|ZP_05461264.1| lytic murein transglycosylase [Brucella ceti B1/94]
 gi|256263242|ref|ZP_05465774.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370232|ref|YP_003107743.1| lytic murein transglycosylase, putative [Brucella microti CCM 4915]
 gi|260168025|ref|ZP_05754836.1| lytic murein transglycosylase, putative [Brucella sp. F5/99]
 gi|260565684|ref|ZP_05836167.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|260568898|ref|ZP_05839366.1| lytic murein transglycosylase [Brucella suis bv. 4 str. 40]
 gi|261219399|ref|ZP_05933680.1| lytic Murein transglycosylase [Brucella ceti M13/05/1]
 gi|261222943|ref|ZP_05937224.1| lytic Murein transglycosylase [Brucella ceti B1/94]
 gi|261316320|ref|ZP_05955517.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261322461|ref|ZP_05961658.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
 gi|261750973|ref|ZP_05994682.1| lytic Murein transglycosylase [Brucella suis bv. 5 str. 513]
 gi|261754227|ref|ZP_05997936.1| lytic Murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|261757473|ref|ZP_06001182.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|265987389|ref|ZP_06099946.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|265991855|ref|ZP_06104412.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995694|ref|ZP_06108251.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998902|ref|ZP_06111459.1| lytic Murein transglycosylase [Brucella ceti M490/95/1]
 gi|294851066|ref|ZP_06791742.1| membrane-bound lytic murein transglycosylase B [Brucella sp. NVSL
           07-0026]
 gi|23348692|gb|AAN30723.1| lytic murein transglycosylase, putative [Brucella suis 1330]
 gi|148371225|gb|ABQ61204.1| putative lytic murein transglycosylase [Brucella ovis ATCC 25840]
 gi|161336558|gb|ABX62863.1| lytic murein transglycosylase [Brucella canis ATCC 23365]
 gi|163676128|gb|ABY40238.1| lytic murein transglycosylase [Brucella suis ATCC 23445]
 gi|225641635|gb|ACO01549.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|256000395|gb|ACU48794.1| lytic murein transglycosylase, putative [Brucella microti CCM 4915]
 gi|260151057|gb|EEW86152.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|260154282|gb|EEW89364.1| lytic murein transglycosylase [Brucella suis bv. 4 str. 40]
 gi|260921527|gb|EEX88180.1| lytic Murein transglycosylase [Brucella ceti B1/94]
 gi|260924488|gb|EEX91056.1| lytic Murein transglycosylase [Brucella ceti M13/05/1]
 gi|261295151|gb|EEX98647.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
 gi|261295543|gb|EEX99039.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261737457|gb|EEY25453.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|261740726|gb|EEY28652.1| lytic Murein transglycosylase [Brucella suis bv. 5 str. 513]
 gi|261743980|gb|EEY31906.1| lytic Murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|262553591|gb|EEZ09360.1| lytic Murein transglycosylase [Brucella ceti M490/95/1]
 gi|262766978|gb|EEZ12596.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002811|gb|EEZ15214.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093203|gb|EEZ17300.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659586|gb|EEZ29847.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|294821709|gb|EFG38705.1| membrane-bound lytic murein transglycosylase B [Brucella sp. NVSL
           07-0026]
 gi|326409831|gb|ADZ66896.1| lytic murein transglycosylase [Brucella melitensis M28]
 gi|326539547|gb|ADZ87762.1| lytic murein transglycosylase [Brucella melitensis M5-90]
          Length = 275

 Score =  214 bits (545), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 105/267 (39%), Positives = 149/267 (55%), Gaps = 2/267 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                ++A  +           C + A  +  W       A   G+         A+ +Y
Sbjct: 10  WTAAAVIAVGMMAGAGIAEAAQCGNNAAGYNAWLQQTMKEAASRGIGKAGIN-ALANTKY 68

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF+ ++    +  II +G A+K+ N+ L  N++K YGVP G L
Sbjct: 69  AQATINADRNQKS-FKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANIEKRYGVPAGPL 127

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +  +S  A+GA 
Sbjct: 128 IAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDREDLSPAAIGAM 187

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW + AGYQPGE 
Sbjct: 188 HGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGWQRGAGYQPGEP 247

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+A ++ WNA+  Y + IA +   IDG
Sbjct: 248 NYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|217979774|ref|YP_002363921.1| lytic murein transglycosylase [Methylocella silvestris BL2]
 gi|217505150|gb|ACK52559.1| lytic murein transglycosylase [Methylocella silvestris BL2]
          Length = 271

 Score =  214 bits (545), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 88/275 (32%), Positives = 143/275 (52%), Gaps = 8/275 (2%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
              +I L+++   +    ++    AT +      A       +A ++ A  +G+S     
Sbjct: 1   MRSMIRLMILALGLSGFCLSSASAATCRDPAGFAAFI-----AAIKSEAAAQGISSGAI- 54

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
                + Y  + +A+D         SF+ +   + S   + +G  L K  +  L  ++  
Sbjct: 55  AALDGVAYSPSILAKDHGQR-VFQQSFEQFSARMISPNRLRRGSTLLKTYASALSRIEAA 113

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGVP  +++ALWGLET FG   G    L  LATLA+DCRR + F  +   AL LV++G +
Sbjct: 114 YGVPGPVIVALWGLETDFGADSGGEATLQALATLAFDCRRTEKFQAELLDALRLVERGDL 173

Query: 185 SSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +     GA  GE+GQ QF+P + +KYA+D + +G+ DL+   +DA+AS A +L   GW  
Sbjct: 174 APAAMRGAWAGELGQTQFMPSSYLKYAVDFNGNGRRDLIHDPLDALASTANYLKAHGWQA 233

Query: 244 CAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
            AG++PG+ NFA+++ WN S  Y KT+A  A  + 
Sbjct: 234 GAGWEPGQPNFAVIQKWNESEVYAKTVAAFATKLA 268


>gi|298292269|ref|YP_003694208.1| lytic murein transglycosylase [Starkeya novella DSM 506]
 gi|296928780|gb|ADH89589.1| lytic murein transglycosylase [Starkeya novella DSM 506]
          Length = 272

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 90/246 (36%), Positives = 135/246 (54%), Gaps = 5/246 (2%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
             C DT   F  W    R  A  +G+SP         L Y    I+ DR        SF+
Sbjct: 29  APCGDTGAGFDAWLRDFRQAAAAQGISPGAV-RALDGLSYDTRVISLDRNQ-KHFKQSFE 86

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            ++     +  I++G A+ + ++ LL  +++ +GVP  IL+A+WG+ET FG   GK P+ 
Sbjct: 87  QFVANRVGAGRISKGKAMLRQHAGLLARIEQRFGVPGPILVAIWGMETDFGVNQGKMPVF 146

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
            +LATLAYDCRR+ FFT Q   AL +V++G +S     GA  GE+GQ QF+P + V++A+
Sbjct: 147 RSLATLAYDCRRSGFFTGQLLDALRIVQRGDLSIGEMRGAWAGELGQTQFMPTSYVRFAV 206

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           D D +G  DL++S  D +AS A +L   GW     ++ G  N   L+ WN +  Y ++IA
Sbjct: 207 DFDGNGHADLIRSVPDVLASTANYLRGYGW-SGPSWENG-ANMGALRGWNKAEVYARSIA 264

Query: 272 YIAAHI 277
           Y A  +
Sbjct: 265 YFATRL 270


>gi|83955291|ref|ZP_00963946.1| peptidoglycan-binding protein, putative [Sulfitobacter sp.
           NAS-14.1]
 gi|83840284|gb|EAP79458.1| peptidoglycan-binding protein, putative [Sulfitobacter sp.
           NAS-14.1]
          Length = 372

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 135/297 (45%), Gaps = 30/297 (10%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA 78
                 +   A    +       +  W SA ++RA  +G+S  T +  FA   YL   + 
Sbjct: 12  AGSFAPRSDAALAPDLQPQPNAGYDAWVSAFKSRAAAQGISDSTLRRGFAGAGYLPGVVK 71

Query: 79  RDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGL 138
           RDR        S +DYL   +S E + +G A    +  +L  ++  YGVP  ++ A+WGL
Sbjct: 72  RDRNQTE-FSRSLEDYLAIAASDERVTKGRAAFARHQGVLRQIEARYGVPAEVVTAVWGL 130

Query: 139 ETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIG 197
           E+ +GE  G  P++S  +TLAYD RR  FF +Q   AL ++++G +S+    G+  G +G
Sbjct: 131 ESFYGERRGNVPVVSATSTLAYDGRRGAFFEKQLIAALRILERGDVSAAGLTGSWAGAMG 190

Query: 198 QFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQPG------ 250
             QF+P +   +A+D   DGK D+      D++AS A +LAK GW     +         
Sbjct: 191 HTQFIPTSYQSFAVDFTGDGKRDIWSDDPSDSLASTAAYLAKSGWKSGQKWGAEMGTAAA 250

Query: 251 --------------------EKNFAILKHWNASLNYNKTIAYIAAHID-GVPIGKGY 286
                                 NF  +K +N S NY   + +++  I  G PI   +
Sbjct: 251 SSATPVQILQPDAGGPRFAIFNNFKAIKRYNNSDNYAIGVGHLSDRIAGGGPIQASF 307


>gi|83943814|ref|ZP_00956272.1| peptidoglycan-binding protein, putative [Sulfitobacter sp. EE-36]
 gi|83845494|gb|EAP83373.1| peptidoglycan-binding protein, putative [Sulfitobacter sp. EE-36]
          Length = 375

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 85/297 (28%), Positives = 136/297 (45%), Gaps = 30/297 (10%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA 78
                 +   A    +       +  W SA ++RA  +G+S  T +  FA   YL   + 
Sbjct: 15  AGSFAPRSDAALAPDLQPQPNAGYDAWVSAFKSRAAAQGISDSTLRRGFAGAGYLPGVVK 74

Query: 79  RDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGL 138
           RDR        S +DYL   +S E +++G A    +  +L  ++  YGVP  ++ A+WGL
Sbjct: 75  RDRNQTE-FSRSLEDYLAIAASDERVSKGRAAFARHQGVLRQIEARYGVPAEVVTAVWGL 133

Query: 139 ETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIG 197
           E+ +GE  G  P++S  +TLAYD RR  FF +Q   AL ++++G +S+    G+  G +G
Sbjct: 134 ESFYGERRGNVPVVSATSTLAYDGRRGAFFEKQLIAALHILERGDVSAAGLTGSWAGAMG 193

Query: 198 QFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQPG------ 250
             QF+P +   +A+D   DGK D+      D++AS A +LAK GW     +         
Sbjct: 194 HTQFIPTSYQSFAVDFTGDGKRDIWSDDPSDSLASTAAYLAKSGWKSGQKWGAEMGTAAA 253

Query: 251 --------------------EKNFAILKHWNASLNYNKTIAYIAAHID-GVPIGKGY 286
                                 NF  +K +N S NY   + +++  I  G PI   +
Sbjct: 254 SSATPVQILQPDAGGPRFAIFNNFKAIKRYNNSDNYAIGVGHLSDRIAGGGPIQASF 310


>gi|163744316|ref|ZP_02151676.1| Lytic murein transglycosylase [Oceanibulbus indolifex HEL-45]
 gi|161381134|gb|EDQ05543.1| Lytic murein transglycosylase [Oceanibulbus indolifex HEL-45]
          Length = 382

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 86/316 (27%), Positives = 137/316 (43%), Gaps = 32/316 (10%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDT------ADRFGEWKSAARARAV 54
           M   +      L  +    A +                         +  W ++ + RA 
Sbjct: 1   MRHSRRTFAFGLAALGLTSACSNGGGALGPAAAAGVPDDLRPVANAGYDAWVASFKGRAS 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
            +G+S  T    F+   YL   + RDR        S +DYL   +S + +++G A    +
Sbjct: 61  AQGISASTLAQGFSGAGYLPGVVKRDRNQTE-FSRSLEDYLAIAASDDRVSKGRAAFARH 119

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
              L  ++  YGV   I+ A+WGLE+ FGE  G  P++S  +TLAYD RR  FF +Q   
Sbjct: 120 RSTLSAIESRYGVAAEIVAAIWGLESFFGERRGNVPVVSATSTLAYDGRRGAFFEKQLIA 179

Query: 175 ALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASA 232
           AL +++ G IS+    G+  G +G  QF+P +   +A+D   DG+ D+      DA+AS 
Sbjct: 180 ALKILQNGDISADRLTGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWSEDPSDALAST 239

Query: 233 AKFLAKLGWTKCAGY-----------------QPGEK------NFAILKHWNASLNYNKT 269
           A +L++ GWT+   +                 Q G        NF  LK +N S +Y   
Sbjct: 240 AAYLSRNGWTRGIKWGGELGSIPASAGSVIQPQAGGPQFVVTSNFRALKRYNNSDSYAIG 299

Query: 270 IAYIAAHIDGVPIGKG 285
           + ++A  I G    +G
Sbjct: 300 VGHLADRIAGGGPLRG 315


>gi|332994727|gb|AEF04782.1| membrane-bound lytic transglycosylase-related protein [Alteromonas
           sp. SN2]
          Length = 408

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 92/342 (26%), Positives = 136/342 (39%), Gaps = 73/342 (21%)

Query: 1   MSFK---KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREG 57
           M  K   K  + ++ MM   +     T                 F    S    +A+ +G
Sbjct: 1   MGLKGKGKQWVTAVSMMSALLSGLCSTTAMADEA----------FSICTSQLANKALEQG 50

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRL 117
           +S +T   +F  L Y    I  DR        +F  Y     +     +G  + + +  L
Sbjct: 51  VSQETVDTIFPSLVYQARVIELDRSQPE-FVQTFPGYFSKRVTDWRTNKGQEMYEKHKDL 109

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L  L  +YGVPP  L+A WGLET+FG   GK P+L +LATLA D RR+K+FT++   A+ 
Sbjct: 110 LHKLSDKYGVPPHYLLAFWGLETNFGNYKGKMPVLDSLATLACDPRRSKYFTQELLVAVK 169

Query: 178 LVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           L ++  ++   + G+  G +G  QF+P     YA+D D DG+I+L  S  DA+ SAA FL
Sbjct: 170 LFERESLTREEMVGSWAGAMGHTQFMPSAYTHYAVDGDNDGQINLWNSEEDALTSAANFL 229

Query: 237 AKLGWTKCAGYQ-------------PGEKN------------------------------ 253
           A LGW +   +               G KN                              
Sbjct: 230 ASLGWQRGFRWGREVQLPEGFDYQLSGYKNRRTLSQWSELGVKQADASPLGDDDTKAYVV 289

Query: 254 ---------------FAILKHWNASLNYNKTIAYIAAHIDGV 280
                          F ++  WN S  Y   +  +A  I G 
Sbjct: 290 VPAGHAGPAFVGYQNFRVIMRWNNSEFYAIAVGVLADRISGA 331


>gi|254708322|ref|ZP_05170150.1| lytic murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261315820|ref|ZP_05955017.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261304846|gb|EEY08343.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
          Length = 275

 Score =  213 bits (543), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 104/267 (38%), Positives = 148/267 (55%), Gaps = 2/267 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                ++A  +           C + A  +  W       A   G+         A+ +Y
Sbjct: 10  WTAAAVIAVGMMAGAGIAEAAQCGNNAAGYNAWLQQTMKEAASRGIGKAGIN-ALANTKY 68

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF+ ++    +  II +G A+K+ N+ L  N++K YGVP G L
Sbjct: 69  AQATINADRNQKS-FKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANIEKRYGVPAGPL 127

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  MGK   LS +ATLAYDC R+ +FT+Q + AL L+ +  +S  A+GA 
Sbjct: 128 IAIWGMETGFGSYMGKQHTLSAVATLAYDCHRSDYFTDQLYAALKLIDREDLSPAAIGAM 187

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW + AGYQPGE 
Sbjct: 188 HGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGWQRGAGYQPGEP 247

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+A ++ WNA+  Y + IA +   IDG
Sbjct: 248 NYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|154252387|ref|YP_001413211.1| lytic murein transglycosylase [Parvibaculum lavamentivorans DS-1]
 gi|154156337|gb|ABS63554.1| lytic murein transglycosylase [Parvibaculum lavamentivorans DS-1]
          Length = 427

 Score =  213 bits (542), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 75/283 (26%), Positives = 127/283 (44%), Gaps = 8/283 (2%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +  L +       +   P+        S  A  F +W +A R  A++ G++P T      
Sbjct: 22  VFGLALAGCGATASTDVPRGVPMAPPVSADAPAFADWLTAFREDALKAGIAPATFDRSMK 81

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
            +   +  I  +            +YL+G  S   +A G  L   N  LL  ++  YGV 
Sbjct: 82  GVRLDEKVIEANESQPE-FTRPVWEYLEGALSDTRVATGKRLLAENKALLDRIEARYGVD 140

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
             +L+A+WGLE+++G   G   ++ +LATL ++ RR ++   Q   AL +++ G I+   
Sbjct: 141 RHVLVAIWGLESNYGSFQGTMSVVRSLATLGFEGRRVEYGRSQLIAALQIIQNGDIAPER 200

Query: 189 L-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           + G+  G +G  QF+P     +A+D D DG+ D+  S+ DA+ASAA +L   GW + A +
Sbjct: 201 MTGSWAGAMGHTQFIPTTYNAHAVDFDGDGRRDIWNSHADALASAAHYLGNSGWQRGAVW 260

Query: 248 QPGEKNFAILKHWNASLNYN-KTIAYI----AAHIDGVPIGKG 285
               K       +  +     + +        A IDG P   G
Sbjct: 261 GYEVKLPQG-FDYGEADMSVSQPVGEWQKLGVARIDGRPFPSG 302


>gi|77462712|ref|YP_352216.1| lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           2.4.1]
 gi|126461605|ref|YP_001042719.1| lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           ATCC 17029]
 gi|221638573|ref|YP_002524835.1| Lytic murein transglycosylase [Rhodobacter sphaeroides KD131]
 gi|332557595|ref|ZP_08411917.1| Lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           WS8N]
 gi|77387130|gb|ABA78315.1| lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           2.4.1]
 gi|126103269|gb|ABN75947.1| lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           ATCC 17029]
 gi|221159354|gb|ACM00334.1| Lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           KD131]
 gi|332275307|gb|EGJ20622.1| Lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           WS8N]
          Length = 267

 Score =  213 bits (541), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 107/271 (39%), Positives = 146/271 (53%), Gaps = 6/271 (2%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           + SL      ++A  +  P  A     CSDT   +  WK      A   G+  +      
Sbjct: 2   ISSLRPASLALVAGLLAGPVAAA---PCSDTGANYESWKPQMAQEAAAVGVGQRGI-AAL 57

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
               Y   TIA DR   +    S   ++    S  I+ QG A K  +  L   L++ YGV
Sbjct: 58  MGTSYSSRTIAADRNQKS-FKYSLDKFMQVRGSETIVKQGRARKAKSPDLYAALERRYGV 116

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G+L+A+ G+ET FG  MG T ++S +ATLAYDCRR+ FFT     AL LV +G IS+ 
Sbjct: 117 PAGVLLAIHGMETGFGNFMGDTNVVSAIATLAYDCRRSDFFTPHLLAALVLVDRGSISTA 176

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           ++GA  GEIG  QFLP N + Y +D + DG++DL  +  DA+AS A FLA  GW    GY
Sbjct: 177 SVGAKHGEIGHTQFLPGNALTYGVDGNGDGRVDL-TNLTDALASTANFLAAKGWQPGLGY 235

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
           QPGE NFA+++ WNA+  Y + IA +   ID
Sbjct: 236 QPGEPNFAVIREWNAASVYQQAIAIMGQRID 266


>gi|163746833|ref|ZP_02154190.1| hypothetical protein OIHEL45_15559 [Oceanibulbus indolifex HEL-45]
 gi|161379947|gb|EDQ04359.1| hypothetical protein OIHEL45_15559 [Oceanibulbus indolifex HEL-45]
          Length = 266

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 101/269 (37%), Positives = 142/269 (52%), Gaps = 3/269 (1%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           ++  ++   A   T     T    C +TA+ F  WK A    A   G+         A  
Sbjct: 1   MIKSLFTTTAAICTFMAAPTLAAQCGNTANGFDAWKGAFAQEARAAGVGQSGLN-ALASA 59

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
            Y + TIA DR   +    S   ++    +  I+AQG   K  N+     L++ YGVP G
Sbjct: 60  RYANGTIAADRNQKS-FKYSLSKFMQVRGADTIVAQGRKRKARNAGFYSALEQRYGVPAG 118

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALG 190
           +L+A+ G+ET FG  MG + ++S + TLAYDCRR+ FF      AL LV +G I+    G
Sbjct: 119 VLLAIHGMETGFGGFMGDSAVVSAITTLAYDCRRSDFFVPHAIGALKLVDQGAITPSTKG 178

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           A  GE+G  QFLP N + Y +D + DG++D   S  DA+AS A FL + GW   AGYQ G
Sbjct: 179 AKHGELGHTQFLPGNALSYGVDGNGDGRVDFY-SETDALASTANFLRQKGWQPGAGYQEG 237

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           + NF +++ WNA+  Y K IA +A  IDG
Sbjct: 238 QPNFRVIQAWNAAGVYQKAIAIMAGRIDG 266


>gi|89069903|ref|ZP_01157237.1| hypothetical protein OG2516_06362 [Oceanicola granulosus HTCC2516]
 gi|89044579|gb|EAR50698.1| hypothetical protein OG2516_06362 [Oceanicola granulosus HTCC2516]
          Length = 265

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 84/248 (33%), Positives = 128/248 (51%), Gaps = 5/248 (2%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
            C + A  F  WK      A  +G+         A+  Y  +TI  DR        S  +
Sbjct: 21  TCGNDASGFERWKQEFAQEAAAQGIGQAGLN-ALANARYSQSTINADRNQRGV-RYSLDE 78

Query: 94  YLDGL--SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
           ++     S     +     + +N     +L++ YGVP  IL+A+  +ET  G  MG TP+
Sbjct: 79  FIRIRLGSLDSFASTLRNARNSNPGFYQSLEQAYGVPASILLAIHYMETGGGRFMGDTPV 138

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAI 211
           + ++ T+AYDCRR+ FFT     AL +V +G+++ +  GA  GE+G  QFLP N ++Y +
Sbjct: 139 VDSITTVAYDCRRSDFFTPHALAALQMVDRGMLAPNQRGAAHGELGHTQFLPGNALRYGV 198

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           D D +G++DL     DA+AS A +L + GW     Y  G +NF +L  WNA+  Y + IA
Sbjct: 199 DGDGNGRVDLYG-VADALASTANYLRQKGWQPGQPYSEGTQNFRVLNEWNAATVYQQAIA 257

Query: 272 YIAAHIDG 279
             AA +DG
Sbjct: 258 LAAARLDG 265


>gi|255264816|ref|ZP_05344158.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
 gi|255107151|gb|EET49825.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
          Length = 369

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 80/303 (26%), Positives = 138/303 (45%), Gaps = 31/303 (10%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTA------DRFGEWKSAARARAVREGMSPKTAKHL 66
           M+    +A  VT   +         +         F  W +A R RA+R G+S  T    
Sbjct: 1   MLGAAGVAGCVTDVARPARAAGTVPSDLRPVATPAFSSWLTAFRPRALRAGISAATVDRA 60

Query: 67  FADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYG 126
            A   ++   I RDR  + +   + ++YL   +S + +A+G          L  ++  YG
Sbjct: 61  LASAGFVPGVITRDRTQIQT-RRTLEEYLSIATSDDRLAKGRVALARYGSTLTAIQSRYG 119

Query: 127 VPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS 186
           V   I+ A+WGLE+ FGE  G+ P++S+ ATLA++ RRA F+  Q   AL ++ +G  + 
Sbjct: 120 VDRHIIAAIWGLESQFGEKRGQVPVISSTATLAFEGRRAAFYESQLIAALRILDRGDTTP 179

Query: 187 HAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKC 244
             + G+  G +G  QF+P +   +A+D + DG+ D+      DA+AS A +L++ GW   
Sbjct: 180 DQMLGSWAGAMGHTQFIPTSYRSFAVDFNGDGRRDIWGDDPTDALASTASYLSRNGWRSG 239

Query: 245 AGYQPG----------------------EKNFAILKHWNASLNYNKTIAYIAAHIDGVPI 282
             +                          +NF ++K +N S  Y   + ++A  + G   
Sbjct: 240 LRWGAEAGTGGPSGRSIRPQRGGVQFTVTRNFNVIKTYNNSDLYAVGVGHLADRLAGGGP 299

Query: 283 GKG 285
            +G
Sbjct: 300 LRG 302


>gi|254465615|ref|ZP_05079026.1| lytic murein transglycosylase [Rhodobacterales bacterium Y4I]
 gi|206686523|gb|EDZ47005.1| lytic murein transglycosylase [Rhodobacterales bacterium Y4I]
          Length = 264

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 99/267 (37%), Positives = 149/267 (55%), Gaps = 6/267 (2%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           ++   +++  +  P  A T   C +T+  F  WK A  A A R G+     +   A+ +Y
Sbjct: 4   LLASALISALLASPAVAAT---CGNTSAGFDAWKQAFSAEAKRAGVRNAGLQ-ALANAQY 59

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI+ DR   +    S + ++    S+ I+AQG   K  N      L+++YGVP G+L
Sbjct: 60  ASRTISADRNQKS-FKYSLEKFMQVRGSATIVAQGRKRKARNPDFYAALERKYGVPAGVL 118

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+ G+ET FG  MG + ++S + TL YDCRR+ FF      AL LV +G I+   LGA 
Sbjct: 119 IAIHGMETAFGNYMGDSQVVSAIVTLTYDCRRSDFFRPHALGALKLVDQGAITPATLGAK 178

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GE+G  QFLP N ++Y  D D +G++D   +  DA+AS A +L + GW    GYQPGE 
Sbjct: 179 HGELGHTQFLPGNALQYGQDWDGNGRVDFY-NMGDALASTANYLRQKGWKPGKGYQPGEP 237

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+ +LK WNA+  Y +++A +   IDG
Sbjct: 238 NYPVLKQWNAATVYQQSLAIMGRQIDG 264


>gi|17986507|ref|NP_539141.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 1 str. 16M]
 gi|17982110|gb|AAL51405.1| membrane-bound lytic murein transglycosylase b [Brucella melitensis
           bv. 1 str. 16M]
          Length = 255

 Score =  212 bits (539), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 104/255 (40%), Positives = 145/255 (56%), Gaps = 2/255 (0%)

Query: 25  QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
                     C + A  +  W       A   G+         A+ +Y   TI  DR   
Sbjct: 2   AGAGIAEAAQCGNNAAGYNAWLQQTMKEAASRGIGKAGIN-ALANTKYAQATINADRNQK 60

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
           +   +SF+ ++    +  II +G A+K+ N+ L  N++K YGVP G L+A+WG+ET FG 
Sbjct: 61  S-FKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANIEKRYGVPAGPLIAIWGMETGFGS 119

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPV 204
            MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +  +S  A+GA  GEIGQ QFLPV
Sbjct: 120 YMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDREDLSPAAIGAMHGEIGQTQFLPV 179

Query: 205 NVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASL 264
           NV+ Y +D D  G ID+ +S  DA+ S A FL   GW + AGYQPGE N+A ++ WNA+ 
Sbjct: 180 NVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGWQRGAGYQPGEPNYAAIQGWNAAQ 239

Query: 265 NYNKTIAYIAAHIDG 279
            Y + IA +   IDG
Sbjct: 240 VYQRAIAVMGKAIDG 254


>gi|301062749|ref|ZP_07203361.1| lytic murein transglycosylase [delta proteobacterium NaphS2]
 gi|300443156|gb|EFK07309.1| lytic murein transglycosylase [delta proteobacterium NaphS2]
          Length = 316

 Score =  212 bits (538), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 84/302 (27%), Positives = 130/302 (43%), Gaps = 57/302 (18%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
           F    +   F EW    R  A   G+S       F DL+ +   I  DR       ++F+
Sbjct: 14  FALGASDRSFQEWLKGVRREAREAGVSEAVMGRAFRDLKPIPRVIELDRSQPE-FKLTFQ 72

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            YLD + + + +  G    + +  LL  + ++YGV P  ++ALWG+ET +G+  G  P++
Sbjct: 73  QYLDRMVTRKTVWDGRQRYREHKDLLNEIFRQYGVEPQYIVALWGIETRYGKITGGYPVI 132

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
             LATLAYD RR+KFF  +   AL ++++G I  +   G+  G +GQ QF+P + V YA+
Sbjct: 133 DVLATLAYDGRRSKFFRAELIRALKILEEGHIDVADMDGSWAGAMGQVQFMPSSFVTYAV 192

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ------------PGEKNFAILKH 259
           D D DG+ D+  +  DA+ASAA +L+K GW    G+               +K    LK 
Sbjct: 193 DQDGDGRRDIWDNVPDALASAANYLSKSGWKPEQGWGGEVALPVGFDAEISDKIVKPLKE 252

Query: 260 W-------------------------------------------NASLNYNKTIAYIAAH 276
           W                                           N S  +   +  +A  
Sbjct: 253 WRAMGLSGKGVEGDPDCLAHLVKPDHNSGRVFLVYPNYQVILKWNRSNYFAIAVGTLADR 312

Query: 277 ID 278
           I 
Sbjct: 313 IA 314


>gi|84687917|ref|ZP_01015783.1| Membrane-bound lytic murein transglycosylase B [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664054|gb|EAQ10552.1| Membrane-bound lytic murein transglycosylase B [Rhodobacterales
           bacterium HTCC2654]
          Length = 439

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 78/352 (22%), Positives = 139/352 (39%), Gaps = 69/352 (19%)

Query: 2   SFKKYLLISLL-MMVYPMLAQAVTQP--------KKATTQFICSDTADRFGEWKSAARAR 52
           +F      +LL +     L      P          ++   +       F +W  + + +
Sbjct: 17  NFHMTRRTALLSLTAMGALTACGASPRGRSVASASSSSASAMPIQQNAGFDDWVVSFKNQ 76

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           A   G+S       F    Y+   I RDR        + +DYL   +S E ++ G A  +
Sbjct: 77  AEGRGISRSVLDTAFRGAGYIPGVIERDRNQTE-FTRTLEDYLAIAASDERVSNGRANYR 135

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQF 172
           + +  L +++  Y V   ++ A+WG+E+ +G   G TP++S +ATL+Y  RR +FFT+Q 
Sbjct: 136 SFASTLNSVESTYEVEGKVVAAVWGMESSYGTRRGDTPIVSAMATLSYAGRRQEFFTQQL 195

Query: 173 FYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIA 230
           +  L ++  G  +   + G+  G +G  QF+P + + YA+D   DG+ D+      DA+A
Sbjct: 196 YAVLKILANGDTTPDRMVGSWAGAMGHTQFMPTSYLSYAVDHTGDGRRDIWSDDPTDALA 255

Query: 231 SAAKFLAKLGWTKCAGY-------------QPGEKNFA---------------------- 255
           SAA +L + GW K   +             Q G  N                        
Sbjct: 256 SAANYLKRHGWQKGQPWGVEVRLPQGFDRAQAGFSNSRSVDSWTAMGVRDMNGNAVGNYG 315

Query: 256 ----------------------ILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
                                 ++K +N + +Y   + ++   I G    +G
Sbjct: 316 AARVIEPAGGGGPAFMVFKNFDVIKRYNNATSYAIGVGHLGDRIAGGGPIRG 367


>gi|29654246|ref|NP_819938.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 493]
 gi|29541512|gb|AAO90452.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           RSA 493]
          Length = 333

 Score =  210 bits (535), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 87/339 (25%), Positives = 138/339 (40%), Gaps = 64/339 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ +K++L+S L+              +A  Q         +  W    R  A+  G+ P
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPS-------WVVWVKQLREEAISRGIRP 53

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +     F+ ++     +    +      ++F  Y    +    I  G A  + + R+L  
Sbjct: 54  EVFDRAFSTVKEPSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQKHHRILTE 113

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q FYAL+++ 
Sbjct: 114 IGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRRAFFRKQLFYALEILN 173

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G ++  +  G   G  GQ QFLP +   YA+D D DG+ D+     DA AS A +LAK 
Sbjct: 174 GGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASIANYLAKH 233

Query: 240 GWTKCAGYQ--------------------------------------------------P 249
           GW     +                                                    
Sbjct: 234 GWKAHQPWAIEVILPSGFDTRLVNGKIKKTIQEWQRMGIRTVGGRPWPHGNEEAELIRPD 293

Query: 250 GEKN------FAILKHWNASLNYNKTIAYIAAHIDGVPI 282
           G  N      F +L  WN S  Y  T+ ++A  I G PI
Sbjct: 294 GGPNFLVFNNFNVLMKWNRSTYYAGTVGWMAEQICGRPI 332


>gi|154707085|ref|YP_001424513.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           Dugway 5J108-111]
 gi|154356371|gb|ABS77833.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           Dugway 5J108-111]
          Length = 333

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 87/339 (25%), Positives = 138/339 (40%), Gaps = 64/339 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ +K++L+S L+              +A  Q         +  W    R  A+  G+ P
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPS-------WAVWVKQLREEAISRGIRP 53

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +     F+ ++     +    +      ++F  Y    +    I  G A  + + R+L  
Sbjct: 54  EVFDRAFSTVKEPSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQKHHRILTE 113

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q FYAL+++ 
Sbjct: 114 IGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRKAFFRKQLFYALEILN 173

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G ++  +  G   G  GQ QFLP +   YA+D D DG+ D+     DA AS A +LAK 
Sbjct: 174 GGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASIANYLAKH 233

Query: 240 GWTKCAGYQ--------------------------------------------------P 249
           GW     +                                                    
Sbjct: 234 GWKAHQPWAIEVILPSGFDTRLVNGKIKKTIQEWQRMGIRTVGGRPWPHGNEEAELIRPD 293

Query: 250 GEKN------FAILKHWNASLNYNKTIAYIAAHIDGVPI 282
           G  N      F +L  WN S  Y  T+ ++A  I G PI
Sbjct: 294 GGPNFLVFNNFNVLMKWNRSTYYAGTVGWMAEQICGRPI 332


>gi|149913892|ref|ZP_01902424.1| hypothetical protein RAZWK3B_17853 [Roseobacter sp. AzwK-3b]
 gi|149812176|gb|EDM72007.1| hypothetical protein RAZWK3B_17853 [Roseobacter sp. AzwK-3b]
          Length = 268

 Score =  210 bits (535), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 105/271 (38%), Positives = 149/271 (54%), Gaps = 5/271 (1%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           +I LL     + + A+  P  A     C +    F  WKSA  A A R G+         
Sbjct: 1   MIRLLAP-LGLCSLALLPPLPAHAAA-CGNDGAGFAAWKSAFAAEAARAGVGQPGL-RAL 57

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A+ +Y   TIA DR   +    + + ++    +  IIAQG   K  ++     L+++YGV
Sbjct: 58  ANAQYASRTIAADRNQKS-FRYTLEKFMQVRGAETIIAQGRKRKARDAAFYDALERQYGV 116

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G+L+A+ G+ET FG  MG + ++S + TLAYDCRR+ FF      AL LV +G I++ 
Sbjct: 117 PAGVLIAIHGMETGFGGFMGDSAVVSAITTLAYDCRRSDFFIPHAIGALKLVDRGTITAD 176

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             GA  GE+G  QFLP N + Y +DA+ DG++DL     DA+AS A FL + GW   AGY
Sbjct: 177 TRGAKHGELGHTQFLPGNALTYGVDANGDGRVDLYT-LSDALASTANFLRQKGWQPGAGY 235

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
           Q GE NF +++ WNA+  Y K IA +A  ID
Sbjct: 236 QEGEPNFRVIQQWNAAGVYQKAIAIMAERID 266


>gi|161831017|ref|YP_001596781.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 331]
 gi|161762884|gb|ABX78526.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 331]
          Length = 333

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 87/339 (25%), Positives = 137/339 (40%), Gaps = 64/339 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ +K++L+S L+              +A  Q         +  W    R  A+  G+ P
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPS-------WVVWVKQLREEAISRGIRP 53

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +     F  ++     +    +      ++F  Y    +    I  G A  + + R+L  
Sbjct: 54  EVFDRAFNTVKEPSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQKHHRILTE 113

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q FYAL+++ 
Sbjct: 114 IGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRRAFFRKQLFYALEILN 173

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G ++  +  G   G  GQ QFLP +   YA+D D DG+ D+     DA AS A +LAK 
Sbjct: 174 GGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASIANYLAKH 233

Query: 240 GWTKCAGYQ--------------------------------------------------P 249
           GW     +                                                    
Sbjct: 234 GWKAHQPWAIEVILPSGFDTRLVNGKIKKTIQEWQRMGIRTVGGRPWPHGNEEAELIRPD 293

Query: 250 GEKN------FAILKHWNASLNYNKTIAYIAAHIDGVPI 282
           G  N      F +L  WN S  Y  T+ ++A  I G PI
Sbjct: 294 GGPNFLVFNNFNVLMKWNRSTYYAGTVGWMAEQICGRPI 332


>gi|13472659|ref|NP_104226.1| hypothetical protein mlr3027 [Mesorhizobium loti MAFF303099]
 gi|14023406|dbj|BAB50012.1| mlr3027 [Mesorhizobium loti MAFF303099]
          Length = 418

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 77/339 (22%), Positives = 129/339 (38%), Gaps = 65/339 (19%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           MS +        +M    L+ A+  P               F +W +  RA AV  G+S 
Sbjct: 12  MSVRNAAKRFTSVMTAASLSLALLMPAGPAFAD------AGFRQWVAGFRATAVAGGVSG 65

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
                 F D++  D  +    +          DY D     + +A G  + K     L  
Sbjct: 66  AVYDQAFRDIKEPDPVVLEKARTQPEFTAPAWDYFDNRVHDQSVAVGQQMAKKWKPWLDR 125

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLST----LATLAY-DCRRAKFFTEQFFYA 175
           ++  +GV   IL+A+W +E+++GE + +  ++      LATL Y D +R+K+   Q   A
Sbjct: 126 IEARFGVDRYILLAIWSMESNYGEILKRDDIMRNVIRSLATLGYGDPKRSKYARTQLVAA 185

Query: 176 LDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L +++ G I     +G+  G +GQ QF+P +   YA+D D +GK D+  S  DA+A++A 
Sbjct: 186 LKILQTGDIDESHLMGSWAGAMGQTQFIPTSYQHYAVDMDGNGKRDIWNSIPDALATSAN 245

Query: 235 FLAKLGWTKCAGY----------------------------------------------- 247
            L K GW     +                                               
Sbjct: 246 LLKKNGWQAGKTWGYEVTIPAGKLPGGSKTLAQWQALGVVRASGKPFKNLTDKATLKVPD 305

Query: 248 QPGEKNF------AILKHWNASLNYNKTIAYIAAHIDGV 280
             G   F      +++K +N +  Y   +  +A  I G 
Sbjct: 306 GRGGPAFLMVRNFSVIKAYNNADKYALAVGLLADEIAGG 344


>gi|239832907|ref|ZP_04681236.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
 gi|239825174|gb|EEQ96742.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
          Length = 274

 Score =  210 bits (533), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 99/267 (37%), Positives = 142/267 (53%), Gaps = 3/267 (1%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                +LA  +           C + A  +  W       A   G+         A  +Y
Sbjct: 10  WTAAAVLAMGMMTGTGIAEAAQCGNNAAGYNAWLQQTLKEAPSRGVGKAGLN-ALAGTKY 68

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR   +   +SF+D++    +  II +G A K+ N+ L   ++K YGVP G L
Sbjct: 69  AQATINADRNQKS-FKLSFEDFMKKRGADTIIKRGRAQKQQNAALFAAIEKRYGVPAGPL 127

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG+ET FG  +GK   LS +ATLAYDCRR+ +FT Q + AL L+ +G +S  A+GA 
Sbjct: 128 IAIWGMETGFGSYLGKQHTLSAVATLAYDCRRSDYFTGQLYAALKLIDQGDLSPQAVGAM 187

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GE+GQ QF+P NV+KY +        DL ++  DA+ S A FL   GW + AGYQPGE 
Sbjct: 188 HGEVGQTQFMPANVLKYGVSGSGGSHFDL-RNKADALHSTANFLVGHGWQRGAGYQPGEP 246

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+  ++ WNA+  Y + IA +   IDG
Sbjct: 247 NYGAIQGWNAAQVYQRAIAVMGKAIDG 273


>gi|212212629|ref|YP_002303565.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           CbuG_Q212]
 gi|212011039|gb|ACJ18420.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           CbuG_Q212]
          Length = 333

 Score =  209 bits (532), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 87/339 (25%), Positives = 139/339 (41%), Gaps = 64/339 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ +K++L+S L+              +A  Q         +  W    R  A+  G+ P
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPS-------WAVWVKQLREEAISRGIRP 53

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +     F+ ++     +    ++     ++F  Y    +    I  G A  + + R+L  
Sbjct: 54  EVFDQAFSTVKEPSRKVMHLERIQPERRITFLKYRSTRADPFRIRIGRAKYQKHHRILTE 113

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q FYAL+++ 
Sbjct: 114 IGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRKAFFRKQLFYALEILN 173

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G ++  +  G   G  GQ QFLP +   YA+D D DG+ D+     DA AS A +LAK 
Sbjct: 174 GGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASIANYLAKH 233

Query: 240 GWTKCAGYQ--------------------------------------------------P 249
           GW     +                                                    
Sbjct: 234 GWKAHQPWAIEVILPYGFDTRLVNGKIKKTIQEWQRMGIRTVGGRPWPHGNEEAELIRPD 293

Query: 250 GEKN------FAILKHWNASLNYNKTIAYIAAHIDGVPI 282
           G  N      F +L  WN S  Y  T+ ++A  I G PI
Sbjct: 294 GGPNFLVFNNFNVLMKWNRSTYYAGTVGWMAEQICGRPI 332


>gi|218889726|ref|YP_002438590.1| putative murein transglycosylase [Pseudomonas aeruginosa LESB58]
 gi|218769949|emb|CAW25710.1| putative murein transglycosylase [Pseudomonas aeruginosa LESB58]
          Length = 448

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 66/231 (28%), Positives = 110/231 (47%), Gaps = 2/231 (0%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA 78
            + A             +     F +W+ A R +A+  G+  +T    FA ++     + 
Sbjct: 53  FSGAGPAASVPAGAPNEAQPGQSFEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPAVVE 112

Query: 79  RDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGL 138
            DR            YL+G      + QG A    ++R+L  +   Y V    ++A+WG+
Sbjct: 113 ADRSQPE-FTRPVWKYLEGALDPLRVRQGQARLAQHARILGEVDARYAVDADAVVAIWGM 171

Query: 139 ETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIG 197
           E+++G  MG   ++ +LATLAY+ RR +F   Q   AL +++ G + +  + G+  G +G
Sbjct: 172 ESNYGSHMGNKNVIRSLATLAYEGRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGAMG 231

Query: 198 QFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           Q QF+P    +YA+D D DGK D+  S  DA+AS A +L   GW     + 
Sbjct: 232 QTQFIPTTYNQYAVDFDGDGKRDIWGSPGDALASTANYLKASGWIAGQPWG 282


>gi|254242677|ref|ZP_04935999.1| hypothetical protein PA2G_03440 [Pseudomonas aeruginosa 2192]
 gi|126196055|gb|EAZ60118.1| hypothetical protein PA2G_03440 [Pseudomonas aeruginosa 2192]
          Length = 448

 Score =  209 bits (531), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 66/234 (28%), Positives = 110/234 (47%), Gaps = 2/234 (0%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
               + A             +     F +W+ A R +A+  G+  +T    FA ++    
Sbjct: 50  TAPFSGAGPAASVPAGAPNEAQPGQSFEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPA 109

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            +  DR            YL+G      + QG A    ++R+L  +   Y V    ++A+
Sbjct: 110 VVEADRSQPE-FTRPVWKYLEGALDPLRVRQGQARLAQHARILGEVDARYAVDADAVVAI 168

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFG 194
           WG+E+++G  MG   ++ +LATLAY+ RR +F   Q   AL +++ G + +  + G+  G
Sbjct: 169 WGMESNYGSHMGNKNVIRSLATLAYEGRRPEFAHAQLLAALKILQHGDVPASFMIGSWAG 228

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            +GQ QF+P    +YA+D D DGK D+  S  DA+AS A +L   GW     + 
Sbjct: 229 AMGQTQFIPTTYNQYAVDFDGDGKRDIWGSPGDALASTANYLKASGWIAGQPWG 282


>gi|116052030|ref|YP_789126.1| putative murein transglycosylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|254236884|ref|ZP_04930207.1| hypothetical protein PACG_02905 [Pseudomonas aeruginosa C3719]
 gi|115587251|gb|ABJ13266.1| putative murein transglycosylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168815|gb|EAZ54326.1| hypothetical protein PACG_02905 [Pseudomonas aeruginosa C3719]
          Length = 448

 Score =  209 bits (531), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 66/233 (28%), Positives = 110/233 (47%), Gaps = 2/233 (0%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
              + A             +     F +W+ A R +A+  G+  +T    FA ++     
Sbjct: 51  APFSGAGPAASVPAGAPNEAQPGQSFEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPAV 110

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           +  DR            YL+G      + QG A    ++R+L  +   Y V    ++A+W
Sbjct: 111 VEADRSQPE-FTRPVWKYLEGALDPLRVRQGQARLAQHARILGEVDARYAVDADAVVAIW 169

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGE 195
           G+E+++G  MG   ++ +LATLAY+ RR +F   Q   AL +++ G + +  + G+  G 
Sbjct: 170 GMESNYGSHMGNKNVIRSLATLAYEGRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGA 229

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +GQ QF+P    +YA+D D DGK D+  S  DA+AS A +L   GW     + 
Sbjct: 230 MGQTQFIPTTYNQYAVDFDGDGKRDIWGSPGDALASTANYLKASGWIAGQPWG 282


>gi|153207654|ref|ZP_01946318.1| putative lytic murein transglycosylase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212218496|ref|YP_002305283.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           CbuK_Q154]
 gi|120576473|gb|EAX33097.1| putative lytic murein transglycosylase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212012758|gb|ACJ20138.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           CbuK_Q154]
          Length = 333

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 87/339 (25%), Positives = 138/339 (40%), Gaps = 64/339 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ +K++L+S L+              +A  Q         +  W    R  A+  G+ P
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPS-------WALWVKQLREEAISRGIRP 53

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +     F+ ++     +    +      ++F  Y    +    I  G A  + + R+L  
Sbjct: 54  EVFDRAFSTVKESSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQKHHRILTE 113

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q FYAL+++ 
Sbjct: 114 IGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRKAFFRKQLFYALEILN 173

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G ++  +  G   G  GQ QFLP +   YA+D D DG+ D+     DA AS A +LAK 
Sbjct: 174 GGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASIANYLAKH 233

Query: 240 GWTKCAGYQ--------------------------------------------------P 249
           GW     +                                                    
Sbjct: 234 GWKAHQPWAIEVILPSGFDTRLVNGKIKKTIQEWQRMGIRTVGGRPWPHGNEEAELIRPD 293

Query: 250 GEKN------FAILKHWNASLNYNKTIAYIAAHIDGVPI 282
           G  N      F +L  WN S  Y  T+ ++A  I G PI
Sbjct: 294 GGPNFLVFNNFNVLMKWNRSTYYAGTVGWMAEQICGRPI 332


>gi|165918874|ref|ZP_02218960.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 334]
 gi|165917422|gb|EDR36026.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 334]
          Length = 333

 Score =  208 bits (530), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 87/339 (25%), Positives = 138/339 (40%), Gaps = 64/339 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ +K++L+S L+              +A  Q         +  W    R  A+  G+ P
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPS-------WALWVKQLREEAISRGIRP 53

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +     F+ ++     +    +      ++F  Y    +    I  G A  + + R+L  
Sbjct: 54  EVFDRAFSTVKESSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQKHHRILTE 113

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q FYAL+++ 
Sbjct: 114 IGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRKAFFRKQLFYALEILN 173

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G ++  +  G   G  GQ QFLP +   YA+D D DG+ D+     DA AS A +LAK 
Sbjct: 174 GGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASIANYLAKH 233

Query: 240 GWTKCAGYQ--------------------------------------------------P 249
           GW     +                                                    
Sbjct: 234 GWKAHQPWAIEVILPSGFDTRLLNGKIKKTIQEWQRMGIRTVGGRPWPHGNEEAELIRPD 293

Query: 250 GEKN------FAILKHWNASLNYNKTIAYIAAHIDGVPI 282
           G  N      F +L  WN S  Y  T+ ++A  I G PI
Sbjct: 294 GGPNFLVFNNFNVLMKWNRSTYYAGTVGWMAEQICGRPI 332


>gi|70732748|ref|YP_262511.1| lytic murein transglycosylase family protein [Pseudomonas
           fluorescens Pf-5]
 gi|68347047|gb|AAY94653.1| lytic murein transglycosylase family protein [Pseudomonas
           fluorescens Pf-5]
          Length = 430

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 74/259 (28%), Positives = 119/259 (45%), Gaps = 9/259 (3%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L  + P    A       T   +       F +W +A RA A+  G+  +     FA + 
Sbjct: 28  LPSLQPAPLAAPATVAPLTVDNLDIQPTQTFDQWLNAFRAEALGAGIRAEVFDRAFAGVT 87

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
              + I  DR           +YL+G  S   + +G AL    S +L  +++ YGV    
Sbjct: 88  PDMSVIKADRSQPE-FSRPVWEYLEGALSPVRVRKGQALLVQYSDILQRIEQRYGVDRQA 146

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-G 190
           L+A+WG+E++FG+  G   ++ +LATLAY+ RR  F   Q   AL +++ G I    + G
Sbjct: 147 LVAVWGMESNFGDFQGNKSVIRSLATLAYEGRRPAFANSQLIAALQIIQHGDIQPEKMLG 206

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           +  G +GQ QF+P     +A+D D DG+ D+  S  DA+AS A +L   GW +   +   
Sbjct: 207 SWAGAMGQTQFIPTTYNTHAVDFDGDGRRDIWNSPADALASTAHYLQSSGWQQGQPWGLE 266

Query: 251 EKNFAILKHWNASLNYNKT 269
            +        N+  +Y   
Sbjct: 267 VQ-------LNSGFDYALA 278



 Score = 48.3 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 31/235 (13%), Positives = 66/235 (28%), Gaps = 24/235 (10%)

Query: 54  VREGMSPKTA------KHLFADLEYLDTTIA-RDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
            R G+  +        +  F D +   + I             +F +     +   I   
Sbjct: 138 QRYGVDRQALVAVWGMESNFGDFQGNKSVIRSLATLAYEGRRPAFANSQLIAALQIIQHG 197

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP-LLSTLATLAYDCRRA 165
            I  +K        + +   +P         ++                LA+ A+  + +
Sbjct: 198 DIQPEKMLGSWAGAMGQTQFIPTTYNT--HAVDFDGDGRRDIWNSPADALASTAHYLQSS 255

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
            +   Q +     +  G   + A  +T   +G         ++  +    +GK     S 
Sbjct: 256 GWQQGQPWGLEVQLNSGFDYALADSSTRKSVG-------EWMRLGMTPA-NGKALPYGSE 307

Query: 226 IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                S A  L   G+           NF  +  +N S +Y   +  ++    G 
Sbjct: 308 H---LS-ASLLLPAGYR--GPAFLILDNFRAVLKYNNSSSYALAVNLLSERFGGA 356


>gi|85704443|ref|ZP_01035545.1| peptidoglycan binding domain protein [Roseovarius sp. 217]
 gi|85670851|gb|EAQ25710.1| peptidoglycan binding domain protein [Roseovarius sp. 217]
          Length = 405

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 78/307 (25%), Positives = 129/307 (42%), Gaps = 58/307 (18%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           +     F  W +  R RAV +G++ +     F  + +    +A+DR           DYL
Sbjct: 31  ASANPGFDNWIAGFRGRAVAQGVNGQVFDRAFRGVTFNPEIVAKDRNQSE-FKREIWDYL 89

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
           D   S   +  G    + N R L  ++  YGV   ++ A+WG+E+ +GE +G  PL+ +L
Sbjct: 90  DSAVSPVRVKNGEEAVRRNRRALDRIEAHYGVEKEVVAAVWGMESTYGERLGDLPLIQSL 149

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLAYD RR  FF +Q   AL +++ G ++  +  G+  G +G  QF+P + + YA+D  
Sbjct: 150 ATLAYDGRRGAFFEKQLIAALQILQSGDVTPENMKGSWAGAMGHTQFIPTSYLAYAVDFT 209

Query: 215 EDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQPGEK--------------------- 252
            DGK D+   +  DA+AS A +L + GWTK   +    +                     
Sbjct: 210 GDGKRDIWSDNPTDALASTAAYLKRFGWTKGQPWGVEVRLPRGFSTGSAKSKRMPSQWAA 269

Query: 253 ------NFAILKHW----------------------------NASLNYNKTIAYIAAHID 278
                 +   ++ +                            N S  Y   + ++A  I 
Sbjct: 270 QGVVGVDGRAVRDYGGASIYLPAGLQGPAFMVFDNFGVIKRYNNSDAYAMGVGHLADRIG 329

Query: 279 GVPIGKG 285
           G P  +G
Sbjct: 330 GGPEVQG 336


>gi|313109433|ref|ZP_07795393.1| hypothetical protein PA39016_001790033 [Pseudomonas aeruginosa
           39016]
 gi|310881895|gb|EFQ40489.1| hypothetical protein PA39016_001790033 [Pseudomonas aeruginosa
           39016]
          Length = 448

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 67/233 (28%), Positives = 110/233 (47%), Gaps = 2/233 (0%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
                A      +      +     F +W+ A R +A+  G+  +T    FA +E     
Sbjct: 51  APFTGAGPAASVSAGAPSEAQPGQSFEQWRDAFRQQALAGGIDAQTFDRAFAGVEPDPAV 110

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           +  DR            YL+G      + QG A    ++R+L  +   Y V    ++A+W
Sbjct: 111 VEADRSQPE-FTRPVWKYLEGALDPLRVRQGQARLAQHARILGEVDARYAVDADAVVAIW 169

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGE 195
           G+E+++G  MG   ++ +LATLAY+ RR +F   Q   AL +++ G + +  + G+  G 
Sbjct: 170 GMESNYGSHMGNKNVIRSLATLAYEGRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGA 229

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +GQ QF+P    +YA+D D DGK D+  S  DA+AS A +L   GW     + 
Sbjct: 230 MGQTQFIPTTYNQYAVDFDGDGKRDIWGSPGDALASTANYLKASGWIAGQPWG 282


>gi|259418572|ref|ZP_05742489.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
 gi|259344794|gb|EEW56648.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
          Length = 269

 Score =  208 bits (530), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 98/272 (36%), Positives = 145/272 (53%), Gaps = 3/272 (1%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           ++S  +  + + A        A     C +T+  F  WK+     A R G+         
Sbjct: 1   MLSSRLAAFGLAASLAIATPIAGLAASCGNTSAGFEAWKADFARTAKRAGVRQAGLN-AL 59

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A   Y   TIA DR   +    S + ++    ++ I+AQG   K  N+     L+++YGV
Sbjct: 60  AQTRYATGTIAADRNQKS-FRYSLEKFMQVRGATTIVAQGRKHKARNAEFFAALERKYGV 118

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G+L+A+ G+ET FG  MG + ++S++ TL YDCRR+KFF      AL LV +G IS  
Sbjct: 119 PAGLLIAIHGMETAFGNYMGDSQVVSSIVTLTYDCRRSKFFEPHAIGALKLVDQGAISMA 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             GA  GE+G  QFLP N ++Y  D + DG++D   +  DA+AS A FL + GW    GY
Sbjct: 179 TKGAKHGELGHTQFLPGNALEYGQDWNGDGRVDFY-NMGDALASTANFLRQKGWRPGKGY 237

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           Q GE N+ +LK WNA+  Y +++A +   IDG
Sbjct: 238 QQGEPNYKVLKQWNAATVYQQSLAIMGRQIDG 269


>gi|56697155|ref|YP_167519.1| hypothetical protein SPO2296 [Ruegeria pomeroyi DSS-3]
 gi|56678892|gb|AAV95558.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 280

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 99/251 (39%), Positives = 135/251 (53%), Gaps = 3/251 (1%)

Query: 28  KATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSP 87
                  C +T   F  WK+     A R+G+  +      A   Y   TIA DR   +  
Sbjct: 32  SPALALTCGNTGAGFEAWKAEFAKVARRQGVGKRGLD-ALAQARYATRTIAADRNQKS-F 89

Query: 88  PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
             S + ++    +  I+AQG   K  N      L+++YGVP GIL+AL G+ET FG  MG
Sbjct: 90  KYSLEKFMQVRGADTIVAQGRKRKARNPEFYAALERQYGVPAGILIALHGMETAFGSFMG 149

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVV 207
            + ++S + TLAYDCRR+ FF      AL+LV +  I+    GA  GE+G  QFLP N +
Sbjct: 150 DSAVVSAITTLAYDCRRSDFFIPHALAALELVDRSAITGATKGAKHGELGHTQFLPGNAL 209

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYN 267
            Y +DA  DG++D      DA+AS A FL + GW    GYQPGE NFA++K WNA+  Y 
Sbjct: 210 TYGVDATGDGRVDFY-DMTDALASTANFLRQKGWQPGRGYQPGEPNFAVIKQWNAASVYQ 268

Query: 268 KTIAYIAAHID 278
           + IA +A  ID
Sbjct: 269 QAIAIMARRID 279


>gi|99080860|ref|YP_613014.1| hypothetical protein TM1040_1019 [Ruegeria sp. TM1040]
 gi|99037140|gb|ABF63752.1| hypothetical protein TM1040_1019 [Ruegeria sp. TM1040]
          Length = 270

 Score =  208 bits (529), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 96/273 (35%), Positives = 142/273 (52%), Gaps = 3/273 (1%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           ++   +    ++        +      C +TA  F  WK+     A R G+         
Sbjct: 1   MLFSRLAALGLVTCLAVATPEVVRAASCGNTAAGFEAWKADFARTAKRAGVRQAGLN-AL 59

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A   Y   TIA DR   +    S + ++    ++ I+AQG   K  N+     L+++YGV
Sbjct: 60  AQTRYATGTIAADRNQKS-FRYSLEKFMQVRGATTIVAQGRRHKARNAEFFAALERKYGV 118

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G+L+A+ G+ET FG  MG + ++S++ TL YDCRR++FF      AL LV +G IS  
Sbjct: 119 PAGLLIAIHGMETAFGNYMGDSQVVSSIVTLTYDCRRSEFFEPHAIGALKLVDQGAISMA 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             GA  GE+G  QFLP N +KY  D + DG++D      DA+AS A FL + GW    GY
Sbjct: 179 TKGAKHGELGHTQFLPGNALKYGQDWNRDGRVDFY-DMGDALASTAHFLRQKGWRPGKGY 237

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
           Q GE N+ +LK WNA+  Y +++A +   IDG 
Sbjct: 238 QQGEPNYKVLKQWNAATVYQQSLAIMGRQIDGS 270


>gi|91775566|ref|YP_545322.1| lytic murein transglycosylase [Methylobacillus flagellatus KT]
 gi|91709553|gb|ABE49481.1| Lytic murein transglycosylase [Methylobacillus flagellatus KT]
          Length = 417

 Score =  208 bits (528), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 90/343 (26%), Positives = 146/343 (42%), Gaps = 72/343 (20%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M   +  L  +L+      A +                   F EW       A+ +G+S 
Sbjct: 1   MLKLRRSLAFILVCSLFYSALSHA-------------DGQSFDEWMQDFNRDALSQGISE 47

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T +   AD E +   +  D+        +F +YL+   + + IA+G AL +    LL +
Sbjct: 48  TTLQAALADAEPIARVVELDQAQPE-FVQTFLNYLNRRVTPKQIARGQALLQEQEHLLRS 106

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++++YGVP  IL+A WGLET++G+T+G       LATLAY+ RR  FF  Q   AL ++ 
Sbjct: 107 VEQQYGVPAAILLAFWGLETNYGQTLGGFSTPQALATLAYEGRRHAFFRSQLLDALRIID 166

Query: 181 KGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G I + + +G+  G IG  QF+P   + YA D D DG+I++ +S  DA+ SA ++L  +
Sbjct: 167 AGHIEAGNMVGSWAGAIGHMQFMPSTFLAYAEDGDGDGRINVWQSIPDAMVSAGRYLHSI 226

Query: 240 GWTKCAG--------------------------YQPGE---------------------- 251
           GW +                             +Q                         
Sbjct: 227 GWRRGEPVAIEVTLPDDFAWQYAALNQKRSVEQWQEQGVQAADQQALPIGLNAAIVLPQG 286

Query: 252 ---------KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
                     NF+++  WN S +Y  T+A++A+ + G P   G
Sbjct: 287 WRGPAFMVFDNFSVVMQWNRSTSYALTVAHLASRLQGGPALIG 329


>gi|114765308|ref|ZP_01444425.1| hypothetical protein 1100011001355_R2601_24714 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542288|gb|EAU45317.1| hypothetical protein R2601_24714 [Roseovarius sp. HTCC2601]
          Length = 270

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 94/268 (35%), Positives = 136/268 (50%), Gaps = 5/268 (1%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           +                     C + A  F  WK A  A A R G+  +  + L  + +Y
Sbjct: 5   VFRLAAAVTLGLATAGTVQAATCGNNASGFNAWKQAFAAEAQRAGVGQRGIQALM-NAQY 63

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGL--SSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
             TTI+ DR        +  D++     S     A G    + N +    +++ YGVP G
Sbjct: 64  STTTISADRNQ-KGVKYALNDFIRIRLGSLDGFAATGRKRIQRNPQFYAAVEQRYGVPAG 122

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALG 190
           IL+A+ G+ET FG TMG  P++S+++T+AYDCRR+ FFT     AL +V +G++S    G
Sbjct: 123 ILVAIHGMETGFGRTMGNVPVVSSISTVAYDCRRSSFFTPHALAALQMVDRGMLSPTQKG 182

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           A  GE+G  QFLP N ++Y +D + DG++D      DA+AS A FL + GW     YQ G
Sbjct: 183 AAHGELGHTQFLPGNAMRYGVDGNGDGRVDFYNEW-DALASTANFLRQKGWRPGQPYQQG 241

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             NF +L  WNA+  Y + IA  A  ID
Sbjct: 242 TANFRVLNEWNAATVYQQAIALAAERID 269


>gi|167035840|ref|YP_001671071.1| lytic murein transglycosylase [Pseudomonas putida GB-1]
 gi|166862328|gb|ABZ00736.1| lytic murein transglycosylase [Pseudomonas putida GB-1]
          Length = 438

 Score =  207 bits (527), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 77/255 (30%), Positives = 122/255 (47%), Gaps = 2/255 (0%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           A  VT P               F +W++  R +A++ G+SP T    F  +      I  
Sbjct: 44  APVVTVPGTTPDVSTEIQPLQTFAQWQAGFRQQALQAGISPSTFDRAFLGVTPDMDVIKA 103

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR           +YL+G  S   +  G  L + N+ LL  L++ YGV   +L+A+WG+E
Sbjct: 104 DRSQPE-FTRPVWEYLEGALSPLRVRNGKKLLEQNAELLTRLEQRYGVDRQVLVAVWGME 162

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQ 198
           ++FG+  G   ++ +LATLAY+ RR +F  +Q   AL +++ G I      G+  G +GQ
Sbjct: 163 SNFGQFQGNKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQ 222

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILK 258
            QF+P     +A+D D DG+ D+  S  DA+AS A +L   GW +   +    +  A   
Sbjct: 223 TQFIPTTYNTHAVDFDGDGRRDIWNSTPDALASTAHYLQSSGWKRGQPWGFEVQVPAGFD 282

Query: 259 HWNASLNYNKTIAYI 273
            W A     K ++  
Sbjct: 283 FWQADGALRKPVSEW 297



 Score = 49.5 bits (116), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 28/234 (11%), Positives = 58/234 (24%), Gaps = 24/234 (10%)

Query: 54  VREGMSPKTA------KHLFADLEYLDTTIA-RDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
            R G+  +        +  F   +   + I              F       +   I   
Sbjct: 146 QRYGVDRQVLVAVWGMESNFGQFQGNKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHG 205

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP-LLSTLATLAYDCRRA 165
            I  +         + +   +P         ++                LA+ A+  + +
Sbjct: 206 DIQPEAMRGSWAGAMGQTQFIPTTYNT--HAVDFDGDGRRDIWNSTPDALASTAHYLQSS 263

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
            +   Q +     V  G     A GA    + ++  + V +           +       
Sbjct: 264 GWKRGQPWGFEVQVPAGFDFWQADGALRKPVSEWLAMGVKLPAGTQLPAGSNQ------- 316

Query: 226 IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
                SAA  L                NF  +  +N S +Y   ++ +     G
Sbjct: 317 ----LSAALLLPAG---ARGPAFLVLDNFRAILKYNNSSSYALAVSLLGDRFSG 363


>gi|157961727|ref|YP_001501761.1| lytic murein transglycosylase [Shewanella pealeana ATCC 700345]
 gi|157846727|gb|ABV87226.1| lytic murein transglycosylase [Shewanella pealeana ATCC 700345]
          Length = 396

 Score =  207 bits (525), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 89/328 (27%), Positives = 134/328 (40%), Gaps = 64/328 (19%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           ++   P+    +     A       D    +    +  +  A  EG+S +T +   A+++
Sbjct: 1   MLKSIPLATALILSTSAAYAA----DEQPNWASCVAELQQTAKAEGLSQQTIETTLANVK 56

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y+   I  D+K       SF++Y     +   + QG  L   +  LL  L KEYGVPP  
Sbjct: 57  YVPRVIELDQKQPE-FSTSFENYFSKRVTDWRVEQGRKLYSEHKVLLQKLAKEYGVPPQY 115

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALG 190
           L+A WGLET+FG   GK  +L +LATLA D RR+++FT +   AL L ++     +  +G
Sbjct: 116 LLAFWGLETNFGSYKGKMSVLDSLATLACDPRRSRYFTTELMQALKLKERYNFDEADMVG 175

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP- 249
           +  G +G  QF+P    KYA+D + DGK DL  S  DA+ SAA FL  LGW +   +   
Sbjct: 176 SWAGAMGHTQFMPSAYAKYAVDGNGDGKADLWNSTEDALTSAANFLQNLGWKRNERWGRE 235

Query: 250 ------------GEKNFAILKHW------------------------------------- 260
                       G+     L  W                                     
Sbjct: 236 VTLPENFSYAHLGKAESQPLTRWAELGITQTNGAPLSTPDMQAALYLPSGHTGPAFLGYD 295

Query: 261 --------NASLNYNKTIAYIAAHIDGV 280
                   N S  Y   + ++A  I+G 
Sbjct: 296 NFDVIMRWNRSTFYAIAVGHLADRINGA 323


>gi|254510020|ref|ZP_05122087.1| lytic murein transglycosylase [Rhodobacteraceae bacterium KLH11]
 gi|221533731|gb|EEE36719.1| lytic murein transglycosylase [Rhodobacteraceae bacterium KLH11]
          Length = 264

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 101/268 (37%), Positives = 147/268 (54%), Gaps = 4/268 (1%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           ++ +       V  P  A +   C +T++ F  WK+     A R G+  K  +   A  +
Sbjct: 1   MLRLTLFFTLTVLLPSLAFSAP-CGNTSNGFEAWKADFAKTAKRAGVKKKGLQ-ALAQTQ 58

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y   TIA DR   +    S   ++    +  I+AQG   K  N +    L+++YGVP G+
Sbjct: 59  YATRTIAADRNQKS-FKYSLDKFMQVRGADTIVAQGRKRKARNPQFYAALERQYGVPAGV 117

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGA 191
           L+A+ G+ET FG  MG + ++S + TLAYDCRR++FF      AL LV +G I+    GA
Sbjct: 118 LIAIHGMETGFGNFMGDSQVVSAITTLAYDCRRSEFFIPHAIGALKLVDQGSITVATKGA 177

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             GE+G  QFLP N + Y +DA  D ++D   +  DA+AS A FL K GW    GYQPGE
Sbjct: 178 KHGELGHTQFLPGNALTYGVDATGDRQVDFY-NLTDALASTANFLRKKGWKPGRGYQPGE 236

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDG 279
            NFA+++ WNA+  Y ++IA +A  ID 
Sbjct: 237 PNFAVIQQWNAASVYQQSIAIMAWRIDN 264


>gi|307546096|ref|YP_003898575.1| lytic murein transglycosylase [Halomonas elongata DSM 2581]
 gi|307218120|emb|CBV43390.1| lytic murein transglycosylase [Halomonas elongata DSM 2581]
          Length = 433

 Score =  206 bits (524), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 69/261 (26%), Positives = 112/261 (42%), Gaps = 15/261 (5%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVT------------QPKKATTQFICSDTADRFGEWKSA 48
           M+FK  L +++L         A +                     +       F  W + 
Sbjct: 13  MTFKL-LPLAVLCAALVGCQSAQSRDARAESPATAESAAPTAEAPVSEAQEADFETWLAN 71

Query: 49  ARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGI 108
            R +A  EG+   T       L Y    I  D            +YLD   S+  + +G 
Sbjct: 72  FRRQARGEGIDEATLARALDGLRYRPRVIELDGSQPE-FVRPIWEYLDSAVSASRVKKGR 130

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
                    +  + + YGVP  +L+A+WG+E+ +G+ +G    L  LATLAYD RR  F 
Sbjct: 131 ERLAEYRDTVRQMTERYGVPGEVLVAIWGIESSYGDYLGDFSTLEALATLAYDGRRRDFA 190

Query: 169 TEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
             +   AL +++ G IS   + G+  G +G  QF+P + + +A+D D DG+ D+  S  D
Sbjct: 191 RGELLAALRIIEAGDISPERMKGSWAGAMGHTQFIPSSFLAHAVDGDGDGRRDIWNSIAD 250

Query: 228 AIASAAKFLAKLGWTKCAGYQ 248
            +AS A +L + GW +   + 
Sbjct: 251 VLASTANYLDEAGWREGEPWG 271


>gi|107103508|ref|ZP_01367426.1| hypothetical protein PaerPA_01004578 [Pseudomonas aeruginosa PACS2]
          Length = 448

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 66/233 (28%), Positives = 110/233 (47%), Gaps = 2/233 (0%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
              + A             +     F +W+ A R +A+  G+  +T    FA ++     
Sbjct: 51  APFSGAGPAASVPAGAPNEAQPGQSFEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPAV 110

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           +  DR            YL+G      + QG A    ++R+L  +   Y V    ++A+W
Sbjct: 111 VEADRSQPE-FTRPVWKYLEGALDPLRVRQGQARLAQHARILGEVDARYAVDADAVVAIW 169

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGE 195
           G+E+++G  MG   ++ +LATLAY+ RR +F   Q   AL +++ G + +  + G+  G 
Sbjct: 170 GMESNYGSHMGNKNVIRSLATLAYEGRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGA 229

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +GQ QF+P    +YA+D D DGK D+  S  DA+AS A +L   GW     + 
Sbjct: 230 MGQTQFIPTTYNQYAVDFDGDGKRDIWGSPGDALASTASYLKASGWIAGQPWG 282


>gi|15599187|ref|NP_252681.1| hypothetical protein PA3992 [Pseudomonas aeruginosa PAO1]
 gi|9950184|gb|AAG07379.1|AE004817_3 hypothetical protein PA3992 [Pseudomonas aeruginosa PAO1]
          Length = 448

 Score =  206 bits (523), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 66/233 (28%), Positives = 110/233 (47%), Gaps = 2/233 (0%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
              + A             +     F +W+ A R +A+  G+  +T    FA ++     
Sbjct: 51  APFSGAGPAASVPAGAPNEAQPGQSFEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPAV 110

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           +  DR            YL+G      + QG A    ++R+L  +   Y V    ++A+W
Sbjct: 111 VEADRSQPE-FTRPVWKYLEGALDPLRVRQGQARLAQHARILGEVDARYAVDADAVVAIW 169

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGE 195
           G+E+++G  MG   ++ +LATLAY+ RR +F   Q   AL +++ G + +  + G+  G 
Sbjct: 170 GMESNYGSHMGNKNVIRSLATLAYEGRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGA 229

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +GQ QF+P    +YA+D D DGK D+  S  DA+AS A +L   GW     + 
Sbjct: 230 MGQTQFIPTTHNQYAVDFDGDGKRDIWGSPGDALASTANYLKASGWIAGQPWG 282


>gi|119775164|ref|YP_927904.1| membrane-bound lytic transglycolase-like protein [Shewanella
           amazonensis SB2B]
 gi|119767664|gb|ABM00235.1| membrane-bound lytic transglycolase-related protein [Shewanella
           amazonensis SB2B]
          Length = 401

 Score =  205 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 92/317 (29%), Positives = 138/317 (43%), Gaps = 61/317 (19%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
           +       T F        F +  +  +  A   G+SP++   +   ++ L   +  DR 
Sbjct: 7   LASSLSILTAFSAGAEPRTFEQCIADIKVDAQSAGISPQSI-AVLDSVKPLQRVVELDRS 65

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                  +F DY +   +   I++G  + K +  LL  L+KEYGVPP  L+A WGLET+F
Sbjct: 66  QPE-FTQTFADYFNKRVTERRISEGQKMLKTHGALLNKLQKEYGVPPQYLLAFWGLETNF 124

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFGEIGQFQF 201
           G   GK P+L  LATLA D RR+++FT++   AL L  K G+     +G+  G +G  QF
Sbjct: 125 GGYKGKMPVLDALATLACDARRSQYFTQELLQALRLGDKFGLSFEDMVGSWAGAMGHTQF 184

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W-------------- 241
           +P   + YA+D D DGK+DL  S  DA++SAA FL +LG      W              
Sbjct: 185 MPTTYLTYAVDGDGDGKVDLWNSTEDALSSAANFLMQLGWQRNERWGREVLLPKHYDYES 244

Query: 242 ------TKCAGYQP--------------------------------GEKNFAILKHWNAS 263
                    A +Q                                 G  NF +++ WN S
Sbjct: 245 LGRDHRKPLAEWQTLGLTTVFGHPIPTAPMDAALYLPAGHTGPAFLGYSNFEVIQRWNRS 304

Query: 264 LNYNKTIAYIAAHIDGV 280
             Y   + ++A  I+G 
Sbjct: 305 EFYALAVGHLADRINGA 321


>gi|152985260|ref|YP_001346502.1| putative lipoprotein [Pseudomonas aeruginosa PA7]
 gi|150960418|gb|ABR82443.1| lipoprotein, putative [Pseudomonas aeruginosa PA7]
          Length = 448

 Score =  205 bits (521), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 67/237 (28%), Positives = 116/237 (48%), Gaps = 2/237 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           +          T P  ++     +  A  F +W+ A R +A+ +G+  +T    FAD++ 
Sbjct: 47  LPAKSSTGARPTVPGYSSVTADAAQPAQSFEQWREAFRQQALADGIDAQTFDRAFADVQP 106

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
               +  DR            YL+G      + QG A    ++R+L  +   Y V    +
Sbjct: 107 DPAVVEADRSQPE-FTRPVWKYLEGALDPLRVRQGQARLARHARILEQVDARYAVDANAV 165

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GA 191
           +A+WG+E+++G  MG   ++ +LATLAY+ RR +F   Q   +L +++ G + +  + G+
Sbjct: 166 VAIWGMESNYGSHMGNKNVIRSLATLAYEGRRPEFAHAQLLASLKILQHGDVPASFMIGS 225

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
             G +GQ QF+P    +YA+D D DG+ D+  S  DA+AS A +L   GW     + 
Sbjct: 226 WAGAMGQTQFIPTTYNQYAVDFDGDGRRDIWGSPGDALASTANYLKASGWIAGQPWG 282



 Score = 42.9 bits (99), Expect = 0.058,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 11/28 (39%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGV 280
           NF  +  +N S  Y   +  +A    G 
Sbjct: 347 NFRAILKYNNSSAYALAVGLLADSFKGG 374


>gi|325276751|ref|ZP_08142465.1| lytic murein transglycosylase [Pseudomonas sp. TJI-51]
 gi|324098115|gb|EGB96247.1| lytic murein transglycosylase [Pseudomonas sp. TJI-51]
          Length = 438

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 119/255 (46%), Gaps = 2/255 (0%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           A  VT P               F +W++  R +A++ G+SP      F  +      I  
Sbjct: 44  APVVTVPGATPDASTEIQPLQTFAQWQAGFREQALQAGISPSIFDRAFLGVTPDMDVIKA 103

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR           +YL+G  S   +  G  L   N+ LL  +++ YGV   +L+A+WG+E
Sbjct: 104 DRSQPE-FSRPVWEYLEGALSPLRVRNGKRLLDQNAELLTRIEQRYGVDRQVLVAVWGME 162

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQ 198
           ++FG+  G   ++ +LATLAY+ RR +F  +Q   AL +++ G I      G+  G +GQ
Sbjct: 163 SNFGQFQGNKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQ 222

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILK 258
            QF+P     +A+D D DG+ D+  S  DA+AS A +L   GW +   +    +      
Sbjct: 223 TQFIPTTYNTHAVDFDGDGRRDIWNSTPDALASTAHYLQSSGWKRGQPWGFEVQVPPGFD 282

Query: 259 HWNASLNYNKTIAYI 273
            W A     + ++  
Sbjct: 283 FWQADGALRRPVSEW 297



 Score = 51.4 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/234 (12%), Positives = 59/234 (25%), Gaps = 24/234 (10%)

Query: 54  VREGMSPKTA------KHLFADLEYLDTTIA-RDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
            R G+  +        +  F   +   + I              F       +   I   
Sbjct: 146 QRYGVDRQVLVAVWGMESNFGQFQGNKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHG 205

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP-LLSTLATLAYDCRRA 165
            I  +         + +   +P         ++                LA+ A+  + +
Sbjct: 206 DIQPEAMRGSWAGAMGQTQFIPTTYNT--HAVDFDGDGRRDIWNSTPDALASTAHYLQSS 263

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
            +   Q +     V  G     A GA    + ++  + V +           +       
Sbjct: 264 GWKRGQPWGFEVQVPPGFDFWQADGALRRPVSEWLAMGVKLPTGTQLPAGSNQ------- 316

Query: 226 IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
                SAA  L                NF  +  +N S +Y   ++ +A    G
Sbjct: 317 ----LSAALLLPAG---ARGPAFLVLDNFRAILKYNNSSSYALAVSLLADRFSG 363


>gi|104783758|ref|YP_610256.1| membrane-bound lytic murein transglycosylase [Pseudomonas
           entomophila L48]
 gi|95112745|emb|CAK17473.1| membrane-bound lytic murein transglycosylase [Pseudomonas
           entomophila L48]
          Length = 437

 Score =  205 bits (521), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 76/255 (29%), Positives = 124/255 (48%), Gaps = 2/255 (0%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           A  VT P               F +W++  R +A++ G+SP      F  +      I  
Sbjct: 44  APVVTLPSTTPEVSTEIQPLQTFAQWQAGFRQQALQAGISPSLFDRAFLGVTPDMDVIKA 103

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR           +YLDG  S   +  G  L + NS LL  +++ YGV   +L+++WG+E
Sbjct: 104 DRSQPE-FTRPVWEYLDGALSPLRVRNGKKLLEQNSELLSRIEQRYGVDRQVLVSVWGME 162

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQ 198
           ++FG+  G   ++ +LATLAY+ RR +F  +Q   AL +++ G I      G+  G +GQ
Sbjct: 163 SNFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQILQNGDIQPDAMRGSWAGAMGQ 222

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILK 258
            QF+P   + +A+D D DG+ D+  S  DA+AS A +L   GW +   +    +  A   
Sbjct: 223 TQFIPTTYLTHAVDFDGDGRRDIWNSTADALASTAHYLQASGWKRGQPWGFEVQVPAGFD 282

Query: 259 HWNASLNYNKTIAYI 273
            W A  +  K+++  
Sbjct: 283 FWLADGSQRKSVSEW 297



 Score = 47.6 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/234 (11%), Positives = 58/234 (24%), Gaps = 24/234 (10%)

Query: 54  VREGMSPKTA------KHLFADLEYLDTTIA-RDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
            R G+  +        +  F   +   + I              F       +   +   
Sbjct: 146 QRYGVDRQVLVSVWGMESNFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQILQNG 205

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP-LLSTLATLAYDCRRA 165
            I            + +   +P   L     ++                LA+ A+  + +
Sbjct: 206 DIQPDAMRGSWAGAMGQTQFIPTTYLT--HAVDFDGDGRRDIWNSTADALASTAHYLQAS 263

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
            +   Q +     V  G     A G+    + ++  L V +           +       
Sbjct: 264 GWKRGQPWGFEVQVPAGFDFWLADGSQRKSVSEWLQLGVTLPAGTQLPAGSSQ------- 316

Query: 226 IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
                SAA  L                NF  +  +N S +Y   ++ +     G
Sbjct: 317 ----LSAALLLPAG---ARGPAFLVLDNFRAILKYNNSSSYALAVSLLGDRFYG 363


>gi|170719809|ref|YP_001747497.1| lytic murein transglycosylase [Pseudomonas putida W619]
 gi|169757812|gb|ACA71128.1| lytic murein transglycosylase [Pseudomonas putida W619]
          Length = 438

 Score =  205 bits (520), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 71/230 (30%), Positives = 114/230 (49%), Gaps = 2/230 (0%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           A  VT P               F +W++  R +A++ G+S  T    F  +      I  
Sbjct: 44  APVVTLPSAKPDVSTEIQPLQTFAQWQAGFRQQALQAGISANTFDRAFIGVTPDMDVIKA 103

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR           +YL+G  S   +  G  L + N+ LL  L++ YGV   +L+++WG+E
Sbjct: 104 DRSQPE-FTRPVWEYLEGALSPLRVRNGKKLLEQNAELLARLEQRYGVDRQVLVSVWGME 162

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQ 198
           ++FG+  G   ++ +LATLAY+ RR +F  +Q   AL +++ G I      G+  G +GQ
Sbjct: 163 SNFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQ 222

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            QF+P     +A+D D DG+ D+  S  DA+AS A +L   GW +   + 
Sbjct: 223 TQFIPTTYNTHAVDFDGDGRRDIWNSTPDALASTAHYLQSSGWKRGQPWG 272



 Score = 44.9 bits (104), Expect = 0.015,   Method: Composition-based stats.
 Identities = 30/234 (12%), Positives = 58/234 (24%), Gaps = 24/234 (10%)

Query: 54  VREGMSPKTA------KHLFADLEYLDTTIA-RDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
            R G+  +        +  F   +   + I              F       +   I   
Sbjct: 146 QRYGVDRQVLVSVWGMESNFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHG 205

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP-LLSTLATLAYDCRRA 165
            I  +         + +   +P         ++                LA+ A+  + +
Sbjct: 206 DIQPEAMRGSWAGAMGQTQFIPTTYNT--HAVDFDGDGRRDIWNSTPDALASTAHYLQSS 263

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
            +   Q +     V  G     A GA    + ++  L V +             DL    
Sbjct: 264 GWKRGQPWGFEVQVPAGFDFWLADGALRKPVSEWLQLGVKLPAGTKLPMGSN--DLY--- 318

Query: 226 IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
                  A  L   G            NF  +  +N S +Y   ++ +     G
Sbjct: 319 -------AALLLPAGAR--GPAFLVLDNFRAILKYNNSSSYALAVSLLGDRFSG 363


>gi|239994683|ref|ZP_04715207.1| membrane-bound lytic transglycolase-related protein [Alteromonas
           macleodii ATCC 27126]
          Length = 428

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 96/335 (28%), Positives = 141/335 (42%), Gaps = 69/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
            +L  SL   +  +LA A      A  Q         F    +A   +A +EG+S +T  
Sbjct: 24  SFLRPSLRTSMALLLAGATMNSALANEQ---------FASCTAALADKAKQEGVSQQTID 74

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
            +F  L + D  I  DR        +F  Y     +     +G  +   + +LL  L ++
Sbjct: 75  DVFPRLVHQDRVIELDRSQPE-FVQTFPGYFSKRVTDWRTEKGKEMYAKHDKLLHKLSEK 133

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGVPP  L+A WGLET+FG   GK P+L +LATLA D RR+ +FT++F  A+ L+++  +
Sbjct: 134 YGVPPHYLLAFWGLETNFGSYKGKMPVLDSLATLACDKRRSTYFTQEFLVAVKLMEREKL 193

Query: 185 SS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
                +G+  G +G  QF+P     YAID D DG+I+L  S  DA++SAA FLA LGW +
Sbjct: 194 QKEDMIGSWAGAMGHTQFMPSAYTHYAIDGDGDGQINLWASEEDALSSAANFLANLGWER 253

Query: 244 CAGYQ-------------PGEKN------------------------------------- 253
              +               G KN                                     
Sbjct: 254 SFRWGREVQLPENFDYQESGYKNRKSLSEWHAQGVKKADGSELGEGDTTAYVIVPAGHNG 313

Query: 254 --------FAILKHWNASLNYNKTIAYIAAHIDGV 280
                   F ++  WN S  Y   +  +A  I G 
Sbjct: 314 PAFIAYKNFRVIMRWNNSEFYAIAVGVLADRIAGA 348


>gi|254459633|ref|ZP_05073049.1| lytic murein transglycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206676222|gb|EDZ40709.1| lytic murein transglycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 267

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 103/267 (38%), Positives = 146/267 (54%), Gaps = 3/267 (1%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           +    + A   T    A     C +T+  F  WK+A  + A R G+  +  +   A  +Y
Sbjct: 4   LFKAAVTAVIFTSSTVAAQAATCGNTSSGFNAWKAAFASDAQRAGVGQRGIQ-ALASSQY 62

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TIA DR   +    S   ++    +  I++QG   K  N+     L+++YGVP G++
Sbjct: 63  ASKTIAADRNQKS-FKYSLDKFMKVRGAPTIVSQGRKRKAKNASFFEALERQYGVPAGVI 121

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+ G+ET FG  MG + ++S + TLAYDCRR+ FF      AL LV KG I S   GA 
Sbjct: 122 IAIHGMETGFGRFMGDSRIVSAITTLAYDCRRSAFFVPHAIGALKLVDKGAIDSSTKGAK 181

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GE+G  QFLP N +KY IDA+ DG+++      DA+AS A FL + GW   AG+Q G+ 
Sbjct: 182 HGELGHTQFLPGNALKYGIDANRDGRVNFYT-EADALASTANFLRQKGWKPGAGFQEGQT 240

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           NF I+K WNA+  Y K IA + A IDG
Sbjct: 241 NFKIIKQWNAAGVYQKAIAIMGAEIDG 267


>gi|163736124|ref|ZP_02143543.1| hypothetical protein RGBS107_13371 [Phaeobacter gallaeciensis
           BS107]
 gi|161389994|gb|EDQ14344.1| hypothetical protein RGBS107_13371 [Phaeobacter gallaeciensis
           BS107]
          Length = 255

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 97/248 (39%), Positives = 137/248 (55%), Gaps = 3/248 (1%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
              C +T+  F  WK    A A R G+         A+  Y   TIA DR   +    S 
Sbjct: 11  AAPCGNTSAGFDSWKRDFAAEAKRAGVRQAGLN-ALANTTYARRTIAADRNQKS-FRYSL 68

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
           + ++    ++ IIAQG   K  N+     L+++YGVP GIL+A+ G+ET FG  MG + +
Sbjct: 69  EKFMQIRGANTIIAQGRKRKARNAEFFAALERKYGVPAGILIAIHGMETAFGNYMGDSQV 128

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAI 211
           +S + TL YDCRR++FF      AL LV +G I+    GA  GE+G  QFLP N + Y +
Sbjct: 129 VSAIVTLTYDCRRSEFFKPHAIGALKLVDRGAITGATKGAKHGELGHTQFLPGNALNYGV 188

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           D D +G++D   +  DA+AS A FL K GW    GYQ GE N+ +LK WNA+  Y +++A
Sbjct: 189 DWDGNGRVDFY-NMGDALASTAYFLRKKGWKPGRGYQQGEPNYKVLKQWNAATVYQQSLA 247

Query: 272 YIAAHIDG 279
            +   IDG
Sbjct: 248 IMGRKIDG 255


>gi|86138446|ref|ZP_01057020.1| hypothetical protein MED193_05061 [Roseobacter sp. MED193]
 gi|85824971|gb|EAQ45172.1| hypothetical protein MED193_05061 [Roseobacter sp. MED193]
          Length = 265

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 98/267 (36%), Positives = 147/267 (55%), Gaps = 3/267 (1%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           +  +   +A  V+   +      C +T+  F  WK+     A R G+     +   A  +
Sbjct: 1   MRFLAAAIALTVSSLTQPALAAPCGNTSAGFNAWKADFARTARRAGVKAPGLE-ALAQAQ 59

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y + TIA DR   +    S + ++    S+ I+AQG   K  N      L+++YGVP G+
Sbjct: 60  YANRTIAADRNQKS-FRYSLEKFMQLRGSATIVAQGRKRKARNPDFYAALERKYGVPAGV 118

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGA 191
           L+A+ G+ET FG  MG + ++S + TL YDCRR+ FF      AL LV +G I+S  LGA
Sbjct: 119 LIAIHGMETAFGNYMGDSKIVSAIVTLTYDCRRSDFFEPHALGALKLVDQGAITSATLGA 178

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             GE+G  QFLP N +KY +D D DG+++      DA+AS A++L K GW +  GYQ GE
Sbjct: 179 KHGELGHTQFLPGNALKYGVDWDRDGRVNFY-DLEDALASTARYLQKRGWKRGKGYQEGE 237

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHID 278
            N+ +LK WNA+  Y +++A +   ID
Sbjct: 238 ANYRVLKEWNAATVYQQSLAIMGRQID 264


>gi|126724387|ref|ZP_01740230.1| Lytic murein transglycosylase [Rhodobacterales bacterium HTCC2150]
 gi|126705551|gb|EBA04641.1| Lytic murein transglycosylase [Rhodobacterales bacterium HTCC2150]
          Length = 434

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 86/353 (24%), Positives = 148/353 (41%), Gaps = 72/353 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQP-----------KKATTQFICSDTADRFGEWKSAARARA 53
                 ++ +   +   ++  P           +  T   + + T  RF    +  + RA
Sbjct: 18  HMFRFFVVSVGILLAGSSLAGPIVLDKSLRPMARSETRPTLVAATPSRFKSCVAGLKRRA 77

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           ++ G+S +TA   F  +++L   IA+DRK          +YLD   S+  +  G A  + 
Sbjct: 78  IKSGISSRTADRAFRGVQFLPDVIAKDRKQSE-FTKQIWEYLDTAVSATRVKNGRAALRK 136

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
            SR+L  ++++YGV   ++ A+WGLE+ +G   G TPL+ +L TLA D RR+KFFT Q  
Sbjct: 137 QSRVLAQIERKYGVEAEVVTAIWGLESAYGTFRGSTPLMDSLTTLACDSRRSKFFTSQLM 196

Query: 174 YALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIAS 231
            AL +++ G ++     G+  G +G  QF+P + + YA+D   DGK D+   +  DA+AS
Sbjct: 197 AALKIIQAGDVAPRKMTGSWAGAMGHTQFIPTSYLGYAVDFTGDGKRDIWSDNPTDALAS 256

Query: 232 AAKFLAKLGWTKCAGYQPGEK-----NF-------------------------------- 254
            A +L + GWT    +    +     N+                                
Sbjct: 257 TAAYLKRFGWTYGQPWGAEVRLPKGFNYGLAGERVKKQPSEWQAMGVRLIDGGALPNKGK 316

Query: 255 -----------AILKHWNA---------SLNYNKTIAYIAAHIDGVPIGK-GY 286
                           +N          +  Y   + +++  IDG P  K G+
Sbjct: 317 ASILLPAGARGTAFVIYNNFHVIERYNLADAYVIAVGHLSDRIDGGPDLKAGW 369


>gi|148549875|ref|YP_001269977.1| lytic murein transglycosylase [Pseudomonas putida F1]
 gi|148513933|gb|ABQ80793.1| lytic murein transglycosylase [Pseudomonas putida F1]
          Length = 438

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 76/254 (29%), Positives = 121/254 (47%), Gaps = 2/254 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
             VT P               F +W++  R +A++ G+SP T    F  +      I  D
Sbjct: 45  PVVTVPGATPDVSTDIQPLQTFAQWQAGFREQALQAGISPSTFDRAFLGVTPDLDVIKAD 104

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YL+G  S   +  G  L + N+ LL  L++ YGV   +L+A+WG+E+
Sbjct: 105 RSQPE-FTRPVWEYLEGALSPLRVRNGKKLLEQNAELLTRLEQRYGVDRQVLVAVWGMES 163

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQF 199
           +FG+  G   ++ +LATLAY+ RR +F  +Q   AL +++ G I      G+  G +GQ 
Sbjct: 164 NFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQT 223

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH 259
           QF+P     +A+D D DG+ D+  S  DA+AS A +L   GW +   +    +  A    
Sbjct: 224 QFIPTTYNTHAVDFDGDGRRDIWNSTPDALASTAHYLQSSGWKRGQPWGFEVQVPAGFDF 283

Query: 260 WNASLNYNKTIAYI 273
           W A     K ++  
Sbjct: 284 WQADGALRKPVSEW 297



 Score = 49.1 bits (115), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 28/234 (11%), Positives = 58/234 (24%), Gaps = 24/234 (10%)

Query: 54  VREGMSPKTA------KHLFADLEYLDTTIA-RDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
            R G+  +        +  F   +   + I              F       +   I   
Sbjct: 146 QRYGVDRQVLVAVWGMESNFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHG 205

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP-LLSTLATLAYDCRRA 165
            I  +         + +   +P         ++                LA+ A+  + +
Sbjct: 206 DIQPEAMRGSWAGAMGQTQFIPTTYNT--HAVDFDGDGRRDIWNSTPDALASTAHYLQSS 263

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
            +   Q +     V  G     A GA    + ++  + V +           +       
Sbjct: 264 GWKRGQPWGFEVQVPAGFDFWQADGALRKPVSEWLAMGVKLPAGTQLPPGSNQ------- 316

Query: 226 IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
                SAA  L                NF  +  +N S +Y   ++ +     G
Sbjct: 317 ----LSAALLLPAG---ARGPAFLVLDNFRAILKYNNSSSYALAVSLLGDRFSG 363


>gi|121594204|ref|YP_986100.1| lytic murein transglycosylase [Acidovorax sp. JS42]
 gi|120606284|gb|ABM42024.1| lytic murein transglycosylase [Acidovorax sp. JS42]
          Length = 474

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 81/316 (25%), Positives = 124/316 (39%), Gaps = 59/316 (18%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
            + P         + T   F  W SA    A+  G+ P+T        ++    +  DR 
Sbjct: 86  ASTPVAPAAPDTTATTLAGFHAWVSAFAREALAAGIRPQTVAATLGQAQWQPRVVELDRA 145

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                      YLD   S + IAQG   ++  +  L    + YGVP  ++ A+WG+E+++
Sbjct: 146 QPE-FTRPPWAYLDSAVSPQRIAQGREQRRQYADALDAAAQRYGVPASVVTAIWGMESNY 204

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQF 201
           G   G    +  LATLAYD RR+ +   +   AL +V +G I++ A +G+  G +G  QF
Sbjct: 205 GRNFGSFRTVDALATLAYDGRRSAWAQRELLAALRIVDQGDIAADALIGSWAGAMGHTQF 264

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW-------------------- 241
           LP   + +A+DAD DG+ D+  S  D +AS A FLA  GW                    
Sbjct: 265 LPSVFLAHAVDADGDGRRDIWGSVPDVVASTANFLAHSGWKSGEPWGAEVLLPPGFDYAR 324

Query: 242 ------TKCAGYQPGE-------------------------------KNFAILKHWNASL 264
                    + +                                    NF  L  +N S+
Sbjct: 325 AELSVRQASSDWAAEGVRGVDGAELPPLQDASVLTPAGARGPAILVGPNFRALLRYNNSV 384

Query: 265 NYNKTIAYIAAHIDGV 280
           NY   +  +A  IDG 
Sbjct: 385 NYALAVGLLARQIDGG 400


>gi|26991478|ref|NP_746903.1| lytic murein transglycosylase [Pseudomonas putida KT2440]
 gi|24986556|gb|AAN70367.1|AE016678_8 membrane-bound lytic murein transglycosylase, putative [Pseudomonas
           putida KT2440]
          Length = 438

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 76/254 (29%), Positives = 121/254 (47%), Gaps = 2/254 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
             VT P               F +W++  R +A++ G+SP T    F  +      I  D
Sbjct: 45  PVVTVPGATPDVSTDIQPLQTFAQWQAGFREQALQAGISPSTFDRAFLGVTPDLDVIKAD 104

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YL+G  S   +  G  L + N+ LL  L++ YGV   +L+A+WG+E+
Sbjct: 105 RSQPE-FTRPVWEYLEGALSPLRVRNGKKLLEQNAELLTRLEQRYGVDRQVLVAVWGMES 163

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQF 199
           +FG+  G   ++ +LATLAY+ RR +F  +Q   AL +++ G I      G+  G +GQ 
Sbjct: 164 NFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQT 223

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH 259
           QF+P     +A+D D DG+ D+  S  DA+AS A +L   GW +   +    +  A    
Sbjct: 224 QFIPTTYNTHAVDFDGDGRRDIWNSTPDALASTAHYLQSSGWKRGQPWGFEVQVPAGFDF 283

Query: 260 WNASLNYNKTIAYI 273
           W A     K ++  
Sbjct: 284 WQADGALRKPVSEW 297



 Score = 48.7 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/234 (11%), Positives = 58/234 (24%), Gaps = 24/234 (10%)

Query: 54  VREGMSPKTA------KHLFADLEYLDTTIA-RDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
            R G+  +        +  F   +   + I              F       +   I   
Sbjct: 146 QRYGVDRQVLVAVWGMESNFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHG 205

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP-LLSTLATLAYDCRRA 165
            I  +         + +   +P         ++                LA+ A+  + +
Sbjct: 206 DIQPEAMRGSWAGAMGQTQFIPTTYNT--HAVDFDGDGRRDIWNSTPDALASTAHYLQSS 263

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
            +   Q +     V  G     A GA    + ++  + V +           +       
Sbjct: 264 GWKRGQPWGFEVQVPAGFDFWQADGALRKPVSEWLAMGVKLPAGTQLPAGSNQ------- 316

Query: 226 IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
                SAA  L                NF  +  +N S +Y   ++ +     G
Sbjct: 317 ----LSAALLLPAG---ARGPAFLVLDNFRAILKYNNSSSYALAVSLLGDRFSG 363


>gi|149203950|ref|ZP_01880918.1| hypothetical protein RTM1035_10530 [Roseovarius sp. TM1035]
 gi|149142392|gb|EDM30437.1| hypothetical protein RTM1035_10530 [Roseovarius sp. TM1035]
          Length = 272

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 99/264 (37%), Positives = 149/264 (56%), Gaps = 3/264 (1%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
             +A   +    +     C ++AD F  WK+A    A  EG+ P+  +   A  +Y  +T
Sbjct: 12  LTMALGFSLLATSALAAPCGNSADGFSNWKAAFAKEAAAEGVGPRGLE-ALAGAQYASST 70

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           IA DR   +    S + ++    +  I+AQG   +  ++     L+++YGVP G+L+A+ 
Sbjct: 71  IAADRNQKS-FKYSLEKFMQVRGAPTIVAQGRKRRAQDAAFYDALERQYGVPAGVLLAIH 129

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEI 196
           G+ET FG  MG + ++S + TL YDCRR+ FF      AL LV +G I++   GA  GE+
Sbjct: 130 GMETGFGGFMGDSAVVSAIVTLTYDCRRSDFFRPHAVGALKLVDRGAITAQTKGAKHGEL 189

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAI 256
           G  QFLP N + Y +DA+ DG++D   +  DA+AS A FL + GW    GYQ G+ NFA+
Sbjct: 190 GHTQFLPGNALNYGVDANGDGRVDFY-NLTDALASTANFLRQKGWQPGQGYQEGQPNFAV 248

Query: 257 LKHWNASLNYNKTIAYIAAHIDGV 280
           ++ WNA+  Y K IA +AA IDG 
Sbjct: 249 IQQWNAAGVYQKAIALMAAQIDGG 272


>gi|330811919|ref|YP_004356381.1| lipoprotein [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327380027|gb|AEA71377.1| putative lipoprotein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 427

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 70/238 (29%), Positives = 122/238 (51%), Gaps = 2/238 (0%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L     + A A+  P   T + +       F +W++  R  A+  G+        F  + 
Sbjct: 25  LQTAPAVTAPAIVPPLVPTGEDLAIAPTQTFAQWQAGFRKEALAAGIRGDLFDRAFIGVS 84

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
              + I  DR           +YLDG  S   + +G +L + N+++L ++++ YGV    
Sbjct: 85  PDMSVIKADRSQPE-FTRPVWEYLDGALSPLRVNKGKSLIQQNAQILQSIEQRYGVDREA 143

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-G 190
           L+A+WG+E++FG+  G   ++++LATLAY+ RR  F   Q   AL ++++G I+   + G
Sbjct: 144 LVAVWGMESNFGQFQGSKSVINSLATLAYEGRRPGFAHAQLIAALQILQQGDITPEKMLG 203

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +  G +GQ QF+P     +A+D D DG+ D+  S+ DA+AS A +L   GW +   + 
Sbjct: 204 SWAGAMGQTQFIPTTYNTHAVDFDGDGRRDIWGSSTDALASTAHYLQSSGWQRGQPWG 261


>gi|285018691|ref|YP_003376402.1| lytic murein transglycosylase precursor transmembrane protein
           [Xanthomonas albilineans GPE PC73]
 gi|283473909|emb|CBA16410.1| probable lytic murein transglycosylase precursor transmembrane
           protein [Xanthomonas albilineans]
          Length = 425

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 87/292 (29%), Positives = 139/292 (47%), Gaps = 15/292 (5%)

Query: 3   FKKYLLISLLMMVYPMLA------QAVTQPKKATTQFICSDTADRFGEWKSAARARAVRE 56
            +    +S+ ++     A       A   P  AT Q     T   F +W +  R RA+  
Sbjct: 8   LRLSFCVSVCVVATSAAAQTTDPETASFSPTTATAQQKPLPT-ASFEQWLADFRQRALAA 66

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+   T    FA +    +  A D++      ++  DYLDG  +  II +G  L K+N  
Sbjct: 67  GIEATTLDKAFAGVTPDPSVQALDQQQPE-FTLALWDYLDGRITPSIIQKGQQLLKSNHA 125

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           L   L+++YGV PGIL A+W +E+ +G+ +G   ++ +LATLA++ RR  +   Q   AL
Sbjct: 126 LFQKLRQQYGVDPGILTAIWSMESEYGKNIGDLYVIRSLATLAHEGRRTTYGNTQLLAAL 185

Query: 177 D--LVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
                +KG+  S  +G+  G +GQ QF+P    +YA+D D D K D+  S+ DA+ SAA 
Sbjct: 186 QILQTEKGIDRSRLIGSWAGAMGQTQFIPTTYREYAVDEDGDHKRDVWNSDADALGSAAN 245

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASL-NYNKTIAYIAA---HIDGVPI 282
           +L +  WT+   +   E +      +  +     KT+A          G PI
Sbjct: 246 YLKQSNWTRDIPWGQ-EVHLPAGFDYAQADLTIKKTVAEWLRLGVRCAGKPI 296



 Score = 42.9 bits (99), Expect = 0.059,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 12/29 (41%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  +  +N+S  Y   +  +A    G 
Sbjct: 322 DNFRSILRYNSSNAYALAVGLLADGYAGG 350


>gi|313500777|gb|ADR62143.1| Lytic murein transglycosylase [Pseudomonas putida BIRD-1]
          Length = 438

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 76/254 (29%), Positives = 121/254 (47%), Gaps = 2/254 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
             VT P               F +W++  R +A++ G+SP T    F  +      I  D
Sbjct: 45  PVVTVPGATPDVSTDIQPLQTFAQWQAGFREQALQAGISPSTFDRAFLGVTPDLDVIKAD 104

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YL+G  S   +  G  L + N+ LL  L++ YGV   +L+A+WG+E+
Sbjct: 105 RSQPE-FTRPVWEYLEGALSPLRVRNGKKLLEQNAELLTRLEQRYGVDRQVLVAVWGMES 163

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQF 199
           +FG+  G   ++ +LATLAY+ RR +F  +Q   AL +++ G I      G+  G +GQ 
Sbjct: 164 NFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQT 223

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH 259
           QF+P     +A+D D DG+ D+  S  DA+AS A +L   GW +   +    +  A    
Sbjct: 224 QFIPTTYNTHAVDFDGDGRRDIWNSTPDALASTAHYLQSSGWKRGQPWGFEVQVPAGFDF 283

Query: 260 WNASLNYNKTIAYI 273
           W A     K ++  
Sbjct: 284 WQADGALRKPVSEW 297



 Score = 48.7 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 28/234 (11%), Positives = 58/234 (24%), Gaps = 24/234 (10%)

Query: 54  VREGMSPKTA------KHLFADLEYLDTTIA-RDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
            R G+  +        +  F   +   + I              F       +   I   
Sbjct: 146 QRYGVDRQVLVAVWGMESNFGQFQGSKSVIRSLATLAYEGRRPQFAQDQLIAALQIIQHG 205

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP-LLSTLATLAYDCRRA 165
            I  +         + +   +P         ++                LA+ A+  + +
Sbjct: 206 DIQPEAMRGSWAGAMGQTQFIPTTYNT--HAVDFDGDGRRDIWNSTPDALASTAHYLQSS 263

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
            +   Q +     V  G     A GA    + ++  + V +           +       
Sbjct: 264 GWKRGQPWGFEVQVPAGFDFWQADGALRKPVSEWLAMGVKLPAGTQLPAGSNQ------- 316

Query: 226 IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
                SAA  L                NF  +  +N S +Y   ++ +     G
Sbjct: 317 ----LSAALLLPAG---ARGPAFLVLDNFRAILKYNNSSSYALAVSLLGDRFSG 363


>gi|310815505|ref|YP_003963469.1| lytic murein transglycosylase [Ketogulonicigenium vulgare Y25]
 gi|308754240|gb|ADO42169.1| lytic murein transglycosylase [Ketogulonicigenium vulgare Y25]
          Length = 259

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 89/245 (36%), Positives = 128/245 (52%), Gaps = 3/245 (1%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
            C DTA  FG WK      A + G+  +          Y   TI  DR   +       +
Sbjct: 17  TCGDTAAGFGAWKREFAQYAAQNGVGARGL-AALDSATYATRTINADRNQRS-FRYELDE 74

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           ++       I+AQG    + N    + L+  YGVP  I++A+ G+ET FG  MG + ++S
Sbjct: 75  FMRIRGGDTIVAQGRRQIENNRDFFLQLELTYGVPSSIIVAIHGMETGFGNFMGDSNVVS 134

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
            + TLAYDCRR  FFT     AL LV +G IS ++ GA  GE+G  QFLP N++ Y +D 
Sbjct: 135 AITTLAYDCRRPAFFTPHALAALQLVDRGAISPNSTGAMHGELGHTQFLPGNILAYGVDG 194

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
           + DG +D+  +  D++ S A FL + GW     Y  G  NF +++ WNA+  Y + IA I
Sbjct: 195 NGDGIVDM-TNRADSLYSTANFLRQKGWQTGQSYAEGGPNFRVIQEWNAAGVYQRAIALI 253

Query: 274 AAHID 278
           A+ ID
Sbjct: 254 ASRID 258


>gi|226942996|ref|YP_002798069.1| lytic murein transglycosylase [Azotobacter vinelandii DJ]
 gi|226717923|gb|ACO77094.1| lytic murein transglycosylase [Azotobacter vinelandii DJ]
          Length = 438

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 110/209 (52%), Gaps = 2/209 (0%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
            F +W+   R  A+  G+ P+     FA +    T I+ DR            YL+G  +
Sbjct: 69  SFEDWRDGFRNEALANGIQPQLFDQAFAGVAPDPTVISADRSQPE-FTRPVWTYLEGALA 127

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
            + +  G  L   ++ LL  ++  YGV    L+A+WG+E++FG+ MG   ++ +LATLA+
Sbjct: 128 EKRVRSGKTLLSQHTALLERIEARYGVDRQALVAVWGMESNFGQVMGSKSVIRSLATLAF 187

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR +F  +Q   AL +++ G +    + G+  G +GQ QF+P   + +A+D D DG+ 
Sbjct: 188 EGRRPQFAHDQLLAALSILQNGDVRPERMIGSWAGAMGQTQFIPTTYLSHAVDFDGDGRR 247

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           D+  S  DA+AS A +L   GW +   + 
Sbjct: 248 DIWDSTADALASTAHYLQASGWRRGQPWG 276


>gi|296387479|ref|ZP_06876954.1| lytic murein transglycosylase [Pseudomonas aeruginosa PAb1]
          Length = 382

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 108/217 (49%), Gaps = 2/217 (0%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
              +     F +W+ A R +A+  G+  +T    FA +E     +  DR           
Sbjct: 1   PSEAQPGQSFEQWRDAFRQQALAGGIDAQTFDRAFAGVEPDPAVVEADRSQPE-FTRPVW 59

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            YL+G      + QG A    ++R+L  +   Y V    ++A+WG+E+++G  MG   ++
Sbjct: 60  KYLEGALDPLRVRQGQARLAQHARILGEVDARYAVDADAVVAIWGMESNYGSHMGNKNVI 119

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATLAY+ RR +F   Q   AL +++ G + +  + G+  G +GQ QF+P    +YA+
Sbjct: 120 RSLATLAYEGRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGAMGQTQFIPTTYNQYAV 179

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           D D DGK D+  S  DA+AS A +L   GW     + 
Sbjct: 180 DFDGDGKRDIWGSPGDALASTANYLKASGWIAGQPWG 216


>gi|254502699|ref|ZP_05114850.1| lytic murein transglycosylase subfamily, putative [Labrenzia
           alexandrii DFL-11]
 gi|222438770|gb|EEE45449.1| lytic murein transglycosylase subfamily, putative [Labrenzia
           alexandrii DFL-11]
          Length = 428

 Score =  203 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 72/331 (21%), Positives = 125/331 (37%), Gaps = 62/331 (18%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            ++    +             +   F  +       A   G+S +T   +F  ++  + T
Sbjct: 31  ALVIAVGSFSASYAYATSGGASDPGFTRFIKDFWPTARSAGISAQTYNAVFTGMQPDNDT 90

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I    K          +YLD   S   + +G  L      +L  ++  YGV    ++A+W
Sbjct: 91  IRLMSKQSE-FVKPIWEYLDSAVSDTRVEKGRELLIEYDGVLRQIESRYGVDREAVLAIW 149

Query: 137 GLETHFGETMGKTPLLSTLATLAYD-CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFG 194
           G+ET++G  MG+  ++  LATLAY   RR  F+ ++   AL +V+ G +  S   G+  G
Sbjct: 150 GMETNYGGFMGRHNVIQALATLAYAAPRRTDFWRKELVTALAIVQAGHVKFSEMEGSWAG 209

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG-------------- 240
            +G  QF+P +   Y+ D + DGK D+  S  DA+AS A +L + G              
Sbjct: 210 AMGHTQFMPSSWKAYSADYNGDGKRDIWTSIPDALASTAYYLKRHGWQTGKTWGYEVQLP 269

Query: 241 ------------------WTK---------CAGYQP-----------------GEKNFAI 256
                             W +             Q                    +NF +
Sbjct: 270 NGFDYNLADGEKTLTLGEWQRYGIRRVNGRGFPRQSDNGILVLPAGASGPAFLMLRNFYV 329

Query: 257 LKHWNASLNYNKTIAYIAAH-IDGVPIGKGY 286
           +K +N +  Y   + ++A   I G P+   +
Sbjct: 330 IKRYNNATAYALAVGHLADRIIGGGPLAGNW 360


>gi|163752325|ref|ZP_02159522.1| membrane-bound lytic transglycolase-related protein [Shewanella
           benthica KT99]
 gi|161327772|gb|EDP98957.1| membrane-bound lytic transglycolase-related protein [Shewanella
           benthica KT99]
          Length = 377

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 87/302 (28%), Positives = 132/302 (43%), Gaps = 60/302 (19%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +AD F       + +A REG+S +T  +  A++ Y+   I  D+K       +F +Y   
Sbjct: 4   SADDFATCVVNLQQKAQREGLSKETIDNALANVNYVSRVIELDKKQPE-FSQTFDNYFSK 62

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             +   ++QG  + + +  LL  L++ YG+PP  LMA WGLET+FG   GK P+L +LAT
Sbjct: 63  RVTDWRVSQGRKMLREHKVLLAKLQETYGIPPQYLMAFWGLETNFGAYKGKMPVLDSLAT 122

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LA D RR+++FT +   AL L +K       + G+  G +G  QF+P     YA+D D D
Sbjct: 123 LACDPRRSQYFTGELMKALKLKEKYDFDVSTMVGSWAGAMGHTQFMPSAYTHYAVDGDGD 182

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK---NFA------------------ 255
           GK DL  S  DA++SAA FL +LGW +   +    +   NF                   
Sbjct: 183 GKADLWNSTADALSSAANFLNQLGWQRNERWGREVRLPANFNYDYLGKSKAQGLTEWKQL 242

Query: 256 ----------------------------ILKHW---------NASLNYNKTIAYIAAHID 278
                                           +         N S  Y   + ++A  I+
Sbjct: 243 GLTQSNGAALSTPDMTATLYLPAGHTGPAFLGYKNFDVIMRWNRSEFYAIAVGHLADRIN 302

Query: 279 GV 280
           G 
Sbjct: 303 GG 304


>gi|146276875|ref|YP_001167034.1| membrane-bound lytic murein transglycosylase B-like protein
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145555116|gb|ABP69729.1| Membrane-bound lytic murein transglycosylase B-like protein
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 247

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 102/248 (41%), Positives = 138/248 (55%), Gaps = 3/248 (1%)

Query: 31  TQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
               CS+T   +  WKS     A   G+  +          Y   TIA DR   +    S
Sbjct: 2   AAAPCSNTGADYESWKSLMAQEAAAVGVGQRGI-AALMGSSYSTRTIAADRNQKS-FRYS 59

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
              ++    S  II QG A K  N     +L++ YGVP G+L+A+ G+ET FG  MG T 
Sbjct: 60  LDKFMQVRGSDTIIRQGRARKAKNPEFYASLERRYGVPAGVLLAIHGMETGFGSFMGDTN 119

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYA 210
           ++S +ATLAYDCRR+ FFT     AL LV +G IS  ++GA  GE+G  QFLP N + Y 
Sbjct: 120 VVSAIATLAYDCRRSDFFTPHLLAALVLVDRGSISPASVGAKHGELGHTQFLPGNALAYG 179

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTI 270
           +D + DG++DL  +  DA+AS A FLA+ GW    GYQP E NFA+++ WNA+  Y + I
Sbjct: 180 VDGNGDGRVDL-GNITDAMASTANFLARKGWQPGLGYQPAEPNFAVIREWNAASVYQQAI 238

Query: 271 AYIAAHID 278
           A +A  ID
Sbjct: 239 AIMAQQID 246


>gi|297569618|ref|YP_003690962.1| lytic murein transglycosylase [Desulfurivibrio alkaliphilus AHT2]
 gi|296925533|gb|ADH86343.1| lytic murein transglycosylase [Desulfurivibrio alkaliphilus AHT2]
          Length = 328

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 73/230 (31%), Positives = 114/230 (49%), Gaps = 10/230 (4%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           +  +  P  A  Q         F +W +  R  A   G+S  T       +E +   I  
Sbjct: 17  SGPLAGPASAAEQP--------FEQWLTELRQEAKGRGISATTLDAALTGIEPIPRVIEL 68

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR+      ++F  Y D +     I  G  L + +  LL  + KE+GV P  ++ALWG+E
Sbjct: 69  DRQQPE-FTLTFVQYRDRVVPQSRINMGRRLLEEHRELLTEIGKEFGVQPRFIVALWGIE 127

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQ 198
           T FG   G  P+++ LATLAYD RR+ +F  +   AL ++ +G I    + G+  G +GQ
Sbjct: 128 TDFGRITGGFPVINALATLAYDGRRSSYFRGELLNALQILDEGHIGVDEMKGSWAGAMGQ 187

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            QF+P + + +A+D + DG+ D+  +  D  ASAA +LAK GW     + 
Sbjct: 188 SQFMPSSFLNFAVDYNGDGRRDIWHTLPDVFASAANYLAKSGWRDDQTWG 237


>gi|222110881|ref|YP_002553145.1| lytic murein transglycosylase [Acidovorax ebreus TPSY]
 gi|221730325|gb|ACM33145.1| lytic murein transglycosylase [Acidovorax ebreus TPSY]
          Length = 466

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 82/316 (25%), Positives = 124/316 (39%), Gaps = 59/316 (18%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
            + P         + T   F  W SA    A+  G+ P+T        ++    +  DR 
Sbjct: 78  ASTPVAPPAPDTTATTLAGFHAWVSAFAREALAAGIRPQTVAATLGQAQWQPRVVELDRA 137

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                      YLD   SS+ IAQG   +   +  L    + YGVP  ++ A+WG+E+++
Sbjct: 138 QPE-FTRPPWAYLDSAVSSQRIAQGREQRHQYADALDAAAQRYGVPASVVTAIWGMESNY 196

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQF 201
           G   G    +  LATLAYD RR+ +   +   AL +V +G I++ A +G+  G +G  QF
Sbjct: 197 GRNFGSFRTVDALATLAYDGRRSAWAQRELLAALRIVDQGDIAADALIGSWAGAMGHTQF 256

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW-------------------- 241
           LP   + +A+DAD DG+ D+  S  D +AS A FLA  GW                    
Sbjct: 257 LPSVFLAHAVDADGDGRRDIWGSVPDVVASTANFLAHSGWKSGEPWGAEVLLPPGFDYAR 316

Query: 242 ------TKCAGYQPGE-------------------------------KNFAILKHWNASL 264
                    + +                                    NF  L  +N S+
Sbjct: 317 AELSVRQASSDWAAEGVRGVGDAELPPLQDASVLTPAGARGPAILVGPNFRALLRYNNSV 376

Query: 265 NYNKTIAYIAAHIDGV 280
           NY   +  +A  IDG 
Sbjct: 377 NYALAVGLLARQIDGG 392


>gi|94268922|ref|ZP_01291321.1| Lytic murein transglycosylase [delta proteobacterium MLMS-1]
 gi|93451410|gb|EAT02260.1| Lytic murein transglycosylase [delta proteobacterium MLMS-1]
          Length = 328

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 66/208 (31%), Positives = 112/208 (53%), Gaps = 2/208 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W    R  A+  G+  +      +D+E ++  I  DR+      ++F++Y D +   
Sbjct: 30  FDQWLEELRTEALERGIRAEILDAALSDIEPIERVIELDRQQPE-FTLTFQEYRDRVVPR 88

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I +G  L   +  LL  + + YGV P  ++ALWG+ET FG   G  P++  +ATLA+D
Sbjct: 89  SRIQRGRKLLAEHRELLTEIGQHYGVQPRFIVALWGIETDFGRITGGFPVIPAMATLAHD 148

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR+ +F  +   AL ++ +G I+   + G+  G +GQ QF+P + + +A+D D DG+ D
Sbjct: 149 GRRSNYFRGELLNALQILDEGHITPEEMKGSWAGAMGQSQFMPSSFINFAVDYDGDGRRD 208

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +  +  D  ASAA +LA+ GW     + 
Sbjct: 209 IWHTTEDVFASAANYLAQSGWRDDQTWG 236


>gi|167624318|ref|YP_001674612.1| lytic murein transglycosylase [Shewanella halifaxensis HAW-EB4]
 gi|167354340|gb|ABZ76953.1| lytic murein transglycosylase [Shewanella halifaxensis HAW-EB4]
          Length = 396

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 88/328 (26%), Positives = 133/328 (40%), Gaps = 64/328 (19%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           +    P+    +     A      +     +    +  +  A  +G+S +T     A+++
Sbjct: 1   MFKSIPLATALLLTSSAAYA----TSEQPNWATCVADLQQTAKAQGLSQQTIDTTLANVK 56

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           ++   I  D+K       SF++Y     +   +AQG  L + +  LL  L KEYG+PP  
Sbjct: 57  FVPRVIELDKKQPE-FSQSFENYFTKRVTDWRVAQGRKLYQEHKVLLHKLAKEYGIPPQY 115

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALG 190
           L+A WGLET+FG   GK  +L +LATLA D RR+ +FT +   AL L ++     +  +G
Sbjct: 116 LLAFWGLETNFGSYKGKMSVLDSLATLACDPRRSSYFTTELMQALKLKERYNFAETDMVG 175

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           +  G +G  QF+P    KYA+D D DGK DL  S  DA+ SAA FL  LGW +   +   
Sbjct: 176 SWAGAMGHTQFMPSAYAKYAVDGDGDGKADLWNSTEDALTSAANFLQNLGWKRNERWGRE 235

Query: 251 ---EKNF----------AILKHW------------------------------------- 260
                NF            L  W                                     
Sbjct: 236 VTLPANFSYAHLGKAEAQPLARWAELGITQTNGSPLSTPEMQAALYLPSGHTGPAFLGYD 295

Query: 261 --------NASLNYNKTIAYIAAHIDGV 280
                   N S  Y   + ++A  I+G 
Sbjct: 296 NFDVIMRWNRSTFYAIAVGHLADRINGA 323


>gi|83941887|ref|ZP_00954349.1| peptidoglycan binding domain protein [Sulfitobacter sp. EE-36]
 gi|83847707|gb|EAP85582.1| peptidoglycan binding domain protein [Sulfitobacter sp. EE-36]
          Length = 419

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 75/310 (24%), Positives = 116/310 (37%), Gaps = 59/310 (19%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
                     A    +W +A RARA+  G+           + Y    I RDR       
Sbjct: 34  PPAAVQKPGNAAGLQDWVTAFRARALAAGIDGAVFDRAMQTVRYDPQVIRRDRNQSE-FT 92

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
            +   YL+  +S   +  G       +  L  ++  YGV   I+ A+WGLE+ +G   G 
Sbjct: 93  KTIWAYLETATSDLRVTNGKKALAEQADALSQIETRYGVEKEIVTAIWGLESAYGTFRGS 152

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVV 207
            P+LS+LATLAYD RR  FF  +   AL +++ G  +     G+  G +G  QF+P +  
Sbjct: 153 DPVLSSLATLAYDGRRRAFFEGELLDALRILQAGDTTPARMQGSWAGAMGHTQFMPSSFQ 212

Query: 208 KYAIDADEDGKIDLVKSNI-DAIASAAKFLAKLGWTKCAGYQ------------------ 248
           +YA D   DGK D+   +  DA+AS A +L   GW +   +                   
Sbjct: 213 QYAEDFTGDGKRDIWSDDPRDALASTAAYLKHFGWVQGQPWGVEVRLPEGFDYLLAGRDI 272

Query: 249 -----------------------------PGEKNFAILK---------HWNASLNYNKTI 270
                                        PG    A +           +N++  Y   +
Sbjct: 273 LKTAAEWRALGVRPVTGSLGDHGPASLLLPGGAEGAAILIYANFAVIERYNSADAYVIGV 332

Query: 271 AYIAAHIDGV 280
            ++A  I G 
Sbjct: 333 GHLADRIAGG 342


>gi|260429209|ref|ZP_05783186.1| peptidoglycan binding domain protein [Citreicella sp. SE45]
 gi|260419832|gb|EEX13085.1| peptidoglycan binding domain protein [Citreicella sp. SE45]
          Length = 423

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 76/227 (33%), Positives = 115/227 (50%), Gaps = 3/227 (1%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
           +    A         A  F +W    R+RA+ +G++P+     F  +EY    I RDR  
Sbjct: 37  STQGTAVRAPQDVKGAAGFADWVRDFRSRALEQGITPEVFDAAFRGVEYDPKVIERDRNQ 96

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
                 +   YLD  +S   IA G      N  LL  +++ YGV    ++A+WGLE+ FG
Sbjct: 97  NE-FTKTVWVYLDSAASEARIAAGKKALAENRALLDRIEERYGVDKQAVVAIWGLESAFG 155

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV-ISSHALGATFGEIGQFQFL 202
              G  P++ +LA+LAYD RR  FF  Q   AL +++ G  + ++  G+  G +G  QF+
Sbjct: 156 TFRGTEPVIRSLASLAYDTRRGTFFEGQLVDALTILQSGDTVPANMKGSWAGAMGHTQFM 215

Query: 203 PVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
           P + +  A D D DG+ D+      DA+ASAA +LA+ GWTK   + 
Sbjct: 216 PSSFLALAQDWDGDGRRDIWSDDPADALASAAHYLAENGWTKGQPWG 262



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 8/32 (25%), Positives = 17/32 (53%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVPIGK 284
           NFA+++ +N +  Y   + ++   I G P  +
Sbjct: 324 NFAVIERYNTADAYVIGVGHLGDRILGGPEIR 355


>gi|319957198|ref|YP_004168461.1| lytic murein transglycosylase [Nitratifractor salsuginis DSM 16511]
 gi|319419602|gb|ADV46712.1| lytic murein transglycosylase [Nitratifractor salsuginis DSM 16511]
          Length = 397

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 92/302 (30%), Positives = 137/302 (45%), Gaps = 60/302 (19%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W  A    AV +G+SP T       + Y  + I RDR+        F+ +   + S 
Sbjct: 30  FPQWLKAFERYAVSQGISPDTVHRALDGITYDPSVIRRDRRQHQ-FSYDFRTFAKRIISP 88

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +G  L    +RL   ++K YGVP  +++A WGLE+ FG  MGK   L +LATLAYD
Sbjct: 89  YRLRKGKQLIHKKARLFKAIEKRYGVPAPVIVAFWGLESDFGAYMGKDNTLRSLATLAYD 148

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR+  F ++   AL ++ +G ++   + G+  GE+GQ QFLP   +KY +D D DG+ D
Sbjct: 149 CRRSDEFQKELLAALKIIDEGDLTPRQMRGSWAGELGQTQFLPSYYLKYGVDFDGDGRRD 208

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGY-------------QPGEKNFAILKHW------- 260
           L+ S+ DA+AS A +L  LGW     +             + G ++   L +W       
Sbjct: 209 LIHSSADALASTANYLRHLGWKPGEPWIREVIVPRQMPWDESGLEHSHSLSYWGKLGVTD 268

Query: 261 ----------NAS----------------------------LNYNKTIAYIAAHIDGVPI 282
                     NAS                            L Y+ T AY A  +DG P 
Sbjct: 269 RNGRPLHGSFNASLLLPMGKDGPAFLAFDNFKDTYLTWNNSLLYSLTAAYFATRLDGAPA 328

Query: 283 GK 284
            +
Sbjct: 329 MR 330


>gi|157375810|ref|YP_001474410.1| lytic murein transglycosylase [Shewanella sediminis HAW-EB3]
 gi|157318184|gb|ABV37282.1| lytic murein transglycosylase [Shewanella sediminis HAW-EB3]
          Length = 377

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 91/302 (30%), Positives = 130/302 (43%), Gaps = 60/302 (19%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +AD F       +  A  +G+S  T  +  A ++Y+   I  D+K       +F +Y   
Sbjct: 4   SADDFASCVIKLKETAQAQGLSRDTIDNTLAKVKYISRVIELDKKQPE-FSQTFDNYFSK 62

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             +   + +G  L K N  LL  L ++YGVPP  LMA WGLET+FG   GK P+L +LAT
Sbjct: 63  RVTDWRVKEGRKLLKENRELLNELSQKYGVPPQYLMAFWGLETNFGSYKGKMPVLDSLAT 122

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LA D RR+K+FT +   AL L ++    S  + G+  G +G  QF+P    KYA+D D D
Sbjct: 123 LACDPRRSKYFTGELMKALKLKEEYQFESSQMVGSWAGAMGHTQFMPSAYAKYAVDGDGD 182

Query: 217 GKIDLVKSNIDAIASAAK--------------------------FLAKLGWTKCAGYQP- 249
           GK DL  S  DA+ SAA                           +L K      A +   
Sbjct: 183 GKADLWNSTTDALTSAANFLNQLGWQRNERWGREVKLPKDFSYGYLGKDKAQPLAEWAKL 242

Query: 250 -------------------------------GEKNFAILKHWNASLNYNKTIAYIAAHID 278
                                          G KNF ++  WN S+ Y   + ++A  I+
Sbjct: 243 GVTKSDKTSLSTPDMNAALYLPAGHTGPAFLGYKNFDVIMRWNRSVYYAIAVGHLADRIN 302

Query: 279 GV 280
           G 
Sbjct: 303 GG 304


>gi|56460924|ref|YP_156205.1| membrane-bound lytic murein transglycosylase [Idiomarina loihiensis
           L2TR]
 gi|56179934|gb|AAV82656.1| Membrane-bound lytic murein transglycosylase [Idiomarina loihiensis
           L2TR]
          Length = 345

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 74/254 (29%), Positives = 119/254 (46%), Gaps = 7/254 (2%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATT-----QFICSDTADRFGEWKSAARARAVR 55
           M   K  +  L + +    A +        T     +    D   +F  +  A +A A+ 
Sbjct: 1   MLTNKIKVAGLALCLASSFALSAPASAFQETDDKAKKESSEDVNQQFATYVEALKAEAIE 60

Query: 56  EGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANS 115
            G    T    FA ++Y +  +  D+       ++   YL          + +     + 
Sbjct: 61  SGYKQDTLDKAFAKVKYYERAVELDKNQPE-FKLTLDTYLPRAVPDWKAEKALEKYNEHK 119

Query: 116 RLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYA 175
            LL  + KEYGV P  ++ALWG+ET+FG   G   ++S L TLA+D RR +FF +Q + A
Sbjct: 120 ELLEKVGKEYGVQPRFIVALWGIETNFGSFTGGFDVVSALTTLAFDGRREEFFKKQLWEA 179

Query: 176 LDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L +++ G I    + G+  G +GQ QF+P + + YA+D D DGK D+  S  D  ASAA 
Sbjct: 180 LTIIEDGHIEPEQMKGSWAGAMGQTQFMPSSFMSYAVDYDGDGKKDIWGSYPDVFASAAN 239

Query: 235 FLAKLGWTKCAGYQ 248
           +L+ +GW     + 
Sbjct: 240 YLSSVGWKDDVTWG 253



 Score = 40.2 bits (92), Expect = 0.33,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 12/29 (41%)

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHID 278
              N+  L  WN S  +   + Y++  I 
Sbjct: 314 AYANYDALMRWNRSHYFVAAVGYLSDRIR 342


>gi|332139886|ref|YP_004425624.1| membrane-bound lytic transglycosylase-related protein [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327549908|gb|AEA96626.1| membrane-bound lytic transglycosylase-related protein [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 421

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 94/340 (27%), Positives = 139/340 (40%), Gaps = 61/340 (17%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADR-FGEWKSAARARAVREGMS 59
           M         L            +     T   I S +A+  F    +A   RA +EG+S
Sbjct: 1   MRLASLQFSFLSTFSLKGGVFRTSLALLFTGAVISSASANEHFSSCTAALADRAKQEGVS 60

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
            +    +F  L + D  I  DR        +F  Y     +     +G A+   + +LL 
Sbjct: 61  QQIIDEIFPHLVHQDRVIELDRSQPE-FVQTFPGYFSKRVTDWRTEKGKAMYAKHEKLLH 119

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            L  +YGVPP  L+A WGLET+FG   GK P+L +LATLA D RR+K+FT++F  A+ L+
Sbjct: 120 KLSDKYGVPPHYLLAFWGLETNFGSYKGKMPVLDSLATLACDKRRSKYFTQEFLVAVKLM 179

Query: 180 KKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           ++  +    + G+  G +G  QF+P     YAID D DG+++L +S  DA++SAA FLA 
Sbjct: 180 QREKLKKDNMVGSWAGAMGHTQFMPSAYTHYAIDGDGDGQVNLWESEEDALSSAANFLAS 239

Query: 239 LGWTKCAGYQ-------------PGEKNFA------------------------------ 255
           LGW +   +               G KN                                
Sbjct: 240 LGWERSFRWGREVKLPEGFNYQESGYKNRKPLSEWHEQGVKKADGSPLGEGETTAYVIVP 299

Query: 256 ---------------ILKHWNASLNYNKTIAYIAAHIDGV 280
                          ++  WN S  Y   +  +A  I G 
Sbjct: 300 AGHNGPAFIAYKNFRVIMRWNNSEFYAIAVGVLADRIAGA 339


>gi|83949918|ref|ZP_00958651.1| Membrane-bound lytic murein transglycosylase B [Roseovarius
           nubinhibens ISM]
 gi|83837817|gb|EAP77113.1| Membrane-bound lytic murein transglycosylase B [Roseovarius
           nubinhibens ISM]
          Length = 460

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 123/249 (49%), Gaps = 7/249 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +   F  W +  R+RA  +G+S +T    F  ++Y  + + +DR           +YLD 
Sbjct: 86  SHQGFANWINGFRSRARAQGISNRTFDAAFRGVQYDPSVVKKDRNQSE-FKKEIWEYLDF 144

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             S+  +  G  + +        ++  +GV   ++ A+WG+E+ +GE  G+ PL+ ++AT
Sbjct: 145 AVSTSRVRNGTKVLRQYRNTFDRIEAHFGVEKEVVAAIWGMESAYGERRGREPLIQSIAT 204

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LAYD RR KFF +Q   AL +++ G ++ + + G+  G +G  QF+P + + YA+D   D
Sbjct: 205 LAYDGRRGKFFEQQLIAALKIIQSGDVAPNRMTGSWAGAMGHTQFIPTSYLAYAVDFTGD 264

Query: 217 GKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
           GK D+      DA+AS A +L + GW K   +    +         AS    ++ A  A 
Sbjct: 265 GKRDIWSDDPTDALASTAAYLKRFGWKKGQPWGVEVRLPRGFNAGRASRKLTQSPAAWAN 324

Query: 276 H----IDGV 280
                IDG 
Sbjct: 325 EGVVGIDGR 333



 Score = 47.6 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 6/32 (18%), Positives = 18/32 (56%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVPIGK 284
           NF++++ +N +  Y   + +++  + G P  +
Sbjct: 359 NFSVIEKYNRADAYVIGVGHLSDRLRGGPPIQ 390


>gi|163743920|ref|ZP_02151290.1| hypothetical protein RG210_17850 [Phaeobacter gallaeciensis 2.10]
 gi|161382765|gb|EDQ07164.1| hypothetical protein RG210_17850 [Phaeobacter gallaeciensis 2.10]
          Length = 247

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 97/248 (39%), Positives = 137/248 (55%), Gaps = 3/248 (1%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
              C +T+  F  WK    A A R G+         A+  Y   TIA DR   +    S 
Sbjct: 3   AAPCGNTSAGFDSWKRDFAAEAKRAGVRQAGLN-ALANTTYARRTIAADRNQKS-FRYSL 60

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
           + ++    ++ IIAQG   K  N+     L+++YGVP GIL+A+ G+ET FG  MG + +
Sbjct: 61  EKFMQIRGANTIIAQGRKRKARNAEFFAALERKYGVPAGILIAIHGMETAFGNYMGDSQV 120

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAI 211
           +S + TL YDCRR++FF      AL LV +G I+    GA  GE+G  QFLP N + Y +
Sbjct: 121 VSAIVTLTYDCRRSEFFKPHAIGALKLVDRGAITGATKGAKHGELGHTQFLPGNALNYGV 180

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           D D +G++D   +  DA+AS A FL K GW    GYQ GE N+ +LK WNA+  Y +++A
Sbjct: 181 DWDGNGRVDFY-NMGDALASTAYFLRKKGWKPGRGYQQGEPNYKVLKQWNAATVYQQSLA 239

Query: 272 YIAAHIDG 279
            +   IDG
Sbjct: 240 IMGRKIDG 247


>gi|114769612|ref|ZP_01447222.1| Membrane bound lytic murein transglycosylase B [alpha
           proteobacterium HTCC2255]
 gi|114549317|gb|EAU52199.1| Membrane bound lytic murein transglycosylase B [alpha
           proteobacterium HTCC2255]
          Length = 410

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 77/336 (22%), Positives = 131/336 (38%), Gaps = 61/336 (18%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
            +  I  L     + +  +      + Q I     + F +W    +  A+  G++  T  
Sbjct: 1   MFKTIFALASCLIVFSMPLVAEDTKSIQTIGVQKENSFKQWIRNFKEDAISNGITTSTFD 60

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F +++     I  D K          DYLD  +S + I  G          L  ++ +
Sbjct: 61  TAFENVKLNSRVIKADNKQAE-FSREIWDYLDTATSPKRITNGKENLSNYLNTLREIEFK 119

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           Y V   +++A+WGLE+ +G+ MG   ++  LATLA+D RR KF  +Q   AL ++++G I
Sbjct: 120 YRVDAEVVLAIWGLESSYGKRMGDINIIEALATLAFDGRREKFGKQQLLEALKIIQRGDI 179

Query: 185 SSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK--SNIDAIASAAKFLAKLGW 241
           +    +G+  G +G  QF+P +   YA D   DGK D+       DA+AS A +LA+ GW
Sbjct: 180 TPDKMMGSWAGAMGHTQFIPTSYQAYAQDFTGDGKRDVWDPLDPSDALASTANYLAEFGW 239

Query: 242 TKCAGYQPGEK---NFA--------------------------ILKHW------------ 260
           T    +    K   NF                           I+ ++            
Sbjct: 240 TNNQPWGIEVKLPENFNYRNADLEVKATTARWTELGLKTISGGIIPNYGEGSVFLPAGAK 299

Query: 261 ----------------NASLNYNKTIAYIAAHIDGV 280
                           N + +Y   + +++  I G 
Sbjct: 300 GPAFIVFKNFFVIKRYNNANSYAMAVGHLSDRILGG 335


>gi|297184320|gb|ADI20437.1| membrane-bound lytic murein transglycosylase b [uncultured alpha
           proteobacterium EB080_L43F08]
          Length = 410

 Score =  202 bits (514), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 78/336 (23%), Positives = 131/336 (38%), Gaps = 61/336 (18%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
            Y  I  L     + +  +      + Q I     + F +W    +  A+  G++  T  
Sbjct: 1   MYKTIFALASCLIVFSMPLVAEDTKSIQTIGVQKENSFKQWIRNFKKDAISNGITTSTFD 60

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F +++     I  D K          DYLD  +S + I  G          L  ++ +
Sbjct: 61  TAFENVKLNSRVIKADNKQAE-FSREIWDYLDTATSPKRITNGKENLSNYLNTLREIEFK 119

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           Y V   +++A+WGLE+ +G+ MG   ++  LATLA+D RR KF  +Q   AL ++++G I
Sbjct: 120 YRVDAEVVLAIWGLESSYGKRMGDINIIEALATLAFDGRREKFGKQQLLEALKIIQRGDI 179

Query: 185 SSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK--SNIDAIASAAKFLAKLGW 241
           +    +G+  G +G  QF+P +   YA D   DGK D+       DA+AS A +LA+ GW
Sbjct: 180 TPDKMMGSWAGAMGHTQFIPTSYQAYAQDFTGDGKRDVWDPLDPSDALASTANYLAEFGW 239

Query: 242 TKCAGYQPGEK---NFA--------------------------ILKHW------------ 260
           T    +    K   NF                           I+ ++            
Sbjct: 240 TNNQPWGIEVKLPENFNYRNADLEVKATTARWTELGLKTISGGIIPNYGEGSVFLPAGAK 299

Query: 261 ----------------NASLNYNKTIAYIAAHIDGV 280
                           N + +Y   + +++  I G 
Sbjct: 300 GPAFIVFKNFFVIKRYNNANSYAMAVGHLSDRILGG 335


>gi|270262198|ref|ZP_06190470.1| putative transglycosylase [Serratia odorifera 4Rx13]
 gi|270044074|gb|EFA17166.1| putative transglycosylase [Serratia odorifera 4Rx13]
          Length = 357

 Score =  202 bits (513), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 72/215 (33%), Positives = 115/215 (53%), Gaps = 2/215 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
                 +F  +    + +A+ +G+S  T  + FA+  ++D  I  DR       ++  DY
Sbjct: 53  TGRDPAQFPAYVEQLKRQALAQGISQATIDNAFANAHFVDRVIKADRNQPEK-KITLDDY 111

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L  +     I QG  L +     L  +   YGVP   ++ALWG+E+ FG+  G+  ++S 
Sbjct: 112 LKRVLPPAKIEQGRTLSRQYRSQLTRVTARYGVPGRYIVALWGMESAFGKIQGREDVISA 171

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDA 213
           LATLA++ RR  FFT+Q   AL +V++G + S+   G+  G +GQ QF+P + + YA D 
Sbjct: 172 LATLAFEGRREAFFTQQVMAALQIVEQGRVGSTQLKGSWAGAMGQCQFMPTSFLSYAADG 231

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           D DG+ID+  +  D  AS A +LA  GW +  G+ 
Sbjct: 232 DGDGRIDIWNNPDDVFASTANYLASEGWQRGIGWG 266


>gi|254486981|ref|ZP_05100186.1| lytic murein transglycosylase [Roseobacter sp. GAI101]
 gi|214043850|gb|EEB84488.1| lytic murein transglycosylase [Roseobacter sp. GAI101]
          Length = 267

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 91/267 (34%), Positives = 137/267 (51%), Gaps = 3/267 (1%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           +         ++          C + A  F  WK+A    A   G+  +      A+ +Y
Sbjct: 4   IFSLTTTLCVMSALASPLAAAQCGNNAGGFNSWKAAFAQEAAAAGVGKRGLD-ALANAQY 62

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TIA DR   +    +   ++    +  I+AQG   K  N     +L+  +GVP G++
Sbjct: 63  ASRTIAADRNQKS-FKYTLDKFMQVRGADTIVAQGRKRKARNPAFYQSLEARFGVPAGVI 121

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+ G+ET FG  MG + ++S + TL YDCRR+ FF      AL LV +G I+    GA 
Sbjct: 122 IAIHGMETAFGGFMGDSAVVSAITTLTYDCRRSDFFAPHAIGALKLVDQGAINGSTKGAK 181

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GE+G  QFLP N ++Y +D + DG++D      DA+AS A FL + GW    GYQ G+ 
Sbjct: 182 HGELGHTQFLPGNALRYGVDGNGDGRVDFY-DQTDALASTANFLRQKGWQPGGGYQEGQT 240

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           NF +++ WNA+  Y K IA +A+ IDG
Sbjct: 241 NFNVIQQWNAAGVYQKAIAIMASRIDG 267


>gi|260460630|ref|ZP_05808881.1| lytic murein transglycosylase [Mesorhizobium opportunistum WSM2075]
 gi|259033735|gb|EEW34995.1| lytic murein transglycosylase [Mesorhizobium opportunistum WSM2075]
          Length = 407

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 76/339 (22%), Positives = 129/339 (38%), Gaps = 65/339 (19%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           MS +        +M    L+ A+  P               F +W +  RA AV  G+S 
Sbjct: 1   MSVRNAAKRFTSVMTAASLSLAMLMPAGPAFAD------AGFRQWVAGFRATAVAGGVSG 54

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
                 F  +   D  +    +          DY D     + +A G  + K     L  
Sbjct: 55  SVYDQAFRSINEPDPVVLEKARTQPEFTAPAWDYFDNRVHDQSVAVGQQMAKKWKPWLDR 114

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLST----LATLAY-DCRRAKFFTEQFFYA 175
           ++ ++GV   IL+A+W +E+++GE + +  ++      LATLAY D +R+K+   Q   A
Sbjct: 115 IEAKFGVDRYILLAIWSMESNYGEILKRDDIMRNVVRSLATLAYGDPKRSKYARTQLVAA 174

Query: 176 LDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L +++ G I     +G+  G +GQ QF+P +   YA+D D +G+ D+  S  DA+A++A 
Sbjct: 175 LKILQTGDIDEGHLMGSWAGAMGQTQFIPTSYQHYAVDMDGNGRRDIWNSIPDALATSAN 234

Query: 235 FLAKLGWTKCAGY----------------------------------------------- 247
            L K GW     +                                               
Sbjct: 235 LLKKNGWQAGKTWGYEVALPAGKLPAGSKTLAQWQALGVVRASGKPFKNLTDKATLKVPD 294

Query: 248 QPGEKNF------AILKHWNASLNYNKTIAYIAAHIDGV 280
             G   F      +++K +N +  Y   +  +A  I G 
Sbjct: 295 GRGGPAFLMIRNFSVIKAYNNADKYALAVGLLADEIAGS 333


>gi|82494640|gb|ABB79949.1| translycolase-related protein [uncultured bacterium pES01019D12]
          Length = 409

 Score =  202 bits (513), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 84/336 (25%), Positives = 134/336 (39%), Gaps = 73/336 (21%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTA 63
           ++Y++  L++     L                      F + K+  + RA  EG+ P T 
Sbjct: 10  RRYVVARLVLTTLIGLIATFPA-------------QADFEQCKANLKDRARAEGIDPSTI 56

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
            H+   ++Y    I  D++       SF +Y     ++  +A G AL   +  LL  +++
Sbjct: 57  NHVLDAVDYNAKVIELDQRQPE-FTRSFGNYYHLRVTTSRVAIGRALLATHIDLLQRVRR 115

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
           + GVPP  L+A WGLET+FG   G   +  +L TLA D RR++FF+ +   AL +++ G 
Sbjct: 116 QTGVPPHYLVAFWGLETNFGNIFGNMSVPDSLTTLACDPRRSEFFSAELMNALRIIEAGD 175

Query: 184 IS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG-- 240
           +      G+  G +G  QF+P   + YA+D D DG+ DL  S  DA+ SA  FL +LG  
Sbjct: 176 VEVEKMRGSWAGAMGHVQFMPSAYLNYAVDGDGDGRRDLWGSIPDAMFSAGNFLQQLGWQ 235

Query: 241 ------------------------------WTK-------CAGYQPG------------- 250
                                         W K                           
Sbjct: 236 PGIRWGREVILPDSFDYALANTGKAKPLNDWRKLGIKDVFGQPLAKSDIATSLLVPSGHK 295

Query: 251 ------EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                  +NF ++  WN S  Y  ++  +A  I G 
Sbjct: 296 GPAFVTYQNFDVIMRWNRSEYYALSVGRLADRIAGA 331


>gi|290475389|ref|YP_003468277.1| putative lipoprotein [Xenorhabdus bovienii SS-2004]
 gi|289174710|emb|CBJ81506.1| putative lipoprotein precursor [Xenorhabdus bovienii SS-2004]
          Length = 361

 Score =  202 bits (512), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 87/306 (28%), Positives = 135/306 (44%), Gaps = 62/306 (20%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
            I S    +F  + +  + +A  +G S KT    FAD+ ++   I  DR       ++  
Sbjct: 48  PIASREPSQFPTYVALLKQQAKEQGFSEKTLDRAFADIHFISRVIQSDRNQPEK-KITLA 106

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL+ + S+  I QG+   + N   L  + ++YGVP   ++ALWGLE+ FG+  GK  ++
Sbjct: 107 DYLNRVLSARKIEQGVIQYQNNLPQLEIISRKYGVPKDYIVALWGLESGFGKIQGKEDVI 166

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA--LGATFGEIGQFQFLPVNVVKYA 210
           S L+TLA++ RR   F +Q   AL++++K  I  H    G+  G +GQ QF+P + + YA
Sbjct: 167 SALSTLAFEGRREDLFIKQLMAALEIIEKKYIDEHQTLKGSWAGAMGQSQFMPTSYLNYA 226

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG-------------------- 250
            D + DGKID+  S  D  AS A +LAK GW +   +  G                    
Sbjct: 227 ADGNGDGKIDIWNSKEDVFASIANYLAKEGWQQGLPWGYGVSLPAGFDQNLEGVKLEQGK 286

Query: 251 -----------EKNF----------------------------AILKHWNASLNYNKTIA 271
                        NF                              + HWN S N+  ++ 
Sbjct: 287 TIIQWQTLGVSSPNFASLPVNTKGWIVIPNDTEQRAFWVTQNFRTIMHWNRSYNFALSVG 346

Query: 272 YIAAHI 277
            +A HI
Sbjct: 347 MMADHI 352


>gi|192361979|ref|YP_001980771.1| peptidoglycan lytic transglycosylase [Cellvibrio japonicus Ueda107]
 gi|190688144|gb|ACE85822.1| peptidoglycan lytic transglycosylase, putative, plt103B [Cellvibrio
           japonicus Ueda107]
          Length = 434

 Score =  202 bits (512), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 93/330 (28%), Positives = 133/330 (40%), Gaps = 63/330 (19%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA 78
              A      AT Q   SD    F          A+  G+S +  +            + 
Sbjct: 41  AGSAPLTTGTATQQAPLSD--ADFAACIDRFSRDAINAGISEQVIRTSLQRATLNRRVLE 98

Query: 79  RDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGL 138
            DR+       +F DY +   +++ +AQG AL  A+  LL  +++ YGVP   L+A WGL
Sbjct: 99  LDRQQPE-FTTTFADYFNRRVTAQRVAQGRALWAAHRPLLDRIEQAYGVPAPYLLAFWGL 157

Query: 139 ETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIG 197
           ET+FG   G  P++ +LATLA D RR+ FFT +   AL +V++G I+   + G+  G +G
Sbjct: 158 ETNFGSYFGNIPVMDSLATLACDTRRSGFFTIELMNALRIVEQGDIAPKKMVGSWAGAMG 217

Query: 198 QFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--------- 248
            FQF+P   +K A+D D D K DL  S  DA+ASAA FL  LGW     +          
Sbjct: 218 NFQFMPSAYLKNAVDFDGDNKRDLWHSKPDAMASAAHFLRNLGWVSAERWGREVKLPRNF 277

Query: 249 ----PGEKNFAIL---------------------------------------------KH 259
                G KN   +                                               
Sbjct: 278 PFLEAGLKNHKSIAEWRNLGVTRADNTPLPPVDIQASLLVPAGHEGPAFLVYENFNVIMR 337

Query: 260 WNASLNYNKTIAYIAAHID-GVPIGKGYDT 288
           WN S  Y   +  +A  I  G P+ +   T
Sbjct: 338 WNRSEFYALAVGQLADQIAGGAPLVQAPPT 367


>gi|330505009|ref|YP_004381878.1| lytic murein transglycosylase [Pseudomonas mendocina NK-01]
 gi|328919295|gb|AEB60126.1| lytic murein transglycosylase [Pseudomonas mendocina NK-01]
          Length = 418

 Score =  201 bits (511), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 76/226 (33%), Positives = 118/226 (52%), Gaps = 2/226 (0%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
                A  Q    +    F +W+ A R+ A+  G+       +FA +      +  D   
Sbjct: 31  AATSPAAVQTSTEEPLTSFADWRQALRSEAIAAGIDAALFDRVFAGVTPDPAVLKADSSQ 90

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
                    +YLDG  SS  I +G  L   +S +L  ++++YGV   IL+A+WGLE++FG
Sbjct: 91  PE-FTRPVWEYLDGAVSSSRIGRGRVLLAQHSLVLERIEQQYGVEAPILVAIWGLESNFG 149

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFL 202
             +G   ++ +LATLAYD RR  F+  Q   AL +++ G +SS  + G+  G +GQ QF+
Sbjct: 150 NNIGSHSVIRSLATLAYDGRRQGFWRVQLLAALQILQNGDVSSERMIGSWAGAMGQTQFM 209

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           P    ++A+D D DGK DL  S+ DA+ASAA +L   GW +   + 
Sbjct: 210 PTTYNQHAVDFDGDGKRDLWGSSTDALASAAHYLQASGWQRGQPWG 255


>gi|85705403|ref|ZP_01036502.1| hypothetical protein ROS217_18082 [Roseovarius sp. 217]
 gi|85670276|gb|EAQ25138.1| hypothetical protein ROS217_18082 [Roseovarius sp. 217]
          Length = 261

 Score =  201 bits (511), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 97/264 (36%), Positives = 146/264 (55%), Gaps = 3/264 (1%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
             L   ++          C ++AD F  WK+A    A  EG+  +      A  +Y  +T
Sbjct: 1   MALGLWLSLAATGAAAAPCGNSADGFSAWKAAFAREAAAEGVGQRGLD-ALASSQYASST 59

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           IA DR   +    S + +L       I+AQG   +  ++     L+++YGVP G+L+A+ 
Sbjct: 60  IAADRNQKS-FKYSLEKFLQVRGGPTIVAQGRKRRVNDAAFYDALERQYGVPAGVLIAIH 118

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEI 196
           G+ET FG  MG + +++ + TL YDCRR+ FF      AL LV +G I++   GA  GE+
Sbjct: 119 GMETGFGGFMGDSAVVAAIVTLTYDCRRSDFFRPHALGALQLVDQGAITAQTKGAKHGEL 178

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAI 256
           G  QFLP N ++Y +DA+ DG++D   +  DA+AS A FL + GW    GYQ G+ NFA+
Sbjct: 179 GHTQFLPGNALRYGVDANGDGRVDFY-NLTDALASTANFLRQKGWQPGQGYQEGQPNFAV 237

Query: 257 LKHWNASLNYNKTIAYIAAHIDGV 280
           ++ WNA+  Y + IA +AA IDG 
Sbjct: 238 IQQWNAASVYQQAIALMAAQIDGG 261


>gi|99082831|ref|YP_614985.1| lytic murein transglycosylase [Ruegeria sp. TM1040]
 gi|99039111|gb|ABF65723.1| Lytic murein transglycosylase [Ruegeria sp. TM1040]
          Length = 455

 Score =  201 bits (511), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/232 (31%), Positives = 112/232 (48%), Gaps = 3/232 (1%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
               Q   A  + +  D    F  W +A + RA  +G+   T +  F  + Y  + I RD
Sbjct: 66  APAAQDALAPAREVDGDANAGFQRWITAFKIRAQTQGIGAATLRAAFNGVTYDASVIKRD 125

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R        +  DYLD  +S   +  G     A+   L  ++K +GV   I++A+WGLE+
Sbjct: 126 RNQSE-FTKTIWDYLDSAASESRVRNGTKALDAHRNTLERIEKHFGVDKEIVVAVWGLES 184

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
            +G   G   ++ +LATLAYD RR  FF EQ   AL +++ G ++   + G+  G +G  
Sbjct: 185 SYGSFRGDMDIIRSLATLAYDGRRGDFFEEQLIAALKIIEAGDVNPRTMTGSWAGAMGHT 244

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKS-NIDAIASAAKFLAKLGWTKCAGYQPG 250
           QF+P + + YA+D   DGK D+      DA+AS A +L   GW     +   
Sbjct: 245 QFIPTSYLDYAVDFTGDGKRDIWSDTPTDALASTAAYLKAFGWVTGQPWGIE 296



 Score = 46.4 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 9/34 (26%), Positives = 19/34 (55%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
           KNF++L+ +N +  Y   + +++  + G    KG
Sbjct: 355 KNFSVLERYNTADAYVIGVGHLSDRLKGGEKIKG 388


>gi|114320621|ref|YP_742304.1| lytic murein transglycosylase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227015|gb|ABI56814.1| lytic murein transglycosylase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 400

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 81/300 (27%), Positives = 120/300 (40%), Gaps = 60/300 (20%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
            D F    +    +A   G+S    +   AD+  L+  I+ DR+       +F  YLD  
Sbjct: 24  GDDFQRCVATLGDQAREAGLSESAIEAALADITPLERVISSDRRQPE-FVQTFWTYLDQR 82

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            +   + +G AL   +  LL  +  +YGV P  L+ALWG+ET+FG   G  P++  LATL
Sbjct: 83  VTDRRVERGRALLDEHQDLLWRIHADYGVRPQYLLALWGMETNFGGYFGDVPVIDALATL 142

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A D RR+ FF  Q   A+ ++ +G +     +G+  G +G  QF+P     YA+D D  G
Sbjct: 143 ACDTRRSAFFRTQVVEAIRIIDEGHMDRDGMVGSWAGAMGHTQFMPSTFTAYAVDYDGSG 202

Query: 218 KIDLVKSNIDAIASAAKFLAK------LGWTK------CAGYQPGEK------------- 252
           +IDL  S  DA AS+A +L          W +         Y                  
Sbjct: 203 RIDLWNSLPDAFASSANYLRALGWRDGHRWGREVILPEGFDYALAAPEARRSVAAWRELG 262

Query: 253 ---------------------------------NFAILKHWNASLNYNKTIAYIAAHIDG 279
                                            NF  +  WNAS +Y   +  +A  I G
Sbjct: 263 VQRTDGRLVPDSEIEAELLLPGGYRGPAFLVYDNFRKIMRWNASTSYALAVGILADRIAG 322


>gi|288958596|ref|YP_003448937.1| lytic murein transglycosylase [Azospirillum sp. B510]
 gi|288910904|dbj|BAI72393.1| lytic murein transglycosylase [Azospirillum sp. B510]
          Length = 425

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/352 (22%), Positives = 132/352 (37%), Gaps = 73/352 (20%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKK--------------ATTQFICSDTADRFGEWKSAARA 51
           +   + L++   ++A   +                   +     +     F EW +A R 
Sbjct: 5   FRHPARLLLATLLMAGCQSTGATTPAPSGAAPAAAQPGSAAQPVAQQPASFPEWLAALRV 64

Query: 52  RAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALK 111
            A+ +G+ P+T    F  ++  D  +  D             YLD   + + +  G    
Sbjct: 65  EALGQGIRPQTFDRAFQRVKLSDRVVELDSSQPE-FTRQVWQYLDSAVNEKRVQDGRQKL 123

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQ 171
           +    LL  + +  GVP  IL+A WG+E+ FG++ G  P++  L TLA++ RRA +F  +
Sbjct: 124 QEQGALLSRISRRTGVPGEILVAFWGVESDFGKSTGNFPVIDALTTLAFEGRRAAYFRSE 183

Query: 172 FFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
              AL ++  G I+   + G+  G +GQ QF+P   ++ A+D D DG  D+  S  D +A
Sbjct: 184 LLAALRILDSGDIAPERMTGSWAGAMGQTQFMPTVFLRNAVDEDGDGHRDIWGSMPDVLA 243

Query: 231 SAAKFLAKLGWTKCAGY-------------QPGEKNFAILKHW----------------- 260
           S AKF+   GW     +             Q        L  W                 
Sbjct: 244 STAKFVLANGWRPGEPWGQEVSLPDGFPYDQAELSVTKPLSEWRRLGVRPLDGGELAGDA 303

Query: 261 ---------------------------NASLNYNKTIAYIAAHIDGVPIGKG 285
                                      N S +Y+  +A +A  + G P  +G
Sbjct: 304 PASVLVLAGHRGPAFLVRDNFRAIMRYNPSTSYSLAVALLADRMTGKPGVRG 355


>gi|117920902|ref|YP_870094.1| lytic murein transglycosylase [Shewanella sp. ANA-3]
 gi|117613234|gb|ABK48688.1| lytic murein transglycosylase [Shewanella sp. ANA-3]
          Length = 430

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 90/361 (24%), Positives = 141/361 (39%), Gaps = 83/361 (22%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDT-----------------------ADRF 42
            + +  +  +   +A  V+    ++      ++                       A  F
Sbjct: 1   MIKLKGMSYLAASIAACVSLSACSSAPTSSGNSQTAIAETQAAVQEMPLSDTIAAHAAAF 60

Query: 43  GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSE 102
               +  + RA  EG+S  T +   A L+++   I  D+        +F +Y    ++  
Sbjct: 61  PTCVANLQERARTEGLSEATIQDTVASLQFVPKVIELDQAQPE-FSQTFNNYFTKRATDW 119

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
            + +G  L K +  LL  L +EYGVPP  +++ WGLET++G   GK  +L +LATLA + 
Sbjct: 120 RVNEGRRLLKKHRALLDKLAQEYGVPPQYILSFWGLETNYGSYKGKMSVLDSLATLACEP 179

Query: 163 RRAKFFTEQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR+ +FT +   AL L +K G   S  +G+  G +G  QF+P    KYAID D DGK DL
Sbjct: 180 RRSGYFTTELMQALKLKEKYGFDKSTMVGSWAGAMGHTQFMPSAYAKYAIDGDGDGKADL 239

Query: 222 VKSNIDAIASAAKFLAKLGWTKCAGYQPG---EKNFA----------------------- 255
             S  DA+ SAA FL  LGW +   +       +NF                        
Sbjct: 240 WNSTEDALTSAANFLQHLGWQRNERWGREVILPRNFNYENLGAKQAQPLSQWAAQSVVQS 299

Query: 256 -----------------------ILKHW---------NASLNYNKTIAYIAAHIDGVPIG 283
                                      +         N S  Y  T+ ++A  I+G    
Sbjct: 300 NGLPLPAINMKAALYLPSGHTGPAFLGYENFNVIMRWNRSEFYAITVGHLADRINGGEPL 359

Query: 284 K 284
           K
Sbjct: 360 K 360


>gi|188582710|ref|YP_001926155.1| lytic murein transglycosylase [Methylobacterium populi BJ001]
 gi|179346208|gb|ACB81620.1| lytic murein transglycosylase [Methylobacterium populi BJ001]
          Length = 400

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 81/305 (26%), Positives = 126/305 (41%), Gaps = 56/305 (18%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPVS 90
                     F  + ++ R+ A+  G+SP T    FA L       IAR R+        
Sbjct: 20  PGPAWAQDGDFPGFVASLRSDAIARGVSPNTFDAAFAGLRGPDPDVIARTRRQGE-FSRP 78

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
             DYL G  S   IA+G A  K  +  L  ++ + GVP  I++A WG+E+ FG + G  P
Sbjct: 79  VWDYLVGAVSPGRIARGQAQGKRLAATLAAIEAKTGVPRAIVLAFWGVESDFGASAGSLP 138

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKY 209
            +  LA+LAY   R   F ++   AL +++KG I     +G+  G +GQ QFLP   ++ 
Sbjct: 139 TVRALASLAYVRHRGTLFRDELLAALQILEKGDIEPARMVGSWAGAMGQVQFLPSVYLRE 198

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP-------------------- 249
           A+D D DG+ D+ +S  DA+AS A +L  LGW     +                      
Sbjct: 199 AVDFDGDGRRDIWRSEPDALASIAHYLRSLGWKPGLSWGYEVSLPKEFDLTRYRGPLADF 258

Query: 250 ---------------------------GEKNF------AILKHWNASLNYNKTIAYIAAH 276
                                      G   F       +++ +N S +Y   + ++A  
Sbjct: 259 AARGVRRTDGKPLPVNGEASLFLPGGLGSPVFLITDNFEVIRGYNTSDSYALAVGHLADR 318

Query: 277 IDGVP 281
           + G P
Sbjct: 319 LAGGP 323


>gi|83855364|ref|ZP_00948894.1| peptidoglycan binding domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83843207|gb|EAP82374.1| peptidoglycan binding domain protein [Sulfitobacter sp. NAS-14.1]
          Length = 426

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/331 (23%), Positives = 123/331 (37%), Gaps = 60/331 (18%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
              ++A       +         +A    +W +A RARA+  G+           + Y  
Sbjct: 27  ATGVIAAGAEGTARPPAMVQKPGSAAGLQDWVTAFRARALAAGIDGAVFDRAMQTVRYDP 86

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
             I RDR        +   YL+  +S   +  G       +  L  ++  YGV   I+ A
Sbjct: 87  QVIRRDRNQSE-FTKTIWAYLETATSDLRVTNGKKALAEQADALSQIETRYGVEKEIVTA 145

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATF 193
           +WGLE+ +G   G  P+LS+LATLAYD RR  FF  +   AL +++ G  +     G+  
Sbjct: 146 IWGLESAYGTFRGSDPVLSSLATLAYDGRRRAFFEGELLDALRILQAGDTTPARMQGSWA 205

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI-DAIASAAKFLAKLGWTKCAGYQ---- 248
           G +G  QF+P +  +YA D   DGK D+   +  DA+AS A +L   GW +   +     
Sbjct: 206 GAMGHTQFMPSSFQQYAEDFTGDGKRDIWSDDPRDALASTAAYLKHFGWVQGQPWGVEVR 265

Query: 249 -------------------------------------------PGEKNFAILKHW----- 260
                                                      PG    A    +     
Sbjct: 266 LPEGFDYLLAGRDILKTAAEWRALGVRPVTGSLGDHGPASLLLPGGAEGAAFLIYANFAV 325

Query: 261 ----NASLNYNKTIAYIAAHID-GVPIGKGY 286
               N++  Y   + ++A  I  G PI   +
Sbjct: 326 IERYNSADAYVIGVGHLADRIAGGGPIESSW 356


>gi|254487251|ref|ZP_05100456.1| peptidoglycan binding domain protein [Roseobacter sp. GAI101]
 gi|214044120|gb|EEB84758.1| peptidoglycan binding domain protein [Roseobacter sp. GAI101]
          Length = 404

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 77/336 (22%), Positives = 127/336 (37%), Gaps = 61/336 (18%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           L  ++         Q   A T    +        W +  R+RAV  G+  +        +
Sbjct: 2   LAALLGVGAMPVFAQASGAATAMAHAGNDAGLQTWLAGFRSRAVTAGIDAQVFDAAMTGV 61

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
            Y    I RDR        +  +YL   +S   IA G      N   L  ++K YGV   
Sbjct: 62  RYDADVIQRDRNQSE-FTKTIWEYLKTATSDLRIANGKKALADNRAALEQIEKTYGVEKE 120

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL- 189
           +++A+WGLE+ +G   G   +L++LA+LAYD RR  FF  +   AL +++ G      + 
Sbjct: 121 VVVAIWGLESAYGTFRGGDNVLTSLASLAYDGRRRDFFESELLDALRILQAGDTQPDQMK 180

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI-DAIASAAKFLAKLGWTKCAGYQ 248
           G+  G +G  QF+P +  ++A+D   D K D+   +  DA+AS A +L   GWT+   + 
Sbjct: 181 GSWAGAMGHTQFMPSSFQRHAVDFTGDAKRDIWGDDPRDALASTAAYLKHFGWTQGQPWG 240

Query: 249 PG----------EKNFAILK---------------------------------------- 258
                         N  +LK                                        
Sbjct: 241 VEVQLPEGFDYLLANRDVLKSPDDWAALGVVNMAGATVGDHGQASILLPGGAEGAAFMIF 300

Query: 259 -------HWNASLNYNKTIAYIAAHID-GVPIGKGY 286
                   +N +  Y   + +++  I  G PI + +
Sbjct: 301 SNFEVIERYNTADAYVIGVGHLSDRIAGGRPIEQSW 336


>gi|77461182|ref|YP_350689.1| lytic murein transglycosylase [Pseudomonas fluorescens Pf0-1]
 gi|77385185|gb|ABA76698.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
          Length = 440

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 70/238 (29%), Positives = 119/238 (50%), Gaps = 2/238 (0%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L       A A+  P   +   +       F EW++  R  A+  G+        FA++ 
Sbjct: 38  LQTAPVATAPAILPPVVPSGDNLDLQPTQTFAEWQAGFRKEALAAGIRADLFDRAFANVS 97

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           +  + I  DR           +YLDG  S   + +G AL    + +L ++++ YGV    
Sbjct: 98  FDASVIRADRSQPE-FARPVWEYLDGALSPLRVRKGQALISQYADILQSIEQRYGVDRQA 156

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-G 190
           L+++WG+E++FG+  G   ++++LATLAY+ RR  F   Q   AL ++++G I+   + G
Sbjct: 157 LVSVWGMESNFGQFQGSKSVINSLATLAYEGRRPGFAHAQLIAALQILQQGDITPEKMLG 216

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +  G +GQ QF+P     +A+D D DG+ D+  S  DA+AS A +L   GW +   + 
Sbjct: 217 SWAGAMGQTQFIPTTYNTHAVDFDGDGRRDIWGSPADALASTAHYLQSSGWQRGQPWG 274



 Score = 45.6 bits (106), Expect = 0.008,   Method: Composition-based stats.
 Identities = 7/35 (20%), Positives = 16/35 (45%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
             NF  +  +N S +Y   ++ ++   +G  +  G
Sbjct: 337 LDNFRAILKYNNSSSYALAVSLLSERFNGAGLING 371


>gi|92113032|ref|YP_572960.1| lytic murein transglycosylase [Chromohalobacter salexigens DSM
           3043]
 gi|91796122|gb|ABE58261.1| Lytic murein transglycosylase [Chromohalobacter salexigens DSM
           3043]
          Length = 430

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/314 (24%), Positives = 120/314 (38%), Gaps = 58/314 (18%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
           +  Q    D    F  W +A R +A   G+   T    F  + +    I  DR       
Sbjct: 45  SEGQVASRDAHQDFAAWVAAFRQKAASAGIDEVTLAAAFDGVRFQPRIIELDRSQPE-FS 103

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
                YLD   S + + QG     A+    +  +K Y VP  IL A+WG+E+++G   G 
Sbjct: 104 KRVWRYLDTAVSEQRVRQGREKLTAHRAAAMRAEKRYAVPAEILTAIWGVESNYGSHFGS 163

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVV 207
              +  L+TL Y+ RR  F  E+   AL++++ G I    + G+  G +G  QFLP + +
Sbjct: 164 FSTIDALSTLGYEGRRQAFAREELLAALEILQSGDIDRDHMRGSWAGAMGHTQFLPSSFL 223

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG--------------------------- 240
            YA+DAD DG+ D+  S  D +AS A +L + G                           
Sbjct: 224 AYAVDADGDGRRDIWGSIDDVMASTAHYLEEAGWQAGQPWGVEVMLPDGFDYSQTELSVR 283

Query: 241 -----WTK-CAGYQPG-----------------------EKNFAILKHWNASLNYNKTIA 271
                W       + G                         NF  +  +NAS +Y   + 
Sbjct: 284 HSSAAWRAQGVTAREGALPTFDAASVIAPAGARGPAFLVGPNFRAIMRYNASTSYALAVV 343

Query: 272 YIAAHIDGVPIGKG 285
            +A  I G    +G
Sbjct: 344 TLAERIAGGDGIQG 357


>gi|323138792|ref|ZP_08073856.1| hypothetical protein Met49242DRAFT_3244 [Methylocystis sp. ATCC
           49242]
 gi|322395940|gb|EFX98477.1| hypothetical protein Met49242DRAFT_3244 [Methylocystis sp. ATCC
           49242]
          Length = 271

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 95/266 (35%), Positives = 138/266 (51%), Gaps = 9/266 (3%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
              +   A      + +   C +    F  WK      A   G  P     L     Y  
Sbjct: 10  AAMVFTAATLGSAPSASAAQCGNGPGGFERWKQDFAEEARASGHGPGAIDALM-GTHYNT 68

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
            TI+ DR   +   +S   ++    +S I+A+G +LK++ + L  ++++ YGVPPG L+A
Sbjct: 69  ATISADRGQKS-FRLSLDQFMAKRGASAIVARGRSLKRSQAALFSSIQQRYGVPPGPLLA 127

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFG 194
           +WG+ET FG  +G    LS +ATLAYDCRR+ +FT+Q   AL L+  G +S +A G+  G
Sbjct: 128 IWGMETGFGAVLGNQHALSAIATLAYDCRRSDYFTDQLNAALTLIDHGTLSPNARGSMHG 187

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNF 254
           EIGQ QFLP N++ Y    + D       +   A+++ A FL   GW   AGYQPGE NF
Sbjct: 188 EIGQTQFLPKNILNYGGGGNLD-------NAGAALSATANFLRAHGWRPGAGYQPGEPNF 240

Query: 255 AILKHWNASLNYNKTIAYIAAHIDGV 280
             ++ WNA+  Y + IA I   IDG 
Sbjct: 241 DAIQAWNAASVYQRAIAIIGRQIDGG 266


>gi|66047584|ref|YP_237425.1| hypothetical protein Psyr_4357 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258291|gb|AAY39387.1| HopAJ2 protein [Pseudomonas syringae pv. syringae B728a]
          Length = 445

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDNLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQTLVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSLQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 47.6 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/262 (12%), Positives = 67/262 (25%), Gaps = 28/262 (10%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTA------KHLFADLEYLDTTIA-RDR 81
           A +            ++    +    + G+  +T       +  F  L+   + I     
Sbjct: 125 AISAARVRKGQALLSQYADDLQKIEQQYGVDRQTLVAVWGMESNFGSLQGTQSVIRSLAT 184

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
                    F       +   I    I   K        + +   +P         ++  
Sbjct: 185 LAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNT--HAVDFD 242

Query: 142 FGETMGKTPLL-STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQ 200
                         LA+ A+  + + +   Q +    ++  G   S              
Sbjct: 243 GDGRRDIWNTPADALASTAHYLQSSGWQRGQPWGFEVVLGSGFDYS-------------- 288

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASA--AKFLAKLGWTKCAGYQPGEKNFAILK 258
                  K  ++  + G      S I   AS   A  L   G+           NF  + 
Sbjct: 289 LADSTTRKSLVEWQQLGLKQPDGSAIPVAASQQQAALLLPAGYR--GPAFLVLDNFRAIL 346

Query: 259 HWNASLNYNKTIAYIAAHIDGV 280
            +N S +Y   I+ ++    G 
Sbjct: 347 KYNNSTSYALAISLLSDRFKGA 368


>gi|319426715|gb|ADV54789.1| lytic murein transglycosylase [Shewanella putrefaciens 200]
          Length = 442

 Score =  200 bits (509), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 88/326 (26%), Positives = 135/326 (41%), Gaps = 60/326 (18%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
            +A                  AD F    +  +ARA  EG+S +T  +  A L+++   I
Sbjct: 48  AIADPNAALATVDINATVQLNADAFASCLTTLQARARSEGLSEETINNTVAHLQFVPRVI 107

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
             D++       +F +Y    ++   + +G  L + +  LL  L  +YGVPP  +++ WG
Sbjct: 108 ELDQQQPE-FSQTFANYFTKRATDWRVNEGRRLLQKHRALLDKLSLQYGVPPQYILSFWG 166

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEI 196
           LET++G   GK  +L +LATLA + RR+ +FT +   AL L +K     + + G+  G +
Sbjct: 167 LETNYGSYKGKMAVLDSLATLACEPRRSSYFTTELMQALKLKEKYQFDKNTMVGSWAGAM 226

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG---EKN 253
           G  QF+P    KYAID D DGK+DL  S  DA+ SAA FL  LGW +   +       KN
Sbjct: 227 GHTQFMPSAYAKYAIDGDGDGKVDLWNSTADALTSAANFLQNLGWQRNERWGREVLLPKN 286

Query: 254 FA----------------------------------------------ILKHW------- 260
           F+                                                  +       
Sbjct: 287 FSYSHLGAKQTLPLAEWAAQSVTLTNGQPLPQADILAALYLPAGHTGPAFLGYENFNVIM 346

Query: 261 --NASLNYNKTIAYIAAHIDGVPIGK 284
             N S  Y  T+ ++A  I+G    K
Sbjct: 347 RWNRSEFYAITVGHLADRINGGEPLK 372


>gi|237798416|ref|ZP_04586877.1| HopAJ2 protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021268|gb|EGI01325.1| HopAJ2 protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 440

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDTLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.9 bits (104), Expect = 0.013,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|330969444|gb|EGH69510.1| hypothetical protein PSYAR_02994 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 445

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDNLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQTLVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSLQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 47.6 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/262 (12%), Positives = 67/262 (25%), Gaps = 28/262 (10%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTA------KHLFADLEYLDTTIA-RDR 81
           A +            ++    +    + G+  +T       +  F  L+   + I     
Sbjct: 125 AISAARVRKGQALLSQYADDLQKIEQQYGVDRQTLVAVWGMESNFGSLQGTQSVIRSLAT 184

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
                    F       +   I    I   K        + +   +P         ++  
Sbjct: 185 LAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNT--HAVDFD 242

Query: 142 FGETMGKTPLL-STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQ 200
                         LA+ A+  + + +   Q +    ++  G   S              
Sbjct: 243 GDGRRDIWNTPADALASTAHYLQSSGWQRGQPWGFEVVLGSGFDYS-------------- 288

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASA--AKFLAKLGWTKCAGYQPGEKNFAILK 258
                  K  ++  + G      S I   AS   A  L   G+           NF  + 
Sbjct: 289 LADSTTRKSLVEWQQLGLKQPDGSAIPVAASQQQAALLLPAGYR--GPAFLVLDNFRAIL 346

Query: 259 HWNASLNYNKTIAYIAAHIDGV 280
            +N S +Y   I+ ++    G 
Sbjct: 347 KYNNSTSYALAISLLSDRFKGA 368


>gi|325983369|ref|YP_004295771.1| lytic murein transglycosylase [Nitrosomonas sp. AL212]
 gi|325532888|gb|ADZ27609.1| lytic murein transglycosylase [Nitrosomonas sp. AL212]
          Length = 406

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 80/253 (31%), Positives = 129/253 (50%), Gaps = 14/253 (5%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ KK+ L S++++V  +++ +      A+           FGE  S  +  A  EG+S 
Sbjct: 1   MTRKKFCL-SIVVLVAELISLSFAYADTAS-----------FGECISRMKILARSEGISD 48

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +T   +   ++++   I  DR+       +F  Y +   + E I +G AL      LL  
Sbjct: 49  RTVNQVLDKVKHIPRVIELDRRQPE-FTQTFSGYFNTRINDERIKRGRALLTQYRPLLER 107

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++ E G+P   L++ WGLET++G   G   +  +LATLA D RR+ FFT++   A+ ++ 
Sbjct: 108 IQLETGIPAQYLVSFWGLETNYGGYFGDWLVTDSLATLACDPRRSTFFTQELLNAMRILD 167

Query: 181 KGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G IS   + G+  G +G  QF+P   + YA D D DG+ DL  S  DA+ SAA FL +L
Sbjct: 168 AGDISHERMIGSWAGAMGHMQFMPSTFLSYAKDIDGDGRRDLWGSIPDAMGSAANFLRQL 227

Query: 240 GWTKCAGYQPGEK 252
           GWT    +    +
Sbjct: 228 GWTPGLDWGQEVR 240


>gi|330953017|gb|EGH53277.1| hypothetical protein PSYCIT7_16904 [Pseudomonas syringae Cit 7]
          Length = 445

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDNLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.9 bits (104), Expect = 0.013,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|289625785|ref|ZP_06458739.1| lytic murein transglycosylase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289648429|ref|ZP_06479772.1| lytic murein transglycosylase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330867181|gb|EGH01890.1| hypothetical protein PSYAE_07967 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330871069|gb|EGH05778.1| hypothetical protein PSYAE_28208 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 445

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 67/229 (29%), Positives = 113/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  R +A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDSLTIQPAVSFSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FTRPIWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.9 bits (104), Expect = 0.015,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|261325856|ref|ZP_05965053.1| lytic Murein transglycosylase [Brucella neotomae 5K33]
 gi|261301836|gb|EEY05333.1| lytic Murein transglycosylase [Brucella neotomae 5K33]
          Length = 272

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 101/225 (44%), Positives = 140/225 (62%), Gaps = 2/225 (0%)

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
           R G+         A+ +Y   TI  DR   +   +SF+ ++    +  II +G A+K+ N
Sbjct: 49  RRGIGKAGIN-ALANTKYAQATINADRNQKS-FKLSFEQFMQKRGADTIIKRGRAMKQQN 106

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + L  N++K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + 
Sbjct: 107 AALFANIEKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYA 166

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           AL L+ +  +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A 
Sbjct: 167 ALKLIDREDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTAN 226

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           FL   GW + AGYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 227 FLVGHGWQRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 271


>gi|83954212|ref|ZP_00962932.1| hypothetical protein NAS141_17939 [Sulfitobacter sp. NAS-14.1]
 gi|83841249|gb|EAP80419.1| hypothetical protein NAS141_17939 [Sulfitobacter sp. NAS-14.1]
          Length = 267

 Score =  200 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 97/264 (36%), Positives = 135/264 (51%), Gaps = 3/264 (1%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
                              C + A  F  WK A    A   G+  +      A+  Y  +
Sbjct: 7   LATALMLSLGFAAPVAAAQCGNNAGGFDAWKPAFAKEAAAAGVGQRGLD-ALANARYASS 65

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
           TIA DR   +    S   ++    +  I+AQG   K  N+    +L+  YGVP G+++A+
Sbjct: 66  TIAADRNQKS-FNYSLDKFMQVRGADTIVAQGRKRKGRNASFYQSLEARYGVPAGVIIAI 124

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGE 195
            G+ET FG  MG T ++S + TL YDCRR+ FF      AL LV  G I+    GA  GE
Sbjct: 125 HGMETAFGGFMGDTSVVSAITTLTYDCRRSDFFAPHAIGALKLVDTGAINGGTKGAKHGE 184

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFA 255
           +G  QFLP N ++Y +D + DG++D   +  DA+AS A FL + GW   AGYQ G+ NF 
Sbjct: 185 LGHTQFLPGNALRYGVDGNGDGRVDFY-NQTDALASTANFLRQKGWQPGAGYQEGQTNFN 243

Query: 256 ILKHWNASLNYNKTIAYIAAHIDG 279
           ++K WNA+  Y K IA +AA IDG
Sbjct: 244 VIKQWNAAGVYQKAIAIMAARIDG 267


>gi|260427736|ref|ZP_05781715.1| membrane-bound lytic murein transglycosylase B [Citreicella sp.
           SE45]
 gi|260422228|gb|EEX15479.1| membrane-bound lytic murein transglycosylase B [Citreicella sp.
           SE45]
          Length = 415

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 72/316 (22%), Positives = 127/316 (40%), Gaps = 59/316 (18%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
             +P       +       +  W ++ R+RA   G+S  T    F +  +L   + RDR 
Sbjct: 27  SMEPSGGLAPDLLPQPNAGYDAWVASFRSRAASRGISAATLDTAFRNAGFLPGVVKRDRS 86

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                  + +DY    +S E ++ G +  +    LL  ++  YGVPP I+ A+WG+E+ +
Sbjct: 87  QTE-FTRTLEDYFAIAASDEKVSTGRSKLRQYGGLLQEIEGRYGVPPQIVTAVWGMESRY 145

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQF 201
           GE  G  P++S  +TLAYD RRA FF  Q   AL ++++G  ++    G+  G +G  QF
Sbjct: 146 GERRGDIPVVSATSTLAYDGRRADFFESQLMAALRILQRGDTTASQLTGSWAGAMGHTQF 205

Query: 202 LPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAKFLAKLGWTKCAGYQPG---------- 250
           +P     YA+D   DG+ D+      D +AS A +L++ GW +   +             
Sbjct: 206 IPTTYQDYAVDFRGDGRRDIWSEDPTDGLASTANYLSRSGWRRGEPWGLEVSLPAGFSAG 265

Query: 251 ----------------------------------------EKNFAILKHW------NASL 264
                                                      F + +++      N + 
Sbjct: 266 QTGRGVRRSSSEWAAMGVRAAGGGSLPGGTGSILALSGVSGPAFLVFRNYNVILRYNNAE 325

Query: 265 NYNKTIAYIAAHIDGV 280
            Y   + +++  + G 
Sbjct: 326 KYGLGVGHLSDRLLGA 341


>gi|212635639|ref|YP_002312164.1| membrane-bound lytic transglycolase-like protein [Shewanella
           piezotolerans WP3]
 gi|212557123|gb|ACJ29577.1| Membrane-bound lytic transglycolase-like protein [Shewanella
           piezotolerans WP3]
          Length = 396

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 89/337 (26%), Positives = 137/337 (40%), Gaps = 74/337 (21%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
           FK   L + L+     +  +V  P               +    +  +  A  +G+S  T
Sbjct: 2   FKLIPLAATLIFSSSTVLASVASP--------------DWATCVANLQQTAKAQGLSQST 47

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
             +  A+++++   I  D +       SF++Y     +   + QG  L K +  LL  L 
Sbjct: 48  IDNTLANVKFVPRVIELDSQQPE-FSSSFENYFTKRVTDWRVQQGRKLYKEHKELLQRLA 106

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK- 181
           KEYGVPP  L+A WGLET+FG   GK  +L++LATLA D RR+++FT +   AL L ++ 
Sbjct: 107 KEYGVPPQYLLAFWGLETNFGSYKGKMSVLNSLATLACDPRRSRYFTTELMQALKLKEQY 166

Query: 182 GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK------- 234
           G      +G+  G +G  QF+P    KYA+D D DGK DL  S  DA++SAA        
Sbjct: 167 GFDEKQMVGSWAGAMGHTQFMPSAYAKYAVDGDGDGKADLWNSTEDALSSAAHFLQNLGW 226

Query: 235 -------------------FLAKLGWTKCAGYQP-------------------------- 249
                              +L +        +                            
Sbjct: 227 KRDERWGREVSLPNDFSYAYLGRAEAQPLTKWAELGLTQTNGNPLSTPDMQASLYLPSGH 286

Query: 250 ------GEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                 G  NF ++  WN S  Y   + ++A  I+G 
Sbjct: 287 TGPAFLGYDNFDVIMKWNRSTFYAIAVGHLADRINGA 323


>gi|163795503|ref|ZP_02189469.1| Membrane-bound lytic murein transglycosylase B [alpha
           proteobacterium BAL199]
 gi|159179102|gb|EDP63635.1| Membrane-bound lytic murein transglycosylase B [alpha
           proteobacterium BAL199]
          Length = 333

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 71/260 (27%), Positives = 122/260 (46%), Gaps = 24/260 (9%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +   F +W +  R  A   G+S +T    FA +  +   I  DR       + F +Y+D 
Sbjct: 31  STQPFDQWLAGVRTEAKGRGVSDRTLDAAFAGVAPIPRVIELDRNQPE-FRLKFDEYMDR 89

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
           + +   I +   L   + +LL  ++ +Y V    ++ALWG+E+ FG   G  P++++LAT
Sbjct: 90  VVTQTRIDRARRLLAEHGQLLDEVEAKYRVQKRFIVALWGIESDFGRITGGFPVIASLAT 149

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADED 216
           LAYD RR+ FF ++   AL+++++G I+     G+  G +GQ QF+P +  ++A+D + D
Sbjct: 150 LAYDGRRSTFFRKELMLALEILEQGHIAPADMKGSWAGAMGQNQFMPSSFHRFAVDHNGD 209

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ-------------PGEKNFAILKHWNAS 263
           G  D+  S  D  AS A++L+  GW     +               G      L     S
Sbjct: 210 GHKDIWNSLPDVFASIARYLSGSGWRDDMTWGREVTLPDGFDRKLIGSDARKPL-----S 264

Query: 264 LNYNKTIAYIAAHIDGVPIG 283
                 +      +DG P+ 
Sbjct: 265 DWEALGV----RRVDGGPLP 280


>gi|83943038|ref|ZP_00955498.1| hypothetical protein EE36_12693 [Sulfitobacter sp. EE-36]
 gi|83846046|gb|EAP83923.1| hypothetical protein EE36_12693 [Sulfitobacter sp. EE-36]
          Length = 267

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 97/264 (36%), Positives = 135/264 (51%), Gaps = 3/264 (1%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
                              C + A  F  WK A    A   G+  +      A+  Y  +
Sbjct: 7   LATALMLSLGFAAPVAAAQCGNNAGGFDAWKPAFAKEAAAAGVGQRGLD-ALANARYASS 65

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
           TIA DR   +    S   ++    +  I+AQG   K  N+    +L+  YGVP G+++A+
Sbjct: 66  TIAADRNQKS-FNYSLDKFMQVRGADTIVAQGRKRKARNASFYQSLEARYGVPAGVIIAI 124

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGE 195
            G+ET FG  MG T ++S + TL YDCRR+ FF      AL LV  G I+    GA  GE
Sbjct: 125 HGMETAFGGFMGDTSVVSAITTLTYDCRRSDFFAPHAIGALKLVDTGAINGGTKGAKHGE 184

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFA 255
           +G  QFLP N ++Y +D + DG++D   +  DA+AS A FL + GW   AGYQ G+ NF 
Sbjct: 185 LGHTQFLPGNALRYGVDGNGDGRVDFY-NQTDALASTANFLRQKGWQPGAGYQEGQTNFN 243

Query: 256 ILKHWNASLNYNKTIAYIAAHIDG 279
           ++K WNA+  Y K IA +AA IDG
Sbjct: 244 VIKQWNAAGVYQKAIAIMAARIDG 267


>gi|330960159|gb|EGH60419.1| hypothetical protein PMA4326_16506 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 445

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALIVDDSLTIQPAVSFSEWQAGFRAQALKAGIRADVFDQAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.9 bits (104), Expect = 0.015,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|120598509|ref|YP_963083.1| lytic murein transglycosylase [Shewanella sp. W3-18-1]
 gi|120558602|gb|ABM24529.1| lytic murein transglycosylase [Shewanella sp. W3-18-1]
          Length = 439

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 88/326 (26%), Positives = 135/326 (41%), Gaps = 60/326 (18%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
            +A                  AD F    +  +ARA  EG+S +T  +  A L+++   I
Sbjct: 45  AIADPNAALATVDINATVQLNADAFASCLTTLQARARSEGLSEETINNTVAHLQFVPRVI 104

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
             D++       +F +Y    ++   + +G  L + +  LL  L  +YGVPP  +++ WG
Sbjct: 105 ELDQQQPE-FSQTFANYFTKRATDWRVNEGRRLLQKHRALLDKLSLQYGVPPQYILSFWG 163

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEI 196
           LET++G   GK  +L +LATLA + RR+ +FT +   AL L +K     + + G+  G +
Sbjct: 164 LETNYGSYKGKMAVLDSLATLACEPRRSSYFTTELMQALKLKEKYQFDKNTMVGSWAGAM 223

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG---EKN 253
           G  QF+P    KYAID D DGK+DL  S  DA+ SAA FL  LGW +   +       KN
Sbjct: 224 GHTQFMPSAYAKYAIDGDGDGKVDLWNSTADALTSAANFLQSLGWQRNERWGREVLLPKN 283

Query: 254 FA----------------------------------------------ILKHW------- 260
           F+                                                  +       
Sbjct: 284 FSYSHLGAKQTLPLAEWAAQSVTLTNGQPLPQADIQAALYLPAGHTGPAFLGYENFNVIM 343

Query: 261 --NASLNYNKTIAYIAAHIDGVPIGK 284
             N S  Y  T+ ++A  I+G    K
Sbjct: 344 RWNRSEFYAITVGHLADRINGGEPLK 369


>gi|126732715|ref|ZP_01748511.1| peptidoglycan binding domain protein [Sagittula stellata E-37]
 gi|126706845|gb|EBA05915.1| peptidoglycan binding domain protein [Sagittula stellata E-37]
          Length = 466

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 62/212 (29%), Positives = 103/212 (48%), Gaps = 3/212 (1%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           A  F  W    R RA+ +G+S +T    F  + +    + RD            DYLD  
Sbjct: 97  AAAFARWVDGFRPRALSQGVSARTFDAAFRGVTFDPKVVERDSSQAE-FAKGIWDYLDSA 155

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           +S   +  G +    +  LL  ++  YGV   +++A+WG+ET +G   G   ++ ++A+L
Sbjct: 156 ASDTRVNNGRSALAQHRALLDRIEAHYGVDKEVVLAVWGMETAYGSYRGSNHIIQSMASL 215

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A+D RR  FF  Q   AL ++++G  +   + G+  G +G  QF+P +    A+D   DG
Sbjct: 216 AFDGRRRSFFERQLVAALQILEQGDTTPDRMTGSWAGAMGHTQFMPTSFQSLAVDFTGDG 275

Query: 218 KIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
           + D+      DA+AS A +L K GW     + 
Sbjct: 276 RRDIWGDDPSDALASTANYLKKNGWIAGQPWG 307



 Score = 56.8 bits (135), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
           KNF ++K +NA+  Y   + ++A  I G P  +G
Sbjct: 366 KNFRVIKRYNAADAYAMGVGHLADRIMGGPKFQG 399


>gi|257482219|ref|ZP_05636260.1| hypothetical protein PsyrptA_03057 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|298488994|ref|ZP_07007017.1| lytic murein transglycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156492|gb|EFH97589.1| lytic murein transglycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330987609|gb|EGH85712.1| hypothetical protein PLA107_21478 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011318|gb|EGH91374.1| hypothetical protein PSYTB_16920 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 445

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 67/229 (29%), Positives = 113/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  R +A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDSLTIQPAVSFSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FTRPIWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.5 bits (103), Expect = 0.016,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|330873691|gb|EGH07840.1| hypothetical protein Pgy4_04772 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 445

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 67/229 (29%), Positives = 113/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  R +A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDSLTIQPAVSFSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FTRPIWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 45.2 bits (105), Expect = 0.010,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 46/148 (31%), Gaps = 19/148 (12%)

Query: 136 WGLETHFGETMGKTPLL-STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFG 194
             ++                LA+ A+  + + +   Q +    ++  G   S A  +T  
Sbjct: 237 HAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWGFEVVLGSGFDYSLADSSTRK 296

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA--AKFLAKLGWTKCAGYQPGEK 252
            + ++Q L              G      S I   AS   A  L   G+           
Sbjct: 297 SLAEWQKL--------------GLKQPDGSAIPVAASQQQAALLLPAGYR--GPAFLVLD 340

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGV 280
           NF  +  +N S +Y   I+ ++    G 
Sbjct: 341 NFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|50086598|ref|YP_048108.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter sp. ADP1]
 gi|49532572|emb|CAG70286.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter sp. ADP1]
          Length = 431

 Score =  200 bits (507), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 79/307 (25%), Positives = 126/307 (41%), Gaps = 32/307 (10%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFIC--------SDTADRFGEWKSAARAR 52
           M    +LL S    + P  A+ +   K +    +         S   D F    +  R++
Sbjct: 1   MRHVPFLLGSYFFFIVPAHAELILNEKTSNGTPMTTPAITSNISPQNDNFQRCIANLRSQ 60

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           A+  G++  T      +L    + I +             DYL GL   E +  G     
Sbjct: 61  AISSGVNESTYDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVQAGRQKMA 119

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQF 172
               +L    + YGVP   ++A+WG+E+++G+  GK PLL  L TL+ + RR  +F  +F
Sbjct: 120 QYRDVLNRASQAYGVPVETIVAVWGVESNYGDISGKYPLLQALGTLSCEGRRQSYFRGEF 179

Query: 173 FYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIAS 231
           F  + ++++G +      G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS
Sbjct: 180 FATMRILQRGDLHEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSVPDALAS 239

Query: 232 AAKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
            A FL + GW     +                 +N   L  W  S             ID
Sbjct: 240 TANFLKQAGWQTGMPWGFEVKIPQGMSVSGESRRNKKPLSTWEQSGI---------TRID 290

Query: 279 GVPIGKG 285
           G  + +G
Sbjct: 291 GSSLVQG 297



 Score = 47.2 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDG-VPIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 322 KNFDAIYSYNAAESYGLAIAHLSDRLRGTGPFVTAWPT 359


>gi|320322695|gb|EFW78788.1| lytic murein transglycosylase [Pseudomonas syringae pv. glycinea
           str. B076]
          Length = 444

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 67/229 (29%), Positives = 113/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  R +A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDSLTIQPAVSFSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FTRPIWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 46.0 bits (107), Expect = 0.007,   Method: Composition-based stats.
 Identities = 25/147 (17%), Positives = 46/147 (31%), Gaps = 18/147 (12%)

Query: 136 WGLETHFGETMGKTPLL-STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFG 194
             ++                LA+ A+  + + +   Q +    ++  G   S A  +T  
Sbjct: 237 HAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWGFEVVLGSGFDYSLADSSTRK 296

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA-AKFLAKLGWTKCAGYQPGEKN 253
            + ++Q L              G      S I   AS  A  L   G+           N
Sbjct: 297 SLAEWQQL--------------GLKQPDGSAIPVAASQQAALLLPAGYR--GPAFLVLDN 340

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDGV 280
           F  +  +N S +Y   I+ ++    G 
Sbjct: 341 FRAILKYNNSTSYALAISLLSDRFKGA 367


>gi|71734872|ref|YP_276514.1| hypothetical protein PSPPH_4398 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555425|gb|AAZ34636.1| HopAJ2 protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320330520|gb|EFW86499.1| lytic murein transglycosylase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 445

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 67/229 (29%), Positives = 113/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  R +A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDSLTIQPAVSFSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FTRPIWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 45.6 bits (106), Expect = 0.009,   Method: Composition-based stats.
 Identities = 25/148 (16%), Positives = 46/148 (31%), Gaps = 19/148 (12%)

Query: 136 WGLETHFGETMGKTPLL-STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFG 194
             ++                LA+ A+  + + +   Q +    ++  G   S A  +T  
Sbjct: 237 HAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWGFEVVLGSGFDYSLADSSTRK 296

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA--AKFLAKLGWTKCAGYQPGEK 252
            + ++Q L              G      S I   AS   A  L   G+           
Sbjct: 297 SLAEWQQL--------------GLKQPDGSAIPVAASQQQAALLLPAGYR--GPAFLVLD 340

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGV 280
           NF  +  +N S +Y   I+ ++    G 
Sbjct: 341 NFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|209964477|ref|YP_002297392.1| membrane-bound lytic murein transglycosylase B, putative
           [Rhodospirillum centenum SW]
 gi|209957943|gb|ACI98579.1| membrane-bound lytic murein transglycosylase B, putative
           [Rhodospirillum centenum SW]
          Length = 328

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 73/308 (23%), Positives = 131/308 (42%), Gaps = 60/308 (19%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
           Q   +  A  F  W  A R  A  +G+S  T +     ++ +   +  DR+      ++F
Sbjct: 21  QAAPAQAATDFAAWLEALRQDAGAQGISEATLREALTGVQPIPRVLELDRRQPEG-TITF 79

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
             Y++ + +++ + +G  L + +  +L  + ++YGV P  ++ALWG+ET FG   G   +
Sbjct: 80  ARYIERVVTAQRVRRGRGLYRQHRAVLEEVGRKYGVQPRFIVALWGIETSFGSNQGGFKV 139

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
           +  LATLAYD RR+ +F ++   AL ++ +  I +  + G+  G +GQ QF+P + ++YA
Sbjct: 140 IDALATLAYDGRRSAYFRKELINALRILDEDHIGADRMLGSWAGAMGQSQFMPSSFLRYA 199

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA------------------------- 245
           +D D DGK D+  +  D  ASAA +L+ +GW                             
Sbjct: 200 VDFDRDGKRDIWGTLPDVFASAANYLSTVGWNPDRTWGREVRIPKHFKESHAGLQTRKTL 259

Query: 246 -GYQPG--------------------------------EKNFAILKHWNASLNYNKTIAY 272
             +Q                                    N+  +  WN S  +   +  
Sbjct: 260 RDWQAMGVRQVDGGPLPVVALEASLVLPDGPKGRAFLVYDNYRTIMDWNRSTYFATAVGL 319

Query: 273 IAAHIDGV 280
           ++  I G 
Sbjct: 320 LSDRIGGA 327


>gi|330895578|gb|EGH27886.1| hypothetical protein PSYJA_02194 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 445

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDNLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.9 bits (104), Expect = 0.015,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|239814037|ref|YP_002942947.1| lytic murein transglycosylase [Variovorax paradoxus S110]
 gi|239800614|gb|ACS17681.1| lytic murein transglycosylase [Variovorax paradoxus S110]
          Length = 438

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 79/307 (25%), Positives = 123/307 (40%), Gaps = 59/307 (19%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
              RF +W +  RA A   G+   T +  F  +++L   I  DR        +  DYLD 
Sbjct: 65  EQQRFAKWVADFRATARASGIREATLQSAFDQVQFLPRVIELDRAQPE-FTRTVWDYLDN 123

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             S + IA G    +            YGVP  +++A+WG+E+++G   G TP++  LAT
Sbjct: 124 TVSPQRIATGQDKLQQVRAEADAAAARYGVPATVVVAIWGMESNYGGNYGSTPVIDALAT 183

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           L ++ RR  +   +   AL ++  G I+   + G+  G +GQ QFLP N + YA+DAD D
Sbjct: 184 LGFEGRREDWARRELLAALKILDSGDIARDRMIGSWAGAMGQTQFLPSNFLAYAVDADGD 243

Query: 217 GKIDLVKSNIDAIASAAKFLAKLG------W--------------------TKCAGYQPG 250
           G+ D+  S  D +AS A FL++ G      W                       A +   
Sbjct: 244 GRRDIWGSMPDVVASTANFLSRSGWQAGMPWGVEIKLPAGFDYGRADMAVRQPSAQWAAE 303

Query: 251 E-------------------------------KNFAILKHWNASLNYNKTIAYIAAHIDG 279
                                            NF  +  +N S NY   +  +A  + G
Sbjct: 304 GITSMDGQPLPEFADGSVLLPAGAQGPAFLVGPNFRAVLRYNNSTNYALAVGLLAQRLGG 363

Query: 280 VPIGKGY 286
            P  +  
Sbjct: 364 GPDVQAP 370


>gi|28871932|ref|NP_794551.1| HopAJ2 protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28855185|gb|AAO58246.1| HopAJ2 protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|331014747|gb|EGH94803.1| HopAJ2 protein [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 445

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDTLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGSQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.5 bits (103), Expect = 0.016,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|85712694|ref|ZP_01043740.1| Membrane-bound lytic murein transglycosylase [Idiomarina baltica
           OS145]
 gi|85693544|gb|EAQ31496.1| Membrane-bound lytic murein transglycosylase [Idiomarina baltica
           OS145]
          Length = 343

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 75/251 (29%), Positives = 120/251 (47%), Gaps = 8/251 (3%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSD------TADRFGEWKSAARARAVREGM 58
           K L +S L ++        T P  A+     S       T  +F  +    R+ A+ +G 
Sbjct: 2   KKLTLSTLALIVSASTVGFTGPVNASQSEQSSMSEQSESTEQKFQTYVDKLRSEALEQGY 61

Query: 59  SPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLL 118
           +  T    FA ++Y    +  D        ++   YL          + +   + +  LL
Sbjct: 62  TKDTLDRAFAKVKYYQRAVELDNNQPE-FKLTLDTYLPRAVPDWKAQKALEKYQEHKALL 120

Query: 119 INLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDL 178
             + K+YGV P  ++ALWG+ET+FG   G   ++S L TLA+D RR  FF +Q + AL +
Sbjct: 121 DEIGKKYGVQPRFIVALWGIETNFGSYTGGFDVVSALTTLAFDGRREAFFKKQLWQALTI 180

Query: 179 VKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLA 237
           ++ G I    + G+  G +GQ QF+P + + YA+D D DGK D+  S  D  ASAA +L+
Sbjct: 181 IQDGHIDPEQMKGSWAGAMGQTQFMPSSFMSYAVDYDGDGKKDIWNSYGDVFASAANYLS 240

Query: 238 KLGWTKCAGYQ 248
            +GW     + 
Sbjct: 241 SVGWRDDVTWG 251



 Score = 39.8 bits (91), Expect = 0.40,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 12/29 (41%)

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHID 278
              N+  L  WN S  +   + Y++  I 
Sbjct: 312 AYANYDALMRWNRSHYFVAAVGYLSDRIR 340


>gi|302185154|ref|ZP_07261827.1| lytic murein transglycosylase [Pseudomonas syringae pv. syringae
           642]
          Length = 445

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDNLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.9 bits (104), Expect = 0.015,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|259418047|ref|ZP_05741966.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
 gi|259346953|gb|EEW58767.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
          Length = 455

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 71/228 (31%), Positives = 112/228 (49%), Gaps = 3/228 (1%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
            T  +KA      +  +  F  W    + RA  +G+S  T +  F  + Y  + I RDR 
Sbjct: 68  ATAAEKALVTAGETSGSAGFPAWIKEFQVRAQAQGISASTLRRAFEGVTYDPSVIKRDRN 127

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                  +  +YLD  +S   ++ G    + +   L  ++K YGV   I++A+WGLE+ +
Sbjct: 128 QSE-FSKTIWEYLDSAASDSRVSNGNKALRDHLAKLQQIEKHYGVDKEIVVAVWGLESSY 186

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQF 201
           G   G   ++ +LATLAYD RR  FF +Q   AL +++ G +      G+  G +G  QF
Sbjct: 187 GTFRGDMDIIRSLATLAYDGRRGAFFEQQLIAALKILQAGDVDPRSMTGSWAGAMGHTQF 246

Query: 202 LPVNVVKYAIDADEDGKIDLVKS-NIDAIASAAKFLAKLGWTKCAGYQ 248
           +P + + YA+D   DGK D+      DA+AS A +L K GW     + 
Sbjct: 247 MPTSYLDYAVDFTGDGKRDIWSDTPTDALASTAAYLKKFGWVTGQPWG 294


>gi|84502809|ref|ZP_01000922.1| Membrane bound lytic murein transglycosylase B [Oceanicola
           batsensis HTCC2597]
 gi|84388792|gb|EAQ01662.1| Membrane bound lytic murein transglycosylase B [Oceanicola
           batsensis HTCC2597]
          Length = 467

 Score =  199 bits (506), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 70/232 (30%), Positives = 113/232 (48%), Gaps = 3/232 (1%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
             +      + + I       F  W  A R+RA+ +G+   T    FA + YL   I  D
Sbjct: 78  AVLVTAAPDSAETIQEANPAGFTAWIGAFRSRALAQGIDAATFDRTFARVRYLPDVIRLD 137

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           RK       +  +YL    S   +  G    +A    L  ++  YGV   ++ A+WG+ET
Sbjct: 138 RKQSE-FTKTTGEYLASAVSDTRVETGREKAQAQGATLRAIEARYGVDRNVVAAVWGMET 196

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQF 199
           ++G   G+T + S LATLAYD RR  FF +Q   AL +++ G  +  + +G+  G +G  
Sbjct: 197 NYGGYRGRTHIPSALATLAYDGRRGAFFEKQLIAALRILQNGDTTPENMVGSWAGAMGHT 256

Query: 200 QFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           QF+P +   YA+D   DG+ D+      DA+AS A +L+++GW +   +   
Sbjct: 257 QFMPTSYAAYAVDFTGDGRRDIWAGDPTDALASTAAYLSRMGWQRGMPWGAE 308



 Score = 55.3 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 37/253 (14%), Positives = 73/253 (28%), Gaps = 36/253 (14%)

Query: 47  SAARARAVREGMSPKTAKHL---------FADLEYLDT---TIARDRKMVTSPPVSFKDY 94
           +  RA   R G+       +         +    ++ +   T+A D +            
Sbjct: 172 ATLRAIEARYGVDRNVVAAVWGMETNYGGYRGRTHIPSALATLAYDGRRGAFFEKQLIAA 231

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L  L + +        +         +     +P                 +        
Sbjct: 232 LRILQNGDTTP-----ENMVGSWAGAMGHTQFMPTSYAAYAVDFTGDGRRDIWAGDPTDA 286

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           LA+ A    R  +     + A   +  G   +HA G         + LP +  +  +   
Sbjct: 287 LASTAAYLSRMGWQRGMPWGAEVTLPAGFDFTHASGP--------KKLPSDWARLGVRPA 338

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
             G      +  D     A+ L   G  +   +    KNF ++K +N S  Y   + ++ 
Sbjct: 339 AGG------TLAD--HGPARLLLPAG-ARGVAFLV-FKNFDVIKRYNNSDAYALGVGHLG 388

Query: 275 AHIDGV-PIGKGY 286
             I G  P+  G+
Sbjct: 389 DRIGGAGPLRGGW 401


>gi|114047835|ref|YP_738385.1| lytic murein transglycosylase [Shewanella sp. MR-7]
 gi|113889277|gb|ABI43328.1| lytic murein transglycosylase [Shewanella sp. MR-7]
          Length = 424

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 93/354 (26%), Positives = 136/354 (38%), Gaps = 75/354 (21%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTAD---------------RFGEWKSAA 49
            YL  S+   V      +       +   I    A                 F    +  
Sbjct: 2   SYLAASIAACVSLSACSSAPTSGGNSQTAIAETQAAVQEMQLSDTIAAHAEAFPTCVANL 61

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           + RA  EG+S  T K   A L+++   I  D+        +F +Y    ++   + +G  
Sbjct: 62  QERARSEGLSEATIKDTVASLQFVPKVIELDQAQPE-FSQTFNNYFTKRATDWRVNEGRR 120

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L K +  LL  L +EYGVPP  +++ WGLET++G   GK  +L +LATLA + RR+ +FT
Sbjct: 121 LLKKHRALLDKLAQEYGVPPQYILSFWGLETNYGSYKGKMSVLDSLATLACEPRRSGYFT 180

Query: 170 EQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            +   AL L +K G      +G+  G +G  QF+P    KYAID D DGK DL  S  DA
Sbjct: 181 TELMQALKLKEKYGFDKRTMVGSWAGAMGHTQFMPSAYAKYAIDGDGDGKADLWNSTEDA 240

Query: 229 IASAAKFLAKLGWTKCAGYQPG---EKNFA------------------------------ 255
           + SAA FL  LGW +   +       +NF                               
Sbjct: 241 LTSAANFLQHLGWQRNERWGREVILPRNFNYENLGAKQAQPLSQWAAQSVVQSNGLPLPA 300

Query: 256 ----------------ILKHW---------NASLNYNKTIAYIAAHIDGVPIGK 284
                               +         N S  Y  T+ ++A  I+G    K
Sbjct: 301 IDMKAALYLPSGHTGPAFLGYENFNVIMRWNRSEFYAITVGHLADRINGGEPLK 354


>gi|254437168|ref|ZP_05050662.1| lytic murein transglycosylase subfamily [Octadecabacter antarcticus
           307]
 gi|198252614|gb|EDY76928.1| lytic murein transglycosylase subfamily [Octadecabacter antarcticus
           307]
          Length = 421

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 75/256 (29%), Positives = 117/256 (45%), Gaps = 5/256 (1%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTAD--RFGEWKSAARARAVREGM 58
           M   + LL   +       A  + Q        I         F  W    R RA R+G+
Sbjct: 10  MLNFRVLLAGAICAAGSGFAGPIPQDGPVHISPITQVQTANQGFNAWIFGFRNRATRQGI 69

Query: 59  SPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLL 118
              T    F  + Y  T I RDR        S  DYLD   S   +  G      N +LL
Sbjct: 70  LEATFDAAFDGITYNTTVIDRDRNQSE-FTKSLWDYLDTAVSDARVRNGRRALADNMQLL 128

Query: 119 INLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDL 178
             +++ +GV   +++A+WGLE+ +G   G T ++  +ATLAYD RR  FF +Q   AL +
Sbjct: 129 NRIEQTFGVDKEVVVAIWGLESAYGAVRGSTNVIGAMATLAYDGRRGAFFEQQLIAALQI 188

Query: 179 VKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFL 236
           ++ G  +  +  G+  G +G  QF+P + ++YA+D + DG+ D+      DA+AS A +L
Sbjct: 189 LQAGDTAPRNMTGSWAGAMGHTQFMPTSFLEYAVDGNGDGRRDIWADDPTDALASTANYL 248

Query: 237 AKLGWTKCAGYQPGEK 252
              GW +   +    +
Sbjct: 249 RSFGWVQGQPWGIEVQ 264



 Score = 45.6 bits (106), Expect = 0.008,   Method: Composition-based stats.
 Identities = 6/29 (20%), Positives = 14/29 (48%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF +++ +N +  Y   +  ++  I G 
Sbjct: 321 PNFEVIERYNTADAYVIGVGILSDRIAGG 349


>gi|293611414|ref|ZP_06693710.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826286|gb|EFF84655.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 430

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 77/288 (26%), Positives = 130/288 (45%), Gaps = 27/288 (9%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L++    ++ + T P   +  +  ++    F    +  R++A+  G+S  T      +L 
Sbjct: 22  LVINGSTISSSATVPVVTSEDYTPNN---NFQSCLANLRSQAISAGVSGTTYDRYTQNLT 78

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
              + I +             DYL GL   E +  G      +  +L    + YGVPP  
Sbjct: 79  PDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVELGKQKLAQHRDVLNRASQTYGVPPET 137

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LG 190
           ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++     G
Sbjct: 138 IVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATVRILQRGDLTEDQLKG 197

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY--- 247
           +  G  G  QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW     +   
Sbjct: 198 SWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGWQTGMPWGFE 257

Query: 248 ----------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
                       G ++   L  W+      + +      IDG P+ +G
Sbjct: 258 VKVPQGMSIEGEGRRSKKALSSWS-----ARGV----TRIDGSPLVQG 296



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 321 KNFDAIYSYNAAESYGLAIAHLSDRLKGAGPFVASWPT 358


>gi|83645387|ref|YP_433822.1| membrane-bound lytic murein transglycosylase B [Hahella chejuensis
           KCTC 2396]
 gi|83633430|gb|ABC29397.1| Membrane-bound lytic murein transglycosylase B [Hahella chejuensis
           KCTC 2396]
          Length = 404

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 86/303 (28%), Positives = 128/303 (42%), Gaps = 60/303 (19%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
                F E  +  + +A +EG+S K        ++  +  I  D K       +F +YL+
Sbjct: 25  TAHADFAECVAGLQEKAKQEGISEKIVDEALGQVKLSERVIELDGKQPE-FIDTFTNYLN 83

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
              + E + +G  +   ++ LL  + KE GVP   L+A WGLET++G   GK P+L +LA
Sbjct: 84  RRVTDERVNKGREMLAKHAPLLDQIAKESGVPAQYLVAFWGLETNYGGYTGKMPILDSLA 143

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADE 215
           TLA D RR+ +FT +   AL +++KG ++   + G+  G +G FQF+P   ++YA D D 
Sbjct: 144 TLACDPRRSGYFTGELMAALKIIEKGDVTVDKMLGSWAGAMGNFQFMPSVYLQYATDRDG 203

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK---NF----------AILKHW-- 260
           DGK DL  S  DA ASA  FL  LGW     +    K   NF            L  W  
Sbjct: 204 DGKRDLWGSLPDAAASAGLFLNGLGWQNGFRWGREVKLPENFAYGEAGLKRSKTLSEWRE 263

Query: 261 -------------------------------------------NASLNYNKTIAYIAAHI 277
                                                      N S +Y   + ++A  I
Sbjct: 264 LGVLDADGREMPNLDLQAALIIPSGHLGPKFLVYDNFKVIMRWNRSESYAIAVGHLADRI 323

Query: 278 DGV 280
            G 
Sbjct: 324 AGA 326


>gi|299772105|ref|YP_003734131.1| lytic murein transglycosylase family protein [Acinetobacter sp.
           DR1]
 gi|298702193|gb|ADI92758.1| lytic murein transglycosylase family protein [Acinetobacter sp.
           DR1]
          Length = 430

 Score =  199 bits (505), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 78/309 (25%), Positives = 130/309 (42%), Gaps = 33/309 (10%)

Query: 3   FKKYLLISLLMMVYPMLAQA---------VTQPKKATTQFICSDTADRFGEWKSAARARA 53
            +++  I   + +    AQA          +               + F    +  R++A
Sbjct: 1   MRRFSCIVGSVFLAMTQAQAELVINGSTISSNATVPVVTSEDYTPNNNFQSCLANLRSQA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  T      +L    + I +             DYL GL   E +  G      
Sbjct: 61  IAAGVSGATYDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVELGKQKLAQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L    + YGVPP  ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF
Sbjct: 120 HRDVLNRASQTYGVPPETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFF 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS 
Sbjct: 180 ATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALAST 239

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           A FL K GW     +               G ++   L  W+      + +      IDG
Sbjct: 240 ANFLNKAGWQTGMPWGFEVKVPQGMSIDGEGRRSKKALSSWS-----ARGV----TRIDG 290

Query: 280 VPIGKGYDT 288
            P+ +G  +
Sbjct: 291 SPLVQGPLS 299



 Score = 48.3 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 321 KNFDAIYSYNAAESYGLAIAHLSDRLKGARPFATSWPT 358


>gi|330873578|gb|EGH07727.1| HopAJ2 protein [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330963473|gb|EGH63733.1| HopAJ2 protein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 445

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDTLTIQPAVSFSEWQAGFRAQALKAGIRADIFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGSQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.5 bits (103), Expect = 0.016,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|157644758|gb|ABV59087.1| HopAJ2 protein [Pseudomonas syringae pv. averrhoi]
          Length = 445

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 67/229 (29%), Positives = 113/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  R +A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDSLTIQPAVSFSEWQAGFRIQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FTRPIWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.5 bits (103), Expect = 0.016,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|113970604|ref|YP_734397.1| lytic murein transglycosylase [Shewanella sp. MR-4]
 gi|113885288|gb|ABI39340.1| lytic murein transglycosylase [Shewanella sp. MR-4]
          Length = 424

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 94/354 (26%), Positives = 138/354 (38%), Gaps = 75/354 (21%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTAD---------------RFGEWKSAA 49
            YL  S+   V      +       +   I    A                 F    +  
Sbjct: 2   SYLAASIAACVSLSACSSAPTSSGNSQTAIAETQAAVQEMQLSDTIAAHAEAFPTCVANL 61

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           + RA  EG+S  T K   A L+++   I  D+        +F +Y    ++   + +G  
Sbjct: 62  QERARSEGLSEATIKDTVASLQFVPKVIELDQAQPE-FSQTFNNYFTKRATDWRVNEGRR 120

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L K +  LL  L +EYGVPP  +++ WGLET++G   GK  +L +LATLA + RR+ +FT
Sbjct: 121 LLKKHRALLDKLAQEYGVPPQYILSFWGLETNYGSYKGKMSVLDSLATLACEPRRSGYFT 180

Query: 170 EQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            +   AL L +K G   S  +G+  G +G  QF+P    KYAID D DGK DL  S  DA
Sbjct: 181 TELMQALKLKEKYGFDKSTMVGSWAGAMGHTQFMPSAYAKYAIDGDGDGKADLWNSTEDA 240

Query: 229 IASAAKFLAKLGWTKCAGYQPG---EKNFA------------------------------ 255
           + SAA FL  LGW +   +       +NF+                              
Sbjct: 241 LTSAANFLQHLGWQRNERWGREVILPRNFSYENLGAKQAQPLSQWAAQSLVQSNGQPLPA 300

Query: 256 ----------------ILKHW---------NASLNYNKTIAYIAAHIDGVPIGK 284
                               +         N S  Y  T+ ++A  I+G    K
Sbjct: 301 IDMKAALYLPSGHTGPAFLGYENFNVIMRWNRSEFYAITVGHLADRINGGEPLK 354


>gi|149201097|ref|ZP_01878072.1| Lytic murein transglycosylase [Roseovarius sp. TM1035]
 gi|149145430|gb|EDM33456.1| Lytic murein transglycosylase [Roseovarius sp. TM1035]
          Length = 427

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 70/226 (30%), Positives = 116/226 (51%), Gaps = 3/226 (1%)

Query: 25  QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
               + T  +  +   RF  W +  R RA+ +G+S +     F  + +    +++DR   
Sbjct: 42  PADVSETAIVPVNANPRFDTWVAGFRGRALSQGISGQVFDRAFRGVTFNPEIVSKDRNQS 101

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
                   DYLD   S   +  G    + + R L  ++  YGV   ++ A+WG+E+ +GE
Sbjct: 102 E-FKREIWDYLDSAVSPIRVNNGQEALRKHRRALERIEAHYGVEKEVVAAVWGMESTYGE 160

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLP 203
            +G  PL+ +LATLAYD RR  FF +Q   AL +++ G ++  +  G+  G +G  QF+P
Sbjct: 161 RLGDLPLIQSLATLAYDGRRGAFFEKQLIAALQILQSGDVTPENMKGSWAGAMGHTQFMP 220

Query: 204 VNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
            + + YA+D   DGK D+   +  DA+AS A +L + GWTK   + 
Sbjct: 221 TSYLAYAVDFTGDGKRDIWSDNPTDALASTAAYLKRFGWTKGQPWG 266



 Score = 55.3 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 10/34 (29%), Positives = 18/34 (52%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
            NF ++K +N S  Y   + +++  I G P  +G
Sbjct: 325 DNFGVIKRYNNSDAYAMGVGHLSDRIGGGPEIRG 358


>gi|159044413|ref|YP_001533207.1| putative membrane-bound lytic murein transglycosylase
           [Dinoroseobacter shibae DFL 12]
 gi|157912173|gb|ABV93606.1| putative membrane-bound lytic murein transglycosylase
           [Dinoroseobacter shibae DFL 12]
          Length = 370

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 82/274 (29%), Positives = 130/274 (47%), Gaps = 21/274 (7%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
           P       +       + +W +  RARA  +  S    +  FA   YL   +ARDR  V 
Sbjct: 27  PAAGPADDLRPVPNAGYADWVARYRARAAAD-FSDDLLRRAFAGTGYLPGVVARDRNQVE 85

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
               + +DYL    S E +A+G A        L  ++  YGVPP ++ A+WGLE+ +G+ 
Sbjct: 86  -FRRTLEDYLAIAVSDERVARGRAAVAQYRPTLAAIEDRYGVPPELVTAIWGLESFYGDR 144

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPV 204
            G  P++S  +TLAYD RR  FF  Q   AL +++ G I +   +G+  G +G  QF+P 
Sbjct: 145 KGDIPVVSATSTLAYDGRRGAFFEGQLTAALRILRAGDIPADRLVGSWAGAMGHTQFIPT 204

Query: 205 NVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQPGEK----------- 252
           +   +A+D   DG+ D+      DA+ASAA +L + GWT+   +   +            
Sbjct: 205 SFEAFAVDFTGDGRRDIWSDDPTDALASAAAYLDRNGWTRGLRWGAEDPEGSLQPQPGGP 264

Query: 253 ------NFAILKHWNASLNYNKTIAYIAAHIDGV 280
                 NF ++K +N S  Y   + +++  I G 
Sbjct: 265 RFATTSNFNVIKRYNNSDAYAIGVGHLSERIAGG 298


>gi|294141374|ref|YP_003557352.1| membrane-bound lytic murein transglycolase [Shewanella violacea
           DSS12]
 gi|293327843|dbj|BAJ02574.1| membrane-bound lytic murein transglycolase [Shewanella violacea
           DSS12]
          Length = 393

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 94/315 (29%), Positives = 134/315 (42%), Gaps = 58/315 (18%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
           +     A++ +     AD F       +  A  EG+S  T  +  A ++Y+   I  D K
Sbjct: 7   LASVILASSLWTLPAVADDFASCVVNLKQTAQHEGLSQDTIDNTLAKVKYVARVIELDNK 66

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                  +F +Y     ++  I +G  L K N  LL  L+ +YGVPP  LMA WGLET+F
Sbjct: 67  QPE-FSQTFDNYFSKRVTAWRIQEGRRLLKENKTLLTKLQDKYGVPPQYLMAFWGLETNF 125

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQF 201
           G   GK P+L +LATLA D RR+K+FT +   AL L +K    +  + G+  G +G  QF
Sbjct: 126 GSYKGKMPVLDSLATLACDPRRSKYFTGELMKALKLKEKYNFDASMMVGSWAGAMGHTQF 185

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG----------- 250
           +P     YA+D D DGK DL  S  DA++SAA FL KLGW +   +              
Sbjct: 186 MPSAYTHYAVDGDGDGKADLWNSTTDALSSAANFLNKLGWQRDERWGREVKLPQTFSYEY 245

Query: 251 ---------------------------------------EKNFAILKHWN------ASLN 265
                                                     F   K++N       S  
Sbjct: 246 LGKKQALTDWAGLGVLQSNGQALSIADMSATLYLPAGHTGPAFLGYKNFNVIMRWNRSEF 305

Query: 266 YNKTIAYIAAHIDGV 280
           Y  T+ ++A  I+G 
Sbjct: 306 YAITVGHLADRINGG 320


>gi|46202634|ref|ZP_00052889.2| COG2951: Membrane-bound lytic murein transglycosylase B
           [Magnetospirillum magnetotacticum MS-1]
          Length = 324

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 82/253 (32%), Positives = 137/253 (54%), Gaps = 6/253 (2%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           +     FG + +  RA A+ +G+ P++     A++ ++D  I  DRK      +SF +YL
Sbjct: 22  ATAESGFGTFLAGVRAEALEKGLKPESLDAALANVVHIDRVIELDRKQPE-FTLSFNEYL 80

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             + S   + +G      N  LL  +++ YGV P  ++ALWG+ET+FG+  G   ++S+L
Sbjct: 81  GRIVSQSRVEEGRRKLAENKALLTEIERRYGVQPRFVVALWGIETNFGKNTGGMSVVSSL 140

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLAYD RR+K+F  +   AL ++ +G I+  + +G+  G +GQ QF+P   +K+A+D D
Sbjct: 141 ATLAYDGRRSKYFRTELMNALTILDQGHITPANMIGSWAGAMGQCQFMPSTFLKFAVDWD 200

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DGK ++  +  DA+ASAA +L+  GW     +    K  +         +  KT+   A
Sbjct: 201 GDGKRNIWTNRSDALASAANYLSSEGWKGDQTWGRAVKLPSDFPRSALGTDTRKTVTEWA 260

Query: 275 A----HIDGVPIG 283
           A     +DG P+ 
Sbjct: 261 ALGVKAVDGKPLP 273



 Score = 44.1 bits (102), Expect = 0.024,   Method: Composition-based stats.
 Identities = 8/29 (27%), Positives = 12/29 (41%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDG 279
             NF  +  WN S  +     ++A  I G
Sbjct: 295 YDNFRTIMKWNRSTFFALAAGHLADRIGG 323


>gi|213966847|ref|ZP_03394998.1| HopAJ2 protein [Pseudomonas syringae pv. tomato T1]
 gi|301381978|ref|ZP_07230396.1| lytic murein transglycosylase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058762|ref|ZP_07250303.1| lytic murein transglycosylase [Pseudomonas syringae pv. tomato K40]
 gi|302135138|ref|ZP_07261128.1| lytic murein transglycosylase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213928697|gb|EEB62241.1| HopAJ2 protein [Pseudomonas syringae pv. tomato T1]
          Length = 445

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 69/229 (30%), Positives = 115/229 (50%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FAD+    + +  D
Sbjct: 49  AVAPTPALVVDDTLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFADVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGSQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276



 Score = 44.5 bits (103), Expect = 0.017,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|163744973|ref|ZP_02152333.1| peptidoglycan binding domain protein [Oceanibulbus indolifex
           HEL-45]
 gi|161381791|gb|EDQ06200.1| peptidoglycan binding domain protein [Oceanibulbus indolifex
           HEL-45]
          Length = 432

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 70/235 (29%), Positives = 111/235 (47%), Gaps = 3/235 (1%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
            P+     + P + T     +        W    R RA+++G+ P         + Y   
Sbjct: 36  APVAVLVASTPAEQTAPSEATGDDAGLRVWVKEFRPRALQQGIDPDIFDRALDTVSYDPE 95

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            I RDR        +  DYLD  +S   +  G        R L +++ +YGV   I+ A+
Sbjct: 96  VIRRDRNQSE-FTKTIWDYLDTATSELRVQNGEKALAQWQRTLEDIEAKYGVEKEIVTAI 154

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFG 194
           WGLE+ +G   G   +LS+L TLAYD RRA+FF  +   AL +++ G   +    G+  G
Sbjct: 155 WGLESAYGSFRGGDSVLSSLTTLAYDARRAEFFEGELLDALRILQAGDTDAEQLRGSWAG 214

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
            +G  QF+P +   +A+D D DG+ D+   +  DA+AS A +L   GWT+   + 
Sbjct: 215 AMGHTQFMPSSFHAHAVDWDGDGRRDIWGDNPGDALASTAAYLKHFGWTEGQPWG 269



 Score = 49.9 bits (117), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 15/29 (51%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF +++ +N +  Y   + ++A  I G 
Sbjct: 330 PNFEVIERYNTADAYVIGVGHLADRIGGA 358


>gi|260432274|ref|ZP_05786245.1| peptidoglycan binding domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416102|gb|EEX09361.1| peptidoglycan binding domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 432

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 84/334 (25%), Positives = 138/334 (41%), Gaps = 61/334 (18%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           +    + A     P+ A      +    RF  W  A + RAV +G+S  T     + +  
Sbjct: 35  LASADLTASLRPVPRPAHGAHRVAAVNPRFEVWLGAFQRRAVSQGISQTTLDRALSGVTQ 94

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
               I RDR           +YLD   S + IA G    + + R+L  ++  YGV   ++
Sbjct: 95  DPDIIRRDRNQAE-FSKPIWEYLDSAVSDQRIADGRKALERHRRVLDRIEARYGVEKEVV 153

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGA 191
           +A+WGLET FG   G +P + +LATLA+D RRA+FF  Q   AL +++ G +      G+
Sbjct: 154 VAVWGLETSFGSFRGSSPTIRSLATLAFDGRRAEFFETQLLAALQILQAGDVRPEAMTGS 213

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWT-------- 242
             G +G  QF+P + +++A+D D DG+ D+      DA+AS A +LA+ GWT        
Sbjct: 214 WAGAMGHTQFMPTSYLEHAVDFDGDGRRDIWSDDPTDALASTAAYLARFGWTKGQPWGVE 273

Query: 243 ----KCAGYQPGEK---------------------------------------------N 253
                   Y    +                                             N
Sbjct: 274 VRLPAGFDYAQASRDITRLPSGWAALGVRAADGRAIADHGPASILLPAGSGGVALMIFGN 333

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDG-VPIGKGY 286
           F++++ +N +  Y   I +++  + G  P    +
Sbjct: 334 FSVIERYNGADAYVIGIGHLSDRLAGQGPFRANW 367


>gi|300723135|ref|YP_003712433.1| putative lipoprotein [Xenorhabdus nematophila ATCC 19061]
 gi|297629650|emb|CBJ90253.1| putative lipoprotein precursor [Xenorhabdus nematophila ATCC 19061]
          Length = 361

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 74/265 (27%), Positives = 123/265 (46%), Gaps = 22/265 (8%)

Query: 5   KYLLISLLMMVYPMLAQAV---------TQPKKATTQ----------FICSDTADRFGEW 45
             L+  + ++   +LA                 A  Q           +      +F  +
Sbjct: 1   MKLITGVTLLAATLLAGCSMSSGKHLSEPLASAAQAQIDTKTLEALFPLNVREPAQFPAY 60

Query: 46  KSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIA 105
            +  + +A  +G S KT +  F+++ ++   I  DR        +  DYL  +  +  I 
Sbjct: 61  VALLKQQAREQGFSEKTVERAFSNIHFIPRVIKADRNQPEK-KATLDDYLSRVLPAWKIE 119

Query: 106 QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRA 165
           QG+   K +   L  + ++YGVP   ++ALWGLE+ FG+  GK  ++S LATLA++ RR 
Sbjct: 120 QGVTQYKNHLPQLEKISRKYGVPKAYIVALWGLESGFGKIQGKEDVISALATLAFEGRRE 179

Query: 166 KFFTEQFFYALDLVKKGVISSHA--LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
            FF +Q   AL++++   I       G+  G +GQ QF+P + + Y  D D DG+ID+  
Sbjct: 180 VFFIKQLLAALEIMENQYIGEGQTLNGSWAGAMGQSQFMPTSYLTYGADGDGDGRIDIWN 239

Query: 224 SNIDAIASAAKFLAKLGWTKCAGYQ 248
           +  D  AS A +LAK GW     + 
Sbjct: 240 NKEDVFASTANYLAKEGWQPGLPWG 264


>gi|146293412|ref|YP_001183836.1| lytic murein transglycosylase [Shewanella putrefaciens CN-32]
 gi|145565102|gb|ABP76037.1| lytic murein transglycosylase [Shewanella putrefaciens CN-32]
          Length = 439

 Score =  198 bits (504), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 88/326 (26%), Positives = 135/326 (41%), Gaps = 60/326 (18%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
            +A                  AD F    +  +ARA  EG+S +T  +  A L+++   I
Sbjct: 45  AIADPNAALATVDINATVQLNADAFASCLTTLQARARSEGLSEETINNTVAYLQFVPRVI 104

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
             D++       +F +Y    ++   + +G  L + +  LL  L  +YGVPP  +++ WG
Sbjct: 105 ELDQQQPE-FSQTFANYFTKRATDWRVNEGRRLLQKHRALLDKLSLQYGVPPQYILSFWG 163

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEI 196
           LET++G   GK  +L +LATLA + RR+ +FT +   AL L +K     + + G+  G +
Sbjct: 164 LETNYGSYKGKMAVLDSLATLACEPRRSSYFTTELMQALKLKEKYQFDKNTMVGSWAGAM 223

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG---EKN 253
           G  QF+P    KYAID D DGK+DL  S  DA+ SAA FL  LGW +   +       KN
Sbjct: 224 GHTQFMPSAYAKYAIDGDGDGKVDLWNSTADALTSAANFLQNLGWQRNERWGREVLLPKN 283

Query: 254 FA----------------------------------------------ILKHW------- 260
           F+                                                  +       
Sbjct: 284 FSYSHLGAKQTLPLAEWAAQSVTLTNGQPLPQADIQAALYLPAGHTGPAFLGYENFNVIM 343

Query: 261 --NASLNYNKTIAYIAAHIDGVPIGK 284
             N S  Y  T+ ++A  I+G    K
Sbjct: 344 RWNRSEFYAITVGHLADRINGGEPLK 369


>gi|317050819|ref|YP_004111935.1| lytic murein transglycosylase [Desulfurispirillum indicum S5]
 gi|316945903|gb|ADU65379.1| lytic murein transglycosylase [Desulfurispirillum indicum S5]
          Length = 415

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 75/218 (34%), Positives = 115/218 (52%), Gaps = 2/218 (0%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
           Q + + TA  F    S  R +A+  G +  T   + + + +    +  DR        +F
Sbjct: 20  QPVQASTAQDFDACLSHLRTKALDAGHAHDTLNQVLSSVTFNQRIVELDRSQAE-FTETF 78

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
             YLD   S + + +G  L + +  LL  +  EYGV P  ++A WG+ET+FG   GKTP+
Sbjct: 79  LQYLDRRVSVDRVEKGRQLLREHRVLLQRIADEYGVRPEYIIAFWGMETNFGTYFGKTPV 138

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
              + TLA D RR +FFT QFF AL ++++G I    + G+  G +G  QF+P   + YA
Sbjct: 139 FDAVVTLACDGRRGEFFTNQFFSALRILEEGHIDMEQMKGSWAGAMGHTQFMPSTFLSYA 198

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +D D +G+ DL  S  DA ASAA +L+ +GW     + 
Sbjct: 199 VDYDGNGRKDLWNSLPDAFASAANYLSAMGWQDGRRWG 236



 Score = 48.3 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 16/29 (55%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDG 279
             NF ++  WN SL+Y   + Y+A  + G
Sbjct: 297 YDNFHLIMRWNRSLHYALAVGYMADRVAG 325


>gi|297183959|gb|ADI20079.1| membrane-bound lytic murein transglycosylase b [uncultured alpha
           proteobacterium EB080_L06A09]
          Length = 411

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 85/340 (25%), Positives = 136/340 (40%), Gaps = 64/340 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+    LL S L++        V        Q I     + F +W S  +  AV  G++ 
Sbjct: 1   MNKSVKLLASCLIL---FSTPLVADDNDNNNQQISVQKENAFKQWVSNFKKDAVSNGITT 57

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T    F +++     I  D K          DYLD  +S + IA G         LL  
Sbjct: 58  TTFDTAFENVQLNSRVIKADNKQAE-FSREIWDYLDTATSPKRIANGKENLSDYLNLLRE 116

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++ +Y V   +++A+WGLE+ +G+ MG   ++  LATLA+D RR KF  +Q   AL +++
Sbjct: 117 IQFKYQVDAEVILAIWGLESSYGKRMGDINIIEALATLAFDGRREKFGKQQLLEALSIIQ 176

Query: 181 KGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK--SNIDAIASAAKFLA 237
           +G I+    +G+  G +G  QF+P +   YA D   DGK ++       DA+AS A +LA
Sbjct: 177 RGDITPDKMMGSWAGAMGHTQFIPTSYQAYAQDFTGDGKRNVWDPLDPSDALASTANYLA 236

Query: 238 KLGWTKCA------------------------------------------GYQPGE---- 251
           + GWT                                              Y  G     
Sbjct: 237 EFGWTNNQPWGIEVNLPENFNYRNADLEVKATPARWSELGLKTITGGKIPNYGEGSVFLP 296

Query: 252 -----------KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                       NF ++K +N + +Y   + +++  I G 
Sbjct: 297 AGAKGPAFIVFNNFFVIKRYNNANSYAMAVGHLSDRILGG 336


>gi|254476983|ref|ZP_05090369.1| lytic murein transglycosylase [Ruegeria sp. R11]
 gi|214031226|gb|EEB72061.1| lytic murein transglycosylase [Ruegeria sp. R11]
          Length = 464

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 73/318 (22%), Positives = 130/318 (40%), Gaps = 61/318 (19%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
              + + ++TA  F  W +A R RA   G+   T     A + +    + RD        
Sbjct: 83  PDGEAVDAETARAFEVWLTAFRGRAQEAGIYRATLDSALAGVRFDPDIVKRDGNQSE-FV 141

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
                YL+   S   +  G A  + ++  L  ++  YGV   ++ A+WG+E+++G   G 
Sbjct: 142 TPIWTYLERAVSDSRVENGRAALRDHADTLARIEATYGVDKEVVAAVWGMESNYGNFRGS 201

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVV 207
             ++ +LATL +D RRA FF  Q   AL +++ G +S+    G+  G +G  QF+P + +
Sbjct: 202 RDIVRSLATLVFDGRRAAFFESQLIAALRILQSGDVSARAMTGSWAGAMGHTQFMPTSYL 261

Query: 208 KYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGW------------------------- 241
           +YA+D   DGK D+      DA+AS A +L + GW                         
Sbjct: 262 EYAVDFTGDGKRDIWSDDPTDALASTAAYLKRFGWVKGQPWGIEVQLPAGFDYAQADRKI 321

Query: 242 -TKCAGYQP-------------------------------GEKNFAILKHWNASLNYNKT 269
                 +Q                                  +NF++++ +NA+  Y   
Sbjct: 322 TKPARDWQRHGVRTVEGGALPDHGEAAVLLPAGAQGAAFLVYRNFSVIERYNAADAYVIG 381

Query: 270 IAYIAAHIDG-VPIGKGY 286
           + +++  + G  PI   +
Sbjct: 382 VGHLSDRLKGRAPIQADW 399


>gi|300021906|ref|YP_003754517.1| lytic murein transglycosylase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523727|gb|ADJ22196.1| lytic murein transglycosylase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 412

 Score =  198 bits (503), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 80/336 (23%), Positives = 139/336 (41%), Gaps = 61/336 (18%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADR--FGEWKSAARARAVREGMSPKTA 63
           +L+ S+  M +  ++ A              +  +   F  W +  R  A+ EG+   T 
Sbjct: 5   FLIFSIATMAFASMSGAAFAEATPPPPANKRNCQNTVPFQRWLADFRREAIAEGIHAGTI 64

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
                 +    + +ARDRK       +F D+   L+++     G +  +    +    ++
Sbjct: 65  DDAIGGMTPDMSVVARDRKQG-FFSQTFIDFYFKLATNGREKMGKSYLQRYKSIFDRAEQ 123

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
           +YGVP  ++   W LE+ FG  MG   ++ +L TLA+DCRR  FF  +   AL ++++G 
Sbjct: 124 QYGVPGAVITGFWALESDFGGGMGNLSVMRSLVTLAWDCRRGDFFRNELKAALKIIERGD 183

Query: 184 ISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           +++  + G+  GE+GQ QFLP +   Y +D D DG++DL++   D I S+A F+A +GW 
Sbjct: 184 LTADQMIGSWAGELGQTQFLPQHYYNYGVDYDGDGRVDLIRDIPDIIGSSANFIASMGWK 243

Query: 243 KCAGY------------------------------------------------QPGEKNF 254
           +   +                                                 P  +N 
Sbjct: 244 RGEPWLEQVRVTKELPWEKADLTVLLPRSQWVAWGVEGVGHRLPSDDLQASLLLPMGRNG 303

Query: 255 AILKHWNA---------SLNYNKTIAYIAAHIDGVP 281
                +N          SL Y  T A++AA + G P
Sbjct: 304 PAFLAYNNFRVYTQWNQSLTYATTAAHLAARMTGAP 339


>gi|262281539|ref|ZP_06059318.1| transglycosylase [Acinetobacter calcoaceticus RUH2202]
 gi|262256998|gb|EEY75737.1| transglycosylase [Acinetobacter calcoaceticus RUH2202]
          Length = 430

 Score =  198 bits (503), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 78/288 (27%), Positives = 129/288 (44%), Gaps = 27/288 (9%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L++    ++ + T P      +  ++    F    +  R++AV  G+S  T      +L 
Sbjct: 22  LVINGSTISSSATVPTVTNENYTPNN---NFQSCLANLRSQAVAAGVSGTTYDRYTQNLT 78

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
              + I +             DYL GL   E +  G         +L    + YGVPP  
Sbjct: 79  PDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVELGKQKLAQYRDVLNRASQTYGVPPET 137

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LG 190
           ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++     G
Sbjct: 138 IVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILQRGDLTEDQLKG 197

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY--- 247
           +  G  G  QF+P    + A+D D DG+ DLV S +DA+AS A FL K GW     +   
Sbjct: 198 SWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTVDALASTANFLNKAGWQAGMPWGFE 257

Query: 248 ----------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
                       G ++   L  W+      + +      IDG P+ +G
Sbjct: 258 VKVPQGMSVDGEGRRSKKALSSWS-----ARGV----TRIDGSPLVQG 296



 Score = 48.3 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 321 KNFDAIYSYNAAESYGLAIAHLSDRLKGARPFATSWPT 358


>gi|84499391|ref|ZP_00997679.1| peptidoglycan-binding protein, putative [Oceanicola batsensis
           HTCC2597]
 gi|84392535|gb|EAQ04746.1| peptidoglycan-binding protein, putative [Oceanicola batsensis
           HTCC2597]
          Length = 379

 Score =  198 bits (503), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 91/313 (29%), Positives = 138/313 (44%), Gaps = 29/313 (9%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFIC---SDTADRFGEWKSAARARAVREG 57
           M  ++  L             A   P +A               +  W +A R RA   G
Sbjct: 1   MIPRRQFLALTGAATLASCGAAPVLPGRAPEAVADDLRPVPNAGWDAWVAAFRPRARSAG 60

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRL 117
           ++  T    F    ++   + RDR    S   S +DYL   +S E +A+G A        
Sbjct: 61  ITSATLDAAFRGAGFIPGVVTRDRSQPES-SYSLEDYLSIAASDERLAKGRAAFARQRDT 119

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L  L+  YGV   I+ A+WGLE+ +GE  G  P++S  +TLA+D RR  FF +Q   AL 
Sbjct: 120 LTALESRYGVDAEIICAIWGLESRYGERRGTVPVISATSTLAFDGRRGAFFEKQLIAALR 179

Query: 178 LVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAKF 235
           +++ G ++    +G+  G +G  QF+P + + YA+D D DG+ D+      DA+ASAA +
Sbjct: 180 ILQSGDVTPARMVGSWAGAMGHTQFIPTSYLAYAVDFDGDGRRDIWSEDPTDALASAAAY 239

Query: 236 LAKLGWTKCAGYQ-----PGEK------------------NFAILKHWNASLNYNKTIAY 272
           LA  GWT+   +      PG                    NF  +K +N S  Y   I +
Sbjct: 240 LANAGWTRGLKWGGETGAPGTPAGTTITPQAGGPSFTVTSNFRAIKRYNNSDLYAIGIGH 299

Query: 273 IAAHIDGVPIGKG 285
           +A  I G    +G
Sbjct: 300 LADRIAGGGPIRG 312


>gi|170726300|ref|YP_001760326.1| lytic murein transglycosylase [Shewanella woodyi ATCC 51908]
 gi|169811647|gb|ACA86231.1| lytic murein transglycosylase [Shewanella woodyi ATCC 51908]
          Length = 395

 Score =  198 bits (502), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 85/301 (28%), Positives = 124/301 (41%), Gaps = 60/301 (19%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           A  F       +  A  +G+S  T ++    ++Y+   I  D+K       +F +Y    
Sbjct: 23  ATDFPSCVVELQKTAKSQGLSADTIENTLGKVKYVARVIELDKKQPE-FSQTFDNYFSKR 81

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            +   + +G  L   N  LL  LK +YGVPP  LMA WGLET+FG   GK P+L +LATL
Sbjct: 82  VTDWRVKEGRRLLAENRELLNQLKDKYGVPPQYLMAFWGLETNFGSYKGKMPVLDSLATL 141

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A D RR+ +FT +   AL L ++    +   +G+  G +G  QF+P     YA+D D DG
Sbjct: 142 ACDPRRSGYFTGELMKALKLKEEYQFEASEMVGSWAGAMGHTQFMPSAYTAYAVDGDGDG 201

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG---EKNFA------------------- 255
           K DL  S  DA+ SAA FL +LGW +   +        NF+                   
Sbjct: 202 KADLWNSRADALTSAANFLQQLGWQRNERWGREVTLPDNFSYEYLGKRHEQALVKWAELG 261

Query: 256 ---------------------------ILKHW---------NASLNYNKTIAYIAAHIDG 279
                                          +         N S  Y   + ++A  I+G
Sbjct: 262 VMKNDGKPISTPDMKAALYLPAGHTGPAFLGYKNFDVIMRWNRSTFYVIAVGHLADRING 321

Query: 280 V 280
            
Sbjct: 322 G 322


>gi|59712309|ref|YP_205085.1| membrane-bound lytic murein transglycosylase B [Vibrio fischeri
           ES114]
 gi|59480410|gb|AAW86197.1| membrane-bound lytic murein transglycosylase B [Vibrio fischeri
           ES114]
          Length = 325

 Score =  198 bits (502), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 70/247 (28%), Positives = 123/247 (49%), Gaps = 14/247 (5%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
            KK LL+ ++ +     A A   P+              F ++    +  A   G+S   
Sbjct: 1   MKKKLLLGIVSLFLATSASASATPE------------GDFQDYIVGLKNEAREIGISEPI 48

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
            +  F ++ + +  +  DR       ++  +Y+        I Q   L K + ++L  + 
Sbjct: 49  LERAFKNVAFKEKAVKSDRNQPEK-KLTLDEYIPRAVPKWKIKQANDLYKKHYKVLNRIG 107

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           +EYGV P  ++ALWG+E++FG+  G   ++  L TLAYD RR  FF +Q   AL ++++G
Sbjct: 108 EEYGVQPRFIVALWGVESNFGKLTGGYNVIEALTTLAYDGRREAFFKKQTMAALTILQQG 167

Query: 183 VISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I+  +  G+  G +GQ QF+P + + YA+D + DGK D+  ++ D  ASAA +L ++GW
Sbjct: 168 HITPENMKGSWAGAMGQCQFMPTSFLSYAVDGNGDGKKDIWNTHADVFASAANYLKQVGW 227

Query: 242 TKCAGYQ 248
                + 
Sbjct: 228 DDTYTWG 234



 Score = 36.8 bits (83), Expect = 3.8,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 298 YNNYQVLMDWNRSHYFALAVSHLADSIK 325


>gi|51245667|ref|YP_065551.1| transglycosylase [Desulfotalea psychrophila LSv54]
 gi|50876704|emb|CAG36544.1| related to transglycosylase [Desulfotalea psychrophila LSv54]
          Length = 406

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 73/328 (22%), Positives = 128/328 (39%), Gaps = 64/328 (19%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAA-RARAVREGMSPKTAKHLFADLEY 72
               +LA  +       + +  +D    F  W     +  A   G+S +T   +F+ +  
Sbjct: 4   FSACLLALFILLCSPLLSTWSHADQ--GFASWVENFYQQEARPVGISRQTFDSVFSRVTA 61

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
            +  + +  K          DYLD   +   +++G  + +  S  L  ++ ++GV   ++
Sbjct: 62  PEPVVLKKAKYQPEFTTEIWDYLDMRLTPLAVSRGQKMARKYSHTLQKIETQFGVSRFVV 121

Query: 133 MALWGLETHFGETMGKTP----LLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSH 187
           +A+W +E+++G  +        + + LATLAY D RRA+F  +Q    L +V+ G +   
Sbjct: 122 LAIWSMESNYGAVLSNKSRLHYVPTALATLAYQDKRRARFARKQLIAVLQMVQAGEVQPQ 181

Query: 188 A-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
             +G+  G +G  QF+P +   YA+  D+ G  D+  S  DA+ASAA  L K GW     
Sbjct: 182 QLVGSWAGAMGHTQFIPSSYRAYAVSLDKRGGSDIWNSVPDALASAANLLHKNGWQTGRT 241

Query: 247 YQ----------------------------------------------PGEKN------- 253
           +                                               PG  N       
Sbjct: 242 WGYEVMSPGNGELYRDKSMALGEWSQKGFRRSAHRQFPHLEERAFLKLPGGGNNPGFLVI 301

Query: 254 --FAILKHWNASLNYNKTIAYIAAHIDG 279
             F++LK +N S  Y   +  +A  I G
Sbjct: 302 KNFSVLKRYNNSDYYALAVGLLADRIAG 329


>gi|330938270|gb|EGH41933.1| hypothetical protein PSYPI_05703 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 337

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDNLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQRGQPWG 276


>gi|146276109|ref|YP_001166268.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554350|gb|ABP68963.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17025]
          Length = 421

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 85/305 (27%), Positives = 122/305 (40%), Gaps = 59/305 (19%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
                 W    R RA+  G+ P+T    F  + Y    +ARDR        +  DYLD  
Sbjct: 48  QAGLEGWIVEFRPRALAAGIRPETLAAAFRGVRYDAEAVARDRNQAE-FNRTLWDYLDSA 106

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S   IA G A    +  LL  ++  YGVP  I++A+WG+ET +G   G  PL+  LATL
Sbjct: 107 VSEVRIANGRAALVRHGALLERIEARYGVPKEIVVAVWGMETSYGTRRGDHPLVGALATL 166

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A+D RRA FF EQ   AL ++  G +      G+  G +G  QF+P + + +A+D   DG
Sbjct: 167 AHDGRRAAFFEEQLIAALKILDTGDVRPEAMTGSWAGAMGHTQFMPTSYLAHAVDFTGDG 226

Query: 218 KIDLVK-SNIDAIASAAKFLAKLGWTK--------------------------------- 243
           + D+      DA+AS A +LA  GW                                   
Sbjct: 227 RRDIWSEDPSDALASTAAYLAGSGWRTGEPWGVEVRLPPGFDFARSGKALRQPVGQWQAL 286

Query: 244 ------CAGYQPGE-----------------KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                  A    GE                  NF  +  +N +  Y   + ++A  + G 
Sbjct: 287 GLRRPDGAPLPAGEAALLLPAGAQGAAFLIYPNFRAISRYNPADAYVIGVGHLADRLKGG 346

Query: 281 PIGKG 285
           P   G
Sbjct: 347 PAFTG 351


>gi|238756995|ref|ZP_04618183.1| Lytic murein transglycosylase [Yersinia aldovae ATCC 35236]
 gi|238704825|gb|EEP97354.1| Lytic murein transglycosylase [Yersinia aldovae ATCC 35236]
          Length = 358

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 72/236 (30%), Positives = 120/236 (50%), Gaps = 2/236 (0%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
             + + +      ATT      +   F  +    +A+A  +G+S  T    FA++ ++D 
Sbjct: 35  SMLSSPSSAGNHTATTLSQQGRSPAEFPAYVDELKAQARAKGISQATLDVAFANIHFVDR 94

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            I  DR  +    V+  DYL  + ++  I QG  + +     L  +   YGVP   ++AL
Sbjct: 95  VIQSDRNQLEK-KVTLDDYLAKVLTATKIEQGKEIYQRYQPQLSQVTARYGVPERYIVAL 153

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFG 194
           WG+E+ FG+  GK  ++S L+TLA++ RR  FFT +   AL ++++G +      G+  G
Sbjct: 154 WGMESGFGKIQGKEDVISALSTLAFEGRRETFFTNELIAALKIIQQGKVDDPQLKGSWAG 213

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
            +GQ QF+P + + Y +D D DGKID+  +  D  AS A +L+  GW    G+   
Sbjct: 214 AMGQSQFMPSSFLTYGVDGDGDGKIDIWNNIDDVFASTANYLSTEGWKPGIGWGQE 269


>gi|256061848|ref|ZP_05451983.1| lytic murein transglycosylase [Brucella neotomae 5K33]
          Length = 241

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 101/225 (44%), Positives = 140/225 (62%), Gaps = 2/225 (0%)

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
           R G+         A+ +Y   TI  DR   +   +SF+ ++    +  II +G A+K+ N
Sbjct: 18  RRGIGKAGIN-ALANTKYAQATINADRNQKS-FKLSFEQFMQKRGADTIIKRGRAMKQQN 75

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + L  N++K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + 
Sbjct: 76  AALFANIEKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYA 135

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           AL L+ +  +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A 
Sbjct: 136 ALKLIDREDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTAN 195

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           FL   GW + AGYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 196 FLVGHGWQRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 240


>gi|119385237|ref|YP_916293.1| lytic murein transglycosylase [Paracoccus denitrificans PD1222]
 gi|119375004|gb|ABL70597.1| lytic murein transglycosylase [Paracoccus denitrificans PD1222]
          Length = 417

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 86/351 (24%), Positives = 139/351 (39%), Gaps = 68/351 (19%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSD----------TADRFGEWKSAAR 50
           M+ +   + +  ++   +    V+      T    +           +   F  W  + R
Sbjct: 1   MTRRISRIATSAVLTIALAGCGVSLNHTPGTVGGGNFGGLPTAGGQGSEAGFQNWVQSFR 60

Query: 51  ARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIAL 110
            RA+  G+SP T     A   Y  + +A DRK          +YLDG       A G A 
Sbjct: 61  PRALAAGVSPGTFDSAMAGAHYQPSIVALDRKQSE-FTKPIWEYLDGAIG-TRGATGRAK 118

Query: 111 KKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTE 170
               +  L  ++  YGVP  I++A+WG+E++FG   G T ++  LATLAYD RR +FF  
Sbjct: 119 AAQYAGTLSAIEARYGVPREIVLAVWGMESNFGANRGNTRIVPALATLAYDGRRGEFFAG 178

Query: 171 QFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDA 228
           +   AL +++ G + S  + G+  G +G  QF+P + + +A+D + DG+ D+      DA
Sbjct: 179 ELVAALRIIQSGDVDSAHMVGSWAGAMGHTQFMPSSFLSHAVDFNGDGRRDIWSNDPTDA 238

Query: 229 IASAAKFLAKLGWTK---------------------------------------CAGYQP 249
           +AS A +L + GW                                          A    
Sbjct: 239 LASTASYLRQNGWRPGQPWGAEVILPPGFDFNRSGKSVQHSGSQWAAMGVRTVSGAPVPS 298

Query: 250 GE---------------KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
           G                 NF  +  +NAS +Y   +AY+   I G    +G
Sbjct: 299 GSILAPAGARGPAFLITDNFRAILKYNASDSYALAVAYLGEAIAGRRGIQG 349


>gi|328542465|ref|YP_004302574.1| Lytic murein transglycosylase subfamily [polymorphum gilvum
           SL003B-26A1]
 gi|326412212|gb|ADZ69275.1| Lytic murein transglycosylase subfamily, putative [Polymorphum
           gilvum SL003B-26A1]
          Length = 419

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 64/218 (29%), Positives = 102/218 (46%), Gaps = 3/218 (1%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
              +     F  W       A   G+S  T   +F  +     TI    +          
Sbjct: 38  AQVARADAAFDTWVRGFWPEARAAGISAATYNAVFTGMSPDPDTIRLMNRQSE-FVKPIW 96

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL G  S   +  G A+      +L  +++ YGV   +++A+WG+ET++G  MGK  ++
Sbjct: 97  DYLAGAVSDTRVETGKAMLAQYGDVLRAIEQRYGVDRAVVLAVWGMETNYGGFMGKHNVI 156

Query: 153 STLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
             LATLAY   RR +F+  +   AL +V+ G I    + G+  G +G  QF+P +  +YA
Sbjct: 157 RALATLAYGAPRRQEFWRSELVTALGIVQAGHIRHDQMIGSWAGAMGHTQFMPSSWKRYA 216

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            D + DG+ D+  S  DA+AS A +L + GW     + 
Sbjct: 217 ADYNGDGRRDIWTSIPDALASTANYLKEHGWQTGKTWG 254



 Score = 49.1 bits (115), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 10/36 (27%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGY 286
            +NF ++K +N + +Y   + ++A  I G   G G+
Sbjct: 315 LRNFFVIKRYNNATSYALAVGHLADRIIG---GSGF 347


>gi|163850482|ref|YP_001638525.1| hypothetical protein Mext_1049 [Methylobacterium extorquens PA1]
 gi|163662087|gb|ABY29454.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 265

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 100/263 (38%), Positives = 140/263 (53%), Gaps = 10/263 (3%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            +   A+           C + A  F  WK    A A  +G +   +    A+  Y   T
Sbjct: 12  MVAVAALMGLAGTAQAAQCGNNAAGFEAWKDEFAAEA--KGRASPASLAALANTSYSTAT 69

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I+ DR   +   +S   +L     + I+++G ALK  N+ L  ++++ YGVPPG L+A+W
Sbjct: 70  ISADRGQKS-FKLSLDQFLAKRGGNTIVSRGRALKAQNAALFASIEQRYGVPPGPLLAIW 128

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEI 196
           G+ET FG   G    LS +ATLAYDCRR+ +FT+Q + AL LV  GV++    GA  GE+
Sbjct: 129 GMETGFGAVKGNVNTLSAVATLAYDCRRSAYFTDQLYAALKLVDSGVLTPATRGAAHGEV 188

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAI 256
           G  QFLP NV+ Y +    D       S   A+ S A FL   GW + AGYQPGE NFA 
Sbjct: 189 GHTQFLPKNVLTYGVGGSLD-------SAPVALNSTANFLKGHGWQRGAGYQPGEPNFAA 241

Query: 257 LKHWNASLNYNKTIAYIAAHIDG 279
           ++ WNA+  Y + IA + A IDG
Sbjct: 242 IQGWNAAGVYQRAIALLGARIDG 264


>gi|83311552|ref|YP_421816.1| membrane-bound lytic murein transglycosylase B [Magnetospirillum
           magneticum AMB-1]
 gi|82946393|dbj|BAE51257.1| Membrane-bound lytic murein transglycosylase B [Magnetospirillum
           magneticum AMB-1]
          Length = 356

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 74/231 (32%), Positives = 125/231 (54%), Gaps = 2/231 (0%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
             +   A  +   +     FG + +  RA  + +G+  +T     A++ ++D  I  DRK
Sbjct: 41  SAEEPVAQAEPQVATAESGFGAFLAGVRAEGLEKGLRSQTLDAALANVTHIDRVIELDRK 100

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                 ++F +YL  + S   + +G      N  LL  +++ YGV P  ++ALWG+ET+F
Sbjct: 101 QPE-FTLTFNEYLGRIVSQARVEEGRRKLAENKALLTEIERRYGVQPRFVVALWGIETNF 159

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQF 201
           G+  G   ++S+LATLAYD RR+K+F  +   AL ++ +G I   + +G+  G +GQ QF
Sbjct: 160 GKNTGGMSVVSSLATLAYDGRRSKYFRTELMNALTILDQGHIQPANMIGSWAGAMGQCQF 219

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
           +P   +K+A+D D DGK ++  +  DA+ASAA +L+  GW     +    K
Sbjct: 220 MPSTFLKFAVDWDGDGKRNIWTNRADALASAANYLSSEGWKGDQTWGRAVK 270



 Score = 42.9 bits (99), Expect = 0.048,   Method: Composition-based stats.
 Identities = 8/29 (27%), Positives = 12/29 (41%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDG 279
             NF  +  WN S  +     ++A  I G
Sbjct: 327 YDNFRTIMKWNRSTFFALAAGHLADRIGG 355


>gi|149915308|ref|ZP_01903835.1| Lytic murein transglycosylase [Roseobacter sp. AzwK-3b]
 gi|149810597|gb|EDM70438.1| Lytic murein transglycosylase [Roseobacter sp. AzwK-3b]
          Length = 414

 Score =  197 bits (501), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 82/270 (30%), Positives = 129/270 (47%), Gaps = 13/270 (4%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
            + +        S     F  W +  R RA+ +G+SP+     F  + Y    + +DR  
Sbjct: 26  AELQSDAQLVRVSTANASFDRWVAGFRGRALAQGISPRVFDAAFRGVSYNSEVVHKDRNQ 85

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
                    DYLD  +S + +  G A  + ++R L  +++ YGV   ++ A+WGLET +G
Sbjct: 86  AE-FKRQIWDYLDSAASPDRVRNGQAALRRHARALAAIERAYGVEKEVVTAVWGLETAYG 144

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFL 202
           E  G  PL+ ++ATLAYD RR  FF +Q   AL +++ G +      G+  G +G  QF+
Sbjct: 145 ERRGTLPLIESVATLAYDGRRGAFFEKQLIAALQIIQAGDVDPRDMKGSWAGAMGHTQFI 204

Query: 203 PVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWN 261
           P + + YA+D   DGK D+      DA+AS A +L + GWTK   +    +       +N
Sbjct: 205 PTSYLAYAVDFTGDGKRDIWSDDPTDALASTAAYLKRFGWTKGQPWGVEVRLPR---GFN 261

Query: 262 ASLN---YNKTIAYIAAH----IDGVPIGK 284
           A+       K  +  AA     IDG P+  
Sbjct: 262 AATAKRDNRKMPSQWAAQGVVGIDGRPVPD 291



 Score = 51.4 bits (121), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 16/30 (53%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
            NF +++ +N +  Y   + +++  I G P
Sbjct: 312 DNFRVIERYNNADAYVIGVGHLSDRIKGGP 341


>gi|304393409|ref|ZP_07375337.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
 gi|303294416|gb|EFL88788.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
          Length = 475

 Score =  197 bits (500), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 81/341 (23%), Positives = 130/341 (38%), Gaps = 67/341 (19%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
            F K   +SLL+     +   +      T  F     + +F +W +     A R G+   
Sbjct: 65  RFAKRFFMSLLIRSAMAVICCIALLSTTTPSFA----SAKFRKWIAEFENVAARNGVKRS 120

Query: 62  TAKHLFADLE-YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
             +  F  +       +   R            Y D   + E IA+G+  K+  +  L  
Sbjct: 121 VYRKAFKGIRSPDPEVLELARFQPE-FRQKLWMYFDTRVNEEGIARGLQEKQKWAPWLSR 179

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGK----TPLLSTLATLAY-DCRRAKFFTEQFFYA 175
           ++K+YGV   IL+ +W +ET FGE + K      ++ +LATLAY D RR KF   Q   A
Sbjct: 180 IEKKYGVDRDILLGIWSMETGFGEALKKGSATRSIVRSLATLAYQDRRRRKFARSQLIAA 239

Query: 176 LDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           + +V+ G +S     G+  G +G  QF+P +   Y  D D DG+ ++  S  DA+A+AA+
Sbjct: 240 MKIVQAGHVSVEGLQGSWAGAMGHTQFIPTSYRAYGQDMDGDGRKNIWTSVPDALATAAQ 299

Query: 235 FLAKLGWT------------------------------------KCAGYQ---------- 248
            L K GW                                         ++          
Sbjct: 300 LLRKNGWRTGETWGYEVENAGRAYTQRNRSKSIGQWAKLGVRRVAGRKWRNTKQRAVLKF 359

Query: 249 ---------PGEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                       KNF ++K +N S  Y   + ++A    G 
Sbjct: 360 PAGKNGPAFLMTKNFFVIKRYNNSDKYALAVGHLADRFGGS 400


>gi|144899828|emb|CAM76692.1| Membrane-bound lytic murein transglycosylase B [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 330

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 72/213 (33%), Positives = 122/213 (57%), Gaps = 2/213 (0%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
            F  +    +A A  +GM P+T +   A++E++D  I  DR+      +++K Y+D + S
Sbjct: 33  DFATFLQGVKAEAAGKGMRPETLETALANVEHIDKVIELDRRQPE-FTMTYKTYMDRVVS 91

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G  +   N  +L ++++EYGV P  ++ALWG+ET +G   G   ++S LATLAY
Sbjct: 92  PTKVEKGRLMLAENHAVLAHIEREYGVQPKYVVALWGIETDYGRVTGGYSVVSALATLAY 151

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           D RR+ +F  +   AL ++ +G I+    LG+  G +GQ QF+P + +++A D D DG+ 
Sbjct: 152 DGRRSTYFRGELMNALQILDEGHIAPASMLGSWAGAMGQCQFMPSSFLRFAADWDGDGRR 211

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
           D+  +  D +ASAA +L+K GW     +    K
Sbjct: 212 DIWTTRADVLASAANYLSKSGWKGDQTWGRAVK 244



 Score = 41.4 bits (95), Expect = 0.16,   Method: Composition-based stats.
 Identities = 8/29 (27%), Positives = 12/29 (41%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDG 279
             NF     WN S  +   + ++A  I G
Sbjct: 301 YDNFRTTLKWNRSTFFALAVGHLAERIGG 329


>gi|332305300|ref|YP_004433151.1| lytic murein transglycosylase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172629|gb|AEE21883.1| lytic murein transglycosylase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 416

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 86/346 (24%), Positives = 142/346 (41%), Gaps = 67/346 (19%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICS--DTADRFGEWKSAARARAVREGMSPKTAKH 65
           L   L++    L   ++ P  A      +     ++F +     + +A   G+S +   +
Sbjct: 5   LSKFLVIARWSLLGCLSTPVLAQANADTNAPTPREQFAQCVVDLQQQAKSVGVSQRVTDN 64

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
           +    ++ +  I+ DR        +F DY +   ++  I +G  +   +   L  L KEY
Sbjct: 65  VLGKAQFKEKIISLDRNQPE-FVQTFTDYFEKRVNTWRIDKGRQMLAKHRAFLNELNKEY 123

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV-I 184
           GVP   L+A WGLET+FG   GK+P++ +L TLA D RR+++F+ +   AL L+ +    
Sbjct: 124 GVPAQYLLAFWGLETNFGSYKGKSPVIDSLVTLACDNRRSRYFSSELMQALLLIDREKLD 183

Query: 185 SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
               +G+  G +G  QF+P   +KYA+D D+DG+I+L  S  DA+ASAA FL  LGW   
Sbjct: 184 DKQMVGSWAGAMGHTQFMPSAYMKYAVDGDKDGQINLWNSEKDALASAANFLKNLGWQAG 243

Query: 245 AGY----------------------------------------------------QPGEK 252
             +                                                         
Sbjct: 244 YKWGREVSLPESFDYTLVGKNSPKTLSVWNDAGVTRTDGKPVGAADIKGALLVPAGHEGP 303

Query: 253 NFAILKHWN------ASLNYNKTIAYIAAHIDG-----VPIGKGYD 287
           +F   K++N       S  Y   + ++A  I G      P+ K  D
Sbjct: 304 SFLAYKNFNVILRWNNSEYYGIAVGHLADRIAGLGTLSKPLPKLPD 349


>gi|220920475|ref|YP_002495776.1| hypothetical protein Mnod_0431 [Methylobacterium nodulans ORS 2060]
 gi|219945081|gb|ACL55473.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 265

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 95/266 (35%), Positives = 136/266 (51%), Gaps = 10/266 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
            +      A      A     C +    F  WK      A   G    T         Y 
Sbjct: 9   PLVAAGFAAFVFTAHAAQAAQCGNGPAGFEAWKREFAEEA--RGRVGATGVSALMGTSYS 66

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             TIA DR   +   +S   +L       I+++G ALK++N+ L  ++++ YGVPPG L+
Sbjct: 67  SATIAADRGQKS-FRLSLDQFLAKRGGPAIVSRGRALKQSNAALFASIEQRYGVPPGPLL 125

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF 193
           A+WG+ET FG + G    LS +ATLAYDCRR+ +FT+Q + AL LV +G++S    GA  
Sbjct: 126 AIWGMETGFGASRGNVNTLSAVATLAYDCRRSAYFTDQLYAALTLVDRGILSPSTRGAAH 185

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GE+G  QFLP +++ Y      D       S  +A+ + A FL   GW + AGYQPGE N
Sbjct: 186 GEVGHTQFLPKSILNYGTGGSLD-------SVPNALNATANFLRAHGWQRGAGYQPGEPN 238

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDG 279
           F+ ++ WN++  Y + IA I   IDG
Sbjct: 239 FSAIQGWNSASVYQRAIALIGRRIDG 264


>gi|218531528|ref|YP_002422344.1| lytic murein transglycosylase [Methylobacterium chloromethanicum
           CM4]
 gi|218523831|gb|ACK84416.1| lytic murein transglycosylase [Methylobacterium chloromethanicum
           CM4]
          Length = 393

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 77/299 (25%), Positives = 124/299 (41%), Gaps = 56/299 (18%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPVSFKDYLD 96
               F  + ++ R  A   G+SPKT    FA ++      +AR R+          DYL 
Sbjct: 22  QDGDFSGFVASLRPDATARGISPKTFDAAFAGVQGPDPDVVARTRRQSE-FSRPVWDYLV 80

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           G  S   I +G A  K  +  L  ++ + GVP  +++A WG+E+ FG + G  P +  LA
Sbjct: 81  GAVSGARITRGQAQGKRLAASLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTVRALA 140

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADE 215
           +LAY   R   F ++   AL +++ G I     +G+  G +GQ QFLP   ++ A+D D 
Sbjct: 141 SLAYARHRGTLFRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDG 200

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP-------------------------- 249
           DG+ D+ +S  DA+AS A +L  LGW     +                            
Sbjct: 201 DGRRDIWRSEADALASIAHYLQSLGWKPGLSWGYEVSLPKDFDLTRYRGPLADFATRGVR 260

Query: 250 ---------------------GEKNF------AILKHWNASLNYNKTIAYIAAHIDGVP 281
                                G   F       +++ +N S +Y   + ++A  + G P
Sbjct: 261 RTDGKPLPTGGEASLFLPGGLGSPVFLITDNFEVIRGYNTSDSYALAVGHLADRLAGGP 319


>gi|126664625|ref|ZP_01735609.1| Membrane-bound lytic murein transglycosylase B [Marinobacter sp.
           ELB17]
 gi|126630951|gb|EBA01565.1| Membrane-bound lytic murein transglycosylase B [Marinobacter sp.
           ELB17]
          Length = 418

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 94/339 (27%), Positives = 138/339 (40%), Gaps = 61/339 (17%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTAD--RFGEWKSAARARAVREGMS 59
           S  + L  +   +   MLA        +         A    F   K+  + +AV  G+S
Sbjct: 4   SISRLLRPAATALCAGMLATLPLSASASLADKATDRPAALNSFETCKADLQQQAVAAGVS 63

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
            +TA+ + A  EYL+  I  DR+        F DYL+   +   I +G  L   ++ LL 
Sbjct: 64  AETARSVLAGAEYLERVIELDRRQPE-FTTPFADYLNRRVNDTRIDKGRQLLIEHADLLQ 122

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            +  E GVP   L++ WGLET++G   GK  + S+LATLA D RR  FFT Q   AL +V
Sbjct: 123 RVTNETGVPAAYLLSFWGLETNYGSYFGKMSVPSSLATLACDERRKTFFTRQLIAALQIV 182

Query: 180 KKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
            +G IS   + G+  G +G  QF+P   +K+A+DAD DG+ DL  S  DA+ SA +FL  
Sbjct: 183 DEGAISPEQMEGSWAGAMGHVQFMPTVFLKHAVDADGDGRRDLWHSLPDALMSAGQFLQS 242

Query: 239 LGWTKCAGYQPGEK---NFA---------------------------------------- 255
           +GW     +    +   NF                                         
Sbjct: 243 MGWDGDYRWGREVQLPDNFNFALADGRRKSLEQWNQLGVTNASGGPLAEEAIDAALIVPA 302

Query: 256 -----ILKHW---------NASLNYNKTIAYIAAHIDGV 280
                    +         N S  Y   + ++A  I G 
Sbjct: 303 GHQGPAFLAYHNFKVIMGWNRSEFYAIAVGHLADRIAGA 341


>gi|254562448|ref|YP_003069543.1| membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
 gi|254269726|emb|CAX25698.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
          Length = 393

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 74/298 (24%), Positives = 124/298 (41%), Gaps = 54/298 (18%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
               F  + ++ R+ A   G+S KT    FA ++  D+ +    +  +       DYL G
Sbjct: 22  QDGDFSGFVASLRSDATARGISQKTFDAAFAGVQAPDSDVVARTRRQSEFSRPVWDYLVG 81

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             S   I +G A  K  +  L  ++ + GVP  +++A WG+E+ FG + G  P +  LA+
Sbjct: 82  AVSGPRITRGQAQGKRLAATLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTIRALAS 141

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADED 216
           LAY   R   F ++   AL +++ G I     +G+  G +GQ QFLP   ++ A+D D D
Sbjct: 142 LAYARHRGTLFRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDGD 201

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP--------------------------- 249
           G+ D+ +S  DA+AS A +L  LGW     +                             
Sbjct: 202 GRRDIWRSEADALASIAHYLQSLGWKPGLSWGYEVSLPKDFDLTRYRGPLADFAARGVRR 261

Query: 250 --------------------GEKNF------AILKHWNASLNYNKTIAYIAAHIDGVP 281
                               G   F       +++ +N S +Y   + ++A  + G P
Sbjct: 262 TDGKPLPSGGEASLFLPGGLGSPVFLITDNFEVIRGYNTSDSYALAVGHLADRLAGGP 319


>gi|239834506|ref|ZP_04682834.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
 gi|239822569|gb|EEQ94138.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
          Length = 441

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 66/305 (21%), Positives = 124/305 (40%), Gaps = 60/305 (19%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
            +    +F +W ++ R  A++ G+SP T    F  ++  D  + +  +          +Y
Sbjct: 62  SALADAQFRQWVASFRPVAIKAGVSPSTFDRAFRGVDAPDPVVLQKARYQPEFTEPVWNY 121

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL-- 152
           +D   + + ++ G ++ +     L  +++ + V   IL+A+W +E+++GE + +  ++  
Sbjct: 122 IDNRVNEQSVSVGQSMARKWGPWLQRIEQRFSVDRNILLAIWSMESNYGEILKRDDVMRD 181

Query: 153 --STLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVK 208
              +LATLAY D RRAK+   Q   A+ +++ G I      G+  G +G  QF+P +   
Sbjct: 182 AVRSLATLAYADQRRAKYGRTQLIAAMKILQTGDIDRGHLSGSWAGALGHTQFIPTSYQA 241

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------------------ 250
           YA+D D +GK D+  S  DA+ +AA  L + GW     +                     
Sbjct: 242 YAVDVDGNGKRDIWNSVPDALGTAANLLHRNGWQPGRTWGYEVALPQGRKFPNGSLSIAE 301

Query: 251 ---------------EKNFAI---------------------LKHWNASLNYNKTIAYIA 274
                          + N                        LK +N +  Y   +  +A
Sbjct: 302 WQQIGIVRANGRPFPDPNEKATLKVPDGRQGPAFLMTKNFFVLKRYNNADKYALAVGLLA 361

Query: 275 AHIDG 279
             I G
Sbjct: 362 DRIGG 366


>gi|23011047|ref|ZP_00051533.1| COG2951: Membrane-bound lytic murein transglycosylase B
           [Magnetospirillum magnetotacticum MS-1]
          Length = 377

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 82/303 (27%), Positives = 129/303 (42%), Gaps = 56/303 (18%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPVSFK 92
                 D F  + +  RA A   G+S KT +  FAD+    +  IAR R+          
Sbjct: 26  PARAQGDDFARFVAGVRADAEARGVSRKTVEAAFADVSGPDNAVIARTRRQGE-FSRPVW 84

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL G  S   IA+G A  K  S  L  ++ + GVP  +++A WG+E+ FG + G  P +
Sbjct: 85  DYLVGAVSPGRIARGQAQAKRLSATLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTI 144

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAI 211
            +LA+LAY   R   F ++   AL +++ G I     +G+  G +GQ QFLP   ++ A+
Sbjct: 145 RSLASLAYARHRGSLFRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAV 204

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK------------------- 252
           D D DG+ D+ +S  DA+AS A +L  LGW     +    +                   
Sbjct: 205 DFDGDGRRDIWRSEADALASIAHYLRSLGWKPGLSWGYEVRLPAGFDLSRYRGRLSDFAA 264

Query: 253 ----------------------------------NFAILKHWNASLNYNKTIAYIAAHID 278
                                             NF +++ +N S +Y   + ++A  + 
Sbjct: 265 RGLRRTDGKPLPAEGEASLFLPGGLGAPVFLITDNFEVIRGYNTSDSYALAVGHLADRLA 324

Query: 279 GVP 281
           G P
Sbjct: 325 GGP 327


>gi|304393133|ref|ZP_07375061.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
 gi|303294140|gb|EFL88512.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
          Length = 293

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 96/281 (34%), Positives = 143/281 (50%), Gaps = 7/281 (2%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
           FK    IS+ + +   +  +            CS+T+  F ++K    A+A R G+  K 
Sbjct: 14  FKDSKGISMKVSITATILASAMIFGTPAAYAACSNTSAGFNQFKKNFAAKAKRNGIGRKG 73

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPP-----VSFKDYLDGLSSSEIIAQGIALKKANSRL 117
              +  D +Y ++ I  DR+            +  +      +  +  +       N RL
Sbjct: 74  V-KVLMDAKYSNSVIKFDRRQAKFFKSAGRSKTNFNSFYSKKTKGLAPRVKRALSKNKRL 132

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
             +L+K +GV   +L  +WG+ET+FG   GK   ++ LATL +DCRR   F++    A+ 
Sbjct: 133 FRSLEKNFGVQKEVLATIWGMETNFGGYTGKIDTMNALATLTHDCRRTGLFSKNLLAAMK 192

Query: 178 LVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           +  KG I  +   GA  GE+GQ QF+  N +KYAID + DGK DLV+S  DA+ASAA FL
Sbjct: 193 IYDKGWISRAAMKGAGHGELGQMQFMAENYLKYAIDYNNDGKRDLVRSRADALASAANFL 252

Query: 237 AKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHI 277
            + GW +   YQPG KNF +L  WN S  Y +TIA  AA +
Sbjct: 253 VRNGWQRMGSYQPGSKNFRVLNSWNESTAYQQTIAKFAASL 293


>gi|89067326|ref|ZP_01154839.1| hypothetical protein OG2516_10816 [Oceanicola granulosus HTCC2516]
 gi|89046895|gb|EAR52949.1| hypothetical protein OG2516_10816 [Oceanicola granulosus HTCC2516]
          Length = 389

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 84/321 (26%), Positives = 117/321 (36%), Gaps = 59/321 (18%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           A        A            F  +  A +  AV  G      +  FA +      IA 
Sbjct: 3   AALTALFTLAAGTAAAQPCGGDFNAFVDALKTEAVARGHDASATERFFASVRQDPDVIAA 62

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR+        F D+   L S   I  G  + +        ++ EYGVP G+L+A W  E
Sbjct: 63  DRRQG-VFQRDFIDFSRRLISQNRIDNGQIMSERYDATFDRIEAEYGVPRGVLLAFWAFE 121

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQ 198
           T +G+  G     + L TLA+DCRR + F  Q + AL+L ++G +      GA  GEIGQ
Sbjct: 122 TDYGQVQGDFNTANALVTLAHDCRRPELFLPQVYAALELYERGDLDPATTTGAWAGEIGQ 181

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY----------- 247
            Q LP +++    D D DG++DL  S  DA+ S    LA LGW     +           
Sbjct: 182 VQMLPEDILTNGRDGDGDGRVDLKGSAEDALMSGGAMLADLGWRAGEPWLQEIVVPEGID 241

Query: 248 ----------------------------------------QPGEKNF------AILKHWN 261
                                                     G   F       +   WN
Sbjct: 242 LTLTGLDHEMTVAEWEALGVRAREGQLGDGSLVASVLLPMGEGGPAFLAYPNFDVYFEWN 301

Query: 262 ASLNYNKTIAYIAAHIDGVPI 282
            SL Y  T AY A  ++G P+
Sbjct: 302 QSLVYVTTAAYFATRLEGAPV 322


>gi|225628550|ref|ZP_03786584.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
 gi|237816592|ref|ZP_04595584.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
 gi|225616396|gb|EEH13444.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
 gi|237787405|gb|EEP61621.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
          Length = 429

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 73/335 (21%), Positives = 125/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 27  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 79

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 80  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 139

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 140 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 199

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L +
Sbjct: 200 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLHR 259

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 260 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 319

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 320 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 354


>gi|120556504|ref|YP_960855.1| lytic murein transglycosylase [Marinobacter aquaeolei VT8]
 gi|120326353|gb|ABM20668.1| lytic murein transglycosylase [Marinobacter aquaeolei VT8]
          Length = 410

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 86/321 (26%), Positives = 133/321 (41%), Gaps = 59/321 (18%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
           ++A +++           +     F + K A   +AV  G+   T + + A + +LD  I
Sbjct: 14  LVAISLSTLALVARAETETTNTPAFEQCKQALGEKAVAAGVRESTVQSVMAGVVHLDRVI 73

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
             DR+       +F DYL+   +   + +G  L   + +LL  +  E GVP   L A WG
Sbjct: 74  ELDRRQPE-FTTTFADYLNRRVNDARVGKGRELLAEHRKLLDRVTAETGVPAPYLAAFWG 132

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEI 196
           LET++G   GK  + S LATLA D RR+ FFTEQ+  AL ++ +G I +  + G+  G +
Sbjct: 133 LETNYGSYFGKMQVPSALATLACDARRSSFFTEQWIAALRIIDEGAIPADQMEGSWAGAM 192

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG---EKN 253
           G  QF+P   +K+A+DAD DG+ DL  S  DA+ SA +FL  +GW     +        N
Sbjct: 193 GHVQFMPTVFLKHAVDADGDGRRDLWNSLPDAMMSAGRFLESMGWDGDYRWGREVLLPDN 252

Query: 254 FA---------------------------------------------ILKHW-------- 260
           F                                                  +        
Sbjct: 253 FDFSLADGRRLPLADWRKMGITDAFGNRLANEPIEAALIVPSGHQGPAFLVYSNFRVIMG 312

Query: 261 -NASLNYNKTIAYIAAHIDGV 280
            N S  Y   + ++A  I G 
Sbjct: 313 WNRSEFYAIAVGHLADRIAGA 333


>gi|310817038|ref|YP_003965002.1| membrane-bound lytic murein transglycosylase B [Ketogulonicigenium
           vulgare Y25]
 gi|308755773|gb|ADO43702.1| membrane-bound lytic murein transglycosylase B [Ketogulonicigenium
           vulgare Y25]
          Length = 419

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 75/315 (23%), Positives = 131/315 (41%), Gaps = 58/315 (18%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
               +  T  +   T   +  W+++ R RA+  G+S +T    F +  YL   +  DR  
Sbjct: 36  PAASQQGTSTMRGATNAGYLNWQASFRPRALAAGISARTFDAAFRNATYLPNVVENDRNQ 95

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
                 +   YL   +S   +  G A+   ++ LL  +++ YGV   I++A+WG+E+++G
Sbjct: 96  AE-FTRALGAYLSTAASDARVENGRAMLAQHANLLSQIEQRYGVDRHIVVAVWGMESNYG 154

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFL 202
              G  P++S L+TLAYD RRA FF  Q   AL +++     +  + G+  G +G  QF+
Sbjct: 155 ARRGDVPIISALSTLAYDGRRASFFENQLIAALRIIQANDTDAEHMLGSWAGAMGHTQFM 214

Query: 203 PVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ------------- 248
           P + ++YA+D   DG+ D+      D +AS A +L++ GW     +              
Sbjct: 215 PTSFLEYAVDFRGDGRRDIWSDDPTDGLASTAAYLSRHGWVSGQPWGVEVRLPSGFNYAL 274

Query: 249 ---------------------------------PGEKNFAILK---------HWNASLNY 266
                                            P   N   +           +NAS +Y
Sbjct: 275 TGKGANRPVSEWAAMGVRAANGNLPGGEASILLPTGANGPAIMIFRNFTVISRYNASDSY 334

Query: 267 NKTIAYIAAHIDGVP 281
              + ++A  + G P
Sbjct: 335 VIGVGHLADRLRGGP 349


>gi|255262308|ref|ZP_05341650.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
 gi|255104643|gb|EET47317.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
          Length = 413

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 76/251 (30%), Positives = 119/251 (47%), Gaps = 4/251 (1%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQ-PKKATTQFICSDTADRFGEWKSAARARAVREGMS 59
           M     L+++ L+ +    A      P+   T      +      W    RARA+ +G+ 
Sbjct: 1   MLRFPALVLACLLPIGAQAAPDTAPRPQARITLAQADGSTAGLEHWIINFRARAISKGIE 60

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
             T   +  +L Y    I RDR        +  DYLD  +S   +  G A  + +  LL 
Sbjct: 61  AATLNSVLRNLTYDRDIIRRDRNQSE-FTKTIWDYLDTAASDLRVKNGQAALRKHETLLS 119

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            ++  YGV   I++A+WGLE+ +G   G  P++ +LATLAYD RR  FF EQ   AL ++
Sbjct: 120 EIETLYGVDRHIVVAIWGLESSYGAFRGSQPVIQSLATLAYDGRRGDFFEEQLIAALRIL 179

Query: 180 KKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLA 237
           + G  ++ +  G+  G +G  QF+P + + Y +D   DG  D+      DA+AS A +L 
Sbjct: 180 QTGDTTAQNMTGSWAGAMGHTQFIPTSYLDYVVDFRGDGARDIWSDDPTDALASTAAYLK 239

Query: 238 KLGWTKCAGYQ 248
             GWT    + 
Sbjct: 240 AFGWTTGQPWG 250



 Score = 48.3 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 8/32 (25%), Positives = 17/32 (53%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVPIGK 284
           NF  L+ +N +  Y   + ++A  + G P+ +
Sbjct: 312 NFETLERYNTADAYVIGVGHLADRLRGGPVVQ 343


>gi|78047996|ref|YP_364171.1| lytic murein transglycosylase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|38564795|gb|AAR23828.1| putative murein transglycosylase precursor [Xanthomonas
           euvesicatoria]
 gi|78036426|emb|CAJ24117.1| Lytic murein transglycosylase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 425

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 73/288 (25%), Positives = 125/288 (43%), Gaps = 12/288 (4%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTA------DRFGEWKSAARARAVRE 56
            +  L +S+ +    + AQA+     A++                F +W +  R RA+  
Sbjct: 8   LRLTLGVSVCVASTSVAAQAIAPETTASSATDAGGQQQDPAPTASFEQWLADFRQRALAA 67

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+   T  +  A +    +    D++          DYL    +   I +G  L      
Sbjct: 68  GIGATTLDNALAGVTPDPSVHELDQRQPE-FTQYLWDYLSARVTPSAIQEGQQLLIRQHA 126

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA++ RR  +   Q   AL
Sbjct: 127 LFEKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLAHEGRRTTYGNTQLLAAL 186

Query: 177 DLVKKGV--ISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            +++       S  +G+  G +GQ QF+P     YA+D D D K D+  S  DA+ SAA 
Sbjct: 187 QILQTEKSIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKRDVWNSKADALGSAAN 246

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASL-NYNKTIAYIAAHIDGVP 281
           +L +  WT    +    +  +    +  +     KT+A     +   P
Sbjct: 247 YLKQNNWTSAVPWGQEVQ-LSAGFDYAQADLTIKKTVAEW-QRLGVAP 292



 Score = 44.5 bits (103), Expect = 0.019,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 11/29 (37%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  +  +N S  Y   +  +A    G 
Sbjct: 322 DNFRSILRYNNSTAYALAVGLLADGYAGR 350


>gi|254711939|ref|ZP_05173750.1| Putative peptidoglycan binding domain 1 [Brucella ceti M644/93/1]
 gi|261319579|ref|ZP_05958776.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
 gi|261292269|gb|EEX95765.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
          Length = 412

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 73/335 (21%), Positives = 125/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 10  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 62

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 63  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 122

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 123 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 182

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L +
Sbjct: 183 QTGDIERSHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLHR 242

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 243 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 302

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 303 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|306841151|ref|ZP_07473867.1| lytic murein transglycosylase [Brucella sp. BO2]
 gi|306288777|gb|EFM60095.1| lytic murein transglycosylase [Brucella sp. BO2]
          Length = 428

 Score =  196 bits (498), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 73/335 (21%), Positives = 125/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 26  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 78

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 79  RAFRGVNQPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 138

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 139 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 198

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L +
Sbjct: 199 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLHR 258

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 259 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 318

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 319 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRISG 353


>gi|254699386|ref|ZP_05161214.1| Putative peptidoglycan binding domain 1 [Brucella suis bv. 5 str.
           513]
 gi|261749835|ref|ZP_05993544.1| lytic Murein transglycosylase [Brucella suis bv. 5 str. 513]
 gi|261739588|gb|EEY27514.1| lytic Murein transglycosylase [Brucella suis bv. 5 str. 513]
          Length = 412

 Score =  196 bits (497), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 73/335 (21%), Positives = 125/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 10  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 62

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 63  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 122

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 123 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 182

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L +
Sbjct: 183 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLHR 242

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 243 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRALPDPHEKATLKVPDGHQ 302

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 303 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|241764631|ref|ZP_04762645.1| lytic murein transglycosylase [Acidovorax delafieldii 2AN]
 gi|241365902|gb|EER60539.1| lytic murein transglycosylase [Acidovorax delafieldii 2AN]
          Length = 387

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 74/265 (27%), Positives = 121/265 (45%), Gaps = 8/265 (3%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
              A T     + + RF  W +     A   G+   T +  F D+ ++   I  DR    
Sbjct: 4   ASPAPTVSDEVEHSQRFARWVADFSTDARAAGIDEATLQSAFHDVRFIARVIELDRAQPE 63

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
               +  DYLD   S++ IA+G          +  +   YGVP  +L+A+WG+E+++G  
Sbjct: 64  -FTRTVWDYLDRALSAQRIARGQDKLLELGPAVDTIAVRYGVPTEVLVAIWGMESNYGSN 122

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPV 204
           +G  P +  LATL ++ RR ++   Q   AL +++   I  +  +G+  G +GQ QFLP 
Sbjct: 123 VGDIPTIDALATLGFEGRREEWARGQLLAALKILQNRDIDRAQMIGSWAGAMGQTQFLPS 182

Query: 205 NVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASL 264
           N + YA+DAD DG+ D+  S  D +AS A FLA+ GW     +    +       +  + 
Sbjct: 183 NFLAYAVDADGDGRRDIWGSVPDVMASTANFLARSGWQAGQPWGIEVRLPTG-FDYARAD 241

Query: 265 NYNKT-IAYIAAH----IDGVPIGK 284
              +      A      +DG P+  
Sbjct: 242 ADVRQPTTQWANEGVQAMDGAPLPT 266



 Score = 49.5 bits (116), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 8/33 (24%), Positives = 16/33 (48%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGK 284
            NF  +  +N S +Y   ++ +A  + G P  +
Sbjct: 287 PNFRTILRYNNSTSYALAVSLLAQKLAGGPTVQ 319


>gi|254462615|ref|ZP_05076031.1| lytic murein transglycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206679204|gb|EDZ43691.1| lytic murein transglycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 447

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 76/224 (33%), Positives = 117/224 (52%), Gaps = 3/224 (1%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
                  + + +   F  W SA R RA+  G+SP      F D+ YL   I RDR     
Sbjct: 64  AVTPEAILAATSNVGFKRWISAFRGRALSAGISPAAFDQSFRDVVYLPKVIERDRNQSE- 122

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
              +  DYLD  +S   IA G A  + +   L  ++ +YGV   +++A+WGLE+ +GE  
Sbjct: 123 FTKTIWDYLDSAASDRRIANGKAALETHRAKLDAIEAKYGVEKEVVVAVWGLESAYGEFR 182

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVN 205
           G TP++S LATL+YD RR +FF  Q   AL +++ G  +  +  G+  G +G  QF+P +
Sbjct: 183 GDTPIVSALATLSYDGRRGRFFESQLIAALKILQSGDTTPKNMTGSWAGAMGHTQFIPTS 242

Query: 206 VVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
            + +A+D   DG+ D+      DA+AS A +L+K GW     + 
Sbjct: 243 YLDHAVDFTGDGRRDIWANDPSDALASTAAYLSKFGWQTGQPWG 286


>gi|218529178|ref|YP_002419994.1| hypothetical protein Mchl_1178 [Methylobacterium chloromethanicum
           CM4]
 gi|254560016|ref|YP_003067111.1| membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
 gi|218521481|gb|ACK82066.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
 gi|254267294|emb|CAX23126.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
          Length = 261

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 100/263 (38%), Positives = 140/263 (53%), Gaps = 10/263 (3%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            +   A+           C + A  F  WK    A A  +G +   +    A+  Y   T
Sbjct: 8   MVAVAALMGLAGTAQAAQCGNNAAGFEAWKDEFAAEA--KGRASPASLAALANTSYSTAT 65

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I+ DR   +   +S   +L     + I+++G ALK  N+ L  ++++ YGVPPG L+A+W
Sbjct: 66  ISADRGQKS-FKLSLDQFLAKRGGNTIVSRGRALKAQNAALFASIEQRYGVPPGPLLAIW 124

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEI 196
           G+ET FG   G    LS +ATLAYDCRR+ +FT+Q + AL LV  GV++    GA  GE+
Sbjct: 125 GMETGFGAVKGNVNTLSAVATLAYDCRRSAYFTDQLYAALKLVDSGVLTPATRGAAHGEV 184

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAI 256
           G  QFLP NV+ Y +    D       S   A+ S A FL   GW + AGYQPGE NFA 
Sbjct: 185 GHTQFLPKNVLTYGVGGSLD-------SAPVALNSTANFLKGHGWQRGAGYQPGEPNFAA 237

Query: 257 LKHWNASLNYNKTIAYIAAHIDG 279
           ++ WNA+  Y + IA + A IDG
Sbjct: 238 IQGWNAAGVYQRAIALLGARIDG 260


>gi|17988368|ref|NP_541001.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 1 str. 16M]
 gi|256042995|ref|ZP_05445941.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256112021|ref|ZP_05452966.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 3 str. Ether]
 gi|260564228|ref|ZP_05834713.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|265989432|ref|ZP_06101989.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993467|ref|ZP_06106024.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|17984146|gb|AAL53265.1| membrane-bound lytic murein transglycosylase b [Brucella melitensis
           bv. 1 str. 16M]
 gi|260151871|gb|EEW86964.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|262764337|gb|EEZ10369.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000101|gb|EEZ12791.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 412

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 73/335 (21%), Positives = 125/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 10  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 62

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 63  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 122

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 123 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 182

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L +
Sbjct: 183 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLHR 242

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 243 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 302

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 303 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|240140021|ref|YP_002964498.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
 gi|240009995|gb|ACS41221.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
          Length = 393

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 75/299 (25%), Positives = 122/299 (40%), Gaps = 56/299 (18%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPVSFKDYLD 96
               F  + ++ R  A   G+S KT    FA ++      +AR  +          DYL 
Sbjct: 22  QDGDFSGFVASLRPDATARGISQKTFDAAFAGVQGPDSDVVARTHRQSE-FSRPVWDYLV 80

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           G  S   I +G A  K  +  L  ++ + GVP  +++A WG+E+ FG + G  P +  LA
Sbjct: 81  GAVSGARITRGQAQGKRLAATLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTIRALA 140

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADE 215
           +LAY   R   F ++   AL +++ G I     +G+  G +GQ QFLP   ++ A+D D 
Sbjct: 141 SLAYARHRGTLFRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDG 200

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP-------------------------- 249
           DG+ D+ +S  DA+AS A +L  LGW     +                            
Sbjct: 201 DGRRDIWRSEADALASIAHYLQSLGWKPGLSWGYEVSLPKDFDLTRYRGPLADFAARGVR 260

Query: 250 ---------------------GEKNF------AILKHWNASLNYNKTIAYIAAHIDGVP 281
                                G   F       +++ +N S +Y   + ++A  + G P
Sbjct: 261 RTDGKPLPTGGEASLFLPGGLGSPVFLITDNFEVIRGYNTSDSYALAVGHLADRLAGGP 319


>gi|239503932|ref|ZP_04663242.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB900]
          Length = 430

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 79/309 (25%), Positives = 131/309 (42%), Gaps = 33/309 (10%)

Query: 3   FKKYLLISLLMMVYPMLAQA---------VTQPKKATTQFICSDTADRFGEWKSAARARA 53
            +++  I   + +    AQA          +      T        + F    +  R++A
Sbjct: 1   MRRFSCIVGSVFLAMTQAQAELVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  T      +L    + I +             DYL GL   E +A G      
Sbjct: 61  IAAGVSGSTYDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVALGKQKLAQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L    + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF
Sbjct: 120 HRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFF 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS 
Sbjct: 180 ATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALAST 239

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           A FL K GW     +               G ++   L  W+      + +      IDG
Sbjct: 240 ANFLNKAGWQTGMPWGFEVQIPAGMSIDGEGRRSKKPLSSWS-----ARGV----TRIDG 290

Query: 280 VPIGKGYDT 288
            P+ +G  +
Sbjct: 291 SPLIQGPLS 299



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 321 KNFDAIYSYNAAESYGLAIAHLSDRLRGAGPFVSSWPT 358


>gi|262371197|ref|ZP_06064518.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262313927|gb|EEY94973.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 427

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 81/294 (27%), Positives = 133/294 (45%), Gaps = 10/294 (3%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDT----ADRFGEWKSAARARAVRE 56
           M    +LL S  +      A+ +   +K T     + +     + F    +  +++A+  
Sbjct: 1   MHRFAFLLGSFFLAATQANAELIINGQKVTGSSNVATSDYSPQNSFQSCIANLKSQAMAN 60

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+S  T      +L    + I +             DYL GL   E +A G      +  
Sbjct: 61  GVSASTYDRYTQNLAPDYSVIEKLNYQPE-FSTPIWDYLSGLVDDERVAVGRQKLVQHRE 119

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           +L  +   YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF A+
Sbjct: 120 VLNRVAAAYGVPAETVVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRGEFFAAM 179

Query: 177 DLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKF 235
            ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS A F
Sbjct: 180 RILQRGDLTESQLKGSWAGAFGHTQFMPSTYEELAVDFDGDGRRDLVSSTTDALASTANF 239

Query: 236 LAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA----HIDGVPIGKG 285
           L K GW     +    KN   +     S    K+++Y         DG  + +G
Sbjct: 240 LKKRGWQTGQPWGFEVKNPQAISLSGESRRNKKSLSYWMQNGLVRADGSALVQG 293



 Score = 46.8 bits (109), Expect = 0.004,   Method: Composition-based stats.
 Identities = 9/36 (25%), Positives = 17/36 (47%)

Query: 244 CAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
                   KNF  +  +NA+ +Y   IA+++  + G
Sbjct: 310 NGPLFLVFKNFDAIYSYNAAESYALAIAHLSDRLQG 345


>gi|169797788|ref|YP_001715581.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii AYE]
 gi|213155414|ref|YP_002317459.1| transglycolase [Acinetobacter baumannii AB0057]
 gi|215485138|ref|YP_002327379.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB307-0294]
 gi|301347988|ref|ZP_07228729.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB056]
 gi|301512988|ref|ZP_07238225.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB058]
 gi|301596722|ref|ZP_07241730.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB059]
 gi|169150715|emb|CAM88625.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii AYE]
 gi|213054574|gb|ACJ39476.1| transglycolase [Acinetobacter baumannii AB0057]
 gi|213988779|gb|ACJ59078.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB307-0294]
          Length = 430

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 79/309 (25%), Positives = 131/309 (42%), Gaps = 33/309 (10%)

Query: 3   FKKYLLISLLMMVYPMLAQA---------VTQPKKATTQFICSDTADRFGEWKSAARARA 53
            +++  I   + +    AQA          +      T        + F    +  R++A
Sbjct: 1   MRRFSCIVGSVFLAMTQAQAELVINGSTISSNATVPVTNSNTYTPNNNFQSCLANLRSQA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  T      +L    + I +             DYL GL   E +A G      
Sbjct: 61  IAAGVSGSTYDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVALGKQKLAQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L    + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF
Sbjct: 120 HRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFF 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS 
Sbjct: 180 ATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALAST 239

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           A FL K GW     +               G ++   L  W+      + +      IDG
Sbjct: 240 ANFLNKAGWQTGMPWGFEVQIPAGMSIDGEGRRSKKPLSSWS-----ARGV----TRIDG 290

Query: 280 VPIGKGYDT 288
            P+ +G  +
Sbjct: 291 SPLIQGPLS 299



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 321 KNFDAIYSYNAAESYGLAIAHLSDRLRGAGPFVSSWPT 358


>gi|330976837|gb|EGH76869.1| hypothetical protein PSYAP_09300 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 445

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
                P       +    A  F EW++  RA+A++ G+        FA +    + +  D
Sbjct: 49  AVAPTPALVVDDNLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKAD 108

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R           +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E+
Sbjct: 109 RSQPE-FSRPVWEYLDGAISAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMES 167

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           +FG   G   ++ +LATLAY+ RR  F   Q   AL++++ G I+   + G+  G +GQ 
Sbjct: 168 NFGSFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQT 227

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P     +A+D D DG+ D+  +  DA+AS A +L   GW +   + 
Sbjct: 228 QFIPTTYNTHAVDFDGDGRRDIWNTPADALASPAHYLQSSGWQRGQPWG 276



 Score = 44.5 bits (103), Expect = 0.016,   Method: Composition-based stats.
 Identities = 7/30 (23%), Positives = 13/30 (43%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
             NF  +  +N S +Y   I+ ++    G 
Sbjct: 339 LDNFRAILKYNNSTSYALAISLLSDRFKGA 368


>gi|260779237|ref|ZP_05888129.1| membrane-bound lytic murein transglycosylase B [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260605401|gb|EEX31696.1| membrane-bound lytic murein transglycosylase B [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 323

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 71/265 (26%), Positives = 120/265 (45%), Gaps = 12/265 (4%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
           AT           F ++    +  A ++G+S +T    F D+ Y    +  DR       
Sbjct: 11  ATIASSAWANELSFEQYVEGLKQEARQKGISEQTISAAFEDVTYKPRAVKADRNQPEK-K 69

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
           ++  +Y+        + Q   L   +   L  + +EYGV P  ++ALWG+E++FG+  G 
Sbjct: 70  LTLDEYIPRAVPDWKVKQAKELYVKHKEELQRIGEEYGVQPRFIVALWGVESNFGKFTGN 129

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVV 207
             ++  L+T+AYD RR  FF  +   AL ++ +G I   +  G+  G +GQ QF+P + +
Sbjct: 130 YSVIDALSTMAYDGRREAFFRNEAMAALTILDEGHIKPENMKGSWAGAMGQCQFMPSSFL 189

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN----FAILKHWNAS 263
            YA D   DGK D+  +  D  ASAA +L++ GWT    +    K        ++    S
Sbjct: 190 SYAADGSGDGKKDIWDNEADVFASAANYLSQSGWTDSYTWGRQVKLPHGFDTSIQG--RS 247

Query: 264 LNYNKTIAYIAA----HIDGVPIGK 284
               K +   +       DG P+ +
Sbjct: 248 EEKGKYLQEWSKMGVTRYDGRPLPQ 272



 Score = 40.2 bits (92), Expect = 0.38,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSYYFALAVSHLADRIA 322


>gi|260553796|ref|ZP_05826066.1| transglycolase [Acinetobacter sp. RUH2624]
 gi|260405100|gb|EEW98600.1| transglycolase [Acinetobacter sp. RUH2624]
          Length = 432

 Score =  195 bits (496), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 80/297 (26%), Positives = 129/297 (43%), Gaps = 27/297 (9%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDT---ADRFGEWKSAARARAVREGMSPKT 62
           +L ++       +   + T    AT     S+T    + F    +  R++A+  G+S  T
Sbjct: 12  FLTMTQAQAELIINGSSSTISSNATVPVTNSNTYTPNNNFQSCLANLRSQAIAAGVSGST 71

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
                 +L    + I +             DYL GL   E +  G         +L    
Sbjct: 72  YDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVELGKQKLAQYRDVLNRAS 130

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           + YGVPP  ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G
Sbjct: 131 QVYGVPPETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILQRG 190

Query: 183 VISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW
Sbjct: 191 DLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGW 250

Query: 242 TKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
                +               G ++   L  W++              IDG P+ +G
Sbjct: 251 QTGMPWGFEVKIPSGMSIDGEGRRSKKPLSSWSSRGV---------TRIDGTPLIQG 298



 Score = 47.2 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 323 KNFDAIYSYNAAESYGLAIAHLSDRLKGGKPFIASWPT 360


>gi|193078394|gb|ABO13365.2| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii ATCC 17978]
          Length = 430

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 79/309 (25%), Positives = 131/309 (42%), Gaps = 33/309 (10%)

Query: 3   FKKYLLISLLMMVYPMLAQA---------VTQPKKATTQFICSDTADRFGEWKSAARARA 53
            +++  I   + +    AQA          +      T        + F    +  R++A
Sbjct: 1   MRRFSCIVGSVFLAMTQAQAELVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  T      +L    + I +             DYL GL   E +A G      
Sbjct: 61  IAAGVSGSTYDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVALGKQKLVQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L    + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF
Sbjct: 120 HRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFF 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS 
Sbjct: 180 ATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALAST 239

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           A FL K GW     +               G ++   L  W+      + +      IDG
Sbjct: 240 ANFLNKAGWQTGMPWGFEVQIPAGMSIDGEGRRSKKPLSSWS-----ARGV----TRIDG 290

Query: 280 VPIGKGYDT 288
            P+ +G  +
Sbjct: 291 SPLIQGPLS 299



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 321 KNFDAIYSYNAAESYGLAIAHLSDRLRGAGPFVSSWPT 358


>gi|74316079|ref|YP_313819.1| lytic murein transglycosylase [Thiobacillus denitrificans ATCC
           25259]
 gi|74055574|gb|AAZ96014.1| lytic murein transglycosylase [Thiobacillus denitrificans ATCC
           25259]
          Length = 434

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 82/305 (26%), Positives = 129/305 (42%), Gaps = 60/305 (19%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
           F        F  W +A R  A  +G+SP T       +E ++  I  DR+       +F 
Sbjct: 32  FPAHAEETDFDTWLAAFRDEAQAQGISPATLASALDGIEPVERVIELDRRQPE-FLQTFA 90

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            YL    +SE + +G  + +A++ L   ++  YGV   +L A WGLET +G   G   + 
Sbjct: 91  AYLARRVTSEQVDRGQTMLEAHADLFDAVETRYGVAANVLAAFWGLETRYGAFKGGLNIP 150

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
           ++LATLAYD RR+ FF ++   AL ++  G ++     G+  G +G  QF+P     YA+
Sbjct: 151 ASLATLAYDGRRSAFFRKELLDALRIIDAGHVTAPEMNGSWAGAMGHMQFMPSTFRAYAV 210

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW--------------------------TKCA 245
           DAD D +IDL +S  DA+ SAA +L++ GW                             A
Sbjct: 211 DADGDARIDLWQSLPDAMNSAANYLSRAGWRSGEPIAVEVTLPPDFDLRKARAGHRQPVA 270

Query: 246 GYQPGE--------------------------------KNFAILKHWNASLNYNKTIAYI 273
            +                                     NF ++  WN S++Y  T+A +
Sbjct: 271 DWAAAGVRAASGCTLPQVNGKAGIVLPQGWEGPAFMVFDNFDVVMRWNRSVSYALTVAQL 330

Query: 274 AAHID 278
           A  + 
Sbjct: 331 AQQLA 335


>gi|62317029|ref|YP_222882.1| transglycosylase [Brucella abortus bv. 1 str. 9-941]
 gi|83269023|ref|YP_418314.1| peptidoglycan binding domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|189022296|ref|YP_001932037.1| Putative peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|254695217|ref|ZP_05157045.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 3
           str. Tulya]
 gi|254698316|ref|ZP_05160144.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254706370|ref|ZP_05168198.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           M163/99/10]
 gi|254711340|ref|ZP_05173151.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           B2/94]
 gi|254731759|ref|ZP_05190337.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 4
           str. 292]
 gi|256014866|ref|YP_003104875.1| membrane-bound lytic murein transglycosylase B [Brucella microti
           CCM 4915]
 gi|256030031|ref|ZP_05443645.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           M292/94/1]
 gi|256158203|ref|ZP_05456112.1| Putative peptidoglycan binding domain 1 [Brucella ceti M490/95/1]
 gi|256252855|ref|ZP_05458391.1| Putative peptidoglycan binding domain 1 [Brucella ceti B1/94]
 gi|256256672|ref|ZP_05462208.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 9
           str. C68]
 gi|260166918|ref|ZP_05753729.1| membrane-bound lytic murein transglycosylase B [Brucella sp. F5/99]
 gi|260544265|ref|ZP_05820086.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260759523|ref|ZP_05871871.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260762767|ref|ZP_05875099.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882916|ref|ZP_05894530.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|261215579|ref|ZP_05929860.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|261219942|ref|ZP_05934223.1| lytic Murein transglycosylase [Brucella ceti B1/94]
 gi|261313816|ref|ZP_05953013.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261318943|ref|ZP_05958140.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261756303|ref|ZP_06000012.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|265987053|ref|ZP_06099610.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|265996715|ref|ZP_06109272.1| lytic Murein transglycosylase [Brucella ceti M490/95/1]
 gi|294853097|ref|ZP_06793769.1| transglycosylase [Brucella sp. NVSL 07-0026]
 gi|297250027|ref|ZP_06933728.1| peptidoglycan binding domain-containing protein [Brucella abortus
           bv. 5 str. B3196]
 gi|62197222|gb|AAX75521.1| hypothetical transglycosylase [Brucella abortus bv. 1 str. 9-941]
 gi|82939297|emb|CAJ12235.1| Putative peptidoglycan binding domain 1 [Brucella melitensis biovar
           Abortus 2308]
 gi|189020870|gb|ACD73591.1| Putative peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|255997526|gb|ACU49213.1| membrane-bound lytic murein transglycosylase B [Brucella microti
           CCM 4915]
 gi|260097536|gb|EEW81410.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260669841|gb|EEX56781.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260673188|gb|EEX60009.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260872444|gb|EEX79513.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|260917186|gb|EEX84047.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|260918526|gb|EEX85179.1| lytic Murein transglycosylase [Brucella ceti B1/94]
 gi|261298166|gb|EEY01663.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261302842|gb|EEY06339.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261736287|gb|EEY24283.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|262551012|gb|EEZ07173.1| lytic Murein transglycosylase [Brucella ceti M490/95/1]
 gi|264659250|gb|EEZ29511.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|294818752|gb|EFG35752.1| transglycosylase [Brucella sp. NVSL 07-0026]
 gi|297173896|gb|EFH33260.1| peptidoglycan binding domain-containing protein [Brucella abortus
           bv. 5 str. B3196]
          Length = 412

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 73/335 (21%), Positives = 125/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 10  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 62

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 63  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 122

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 123 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 182

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L +
Sbjct: 183 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLHR 242

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 243 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 302

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 303 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|220924707|ref|YP_002500009.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
 gi|219949314|gb|ACL59706.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
          Length = 429

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 75/337 (22%), Positives = 125/337 (37%), Gaps = 66/337 (19%)

Query: 7   LLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHL 66
           L++ L+    P   Q    P  AT   +  D    F   K    A A   G++       
Sbjct: 21  LILGLVWPGLPAHGQTAAPPDTATA--VSPDEQAAFDRCKQDLAAEARARGVAQAVVASS 78

Query: 67  FADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYG 126
             DL      +   R+          DY+D   +   I  G A       +L  ++  YG
Sbjct: 79  LQDLSPDPQVLTASRQQAE-FEKPLWDYIDAAVTETAIVDGRAKLGEWEPVLAAIETAYG 137

Query: 127 VPPGILMALWGLETHFGETMGKT----PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           V   +L A+WG+E+ +G  + K     P++ +LATLA    RA ++ ++   AL +  +G
Sbjct: 138 VDRFVLAAIWGIESGYGAVLDKPTKVRPVIRSLATLACGGERAPYWRDELLAALQIADRG 197

Query: 183 VISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL-- 239
            I      G+  G +G  QF+P   +++A+D D DG+ D+  S  DA+AS A  L  +  
Sbjct: 198 GIPLDQLTGSWAGAMGHTQFMPTTYLRHAVDFDGDGRRDIWHSVPDALASTANDLKAMGW 257

Query: 240 ----GW--------------------TKCAGYQPG------------------------- 250
               GW                       A +Q                           
Sbjct: 258 RAGEGWGYEVVLPEGFDYALADEVTERPLAAWQALGVRVAGGQPPAPTPTPARLLVPAGA 317

Query: 251 -------EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                    NF ++  +N +L+Y   +A+++  + G 
Sbjct: 318 RGPAFLLLPNFQVILRYNTALSYALAVAHLSDRLRGA 354


>gi|163844269|ref|YP_001621924.1| lytic murein transglycosylase [Brucella suis ATCC 23445]
 gi|163674992|gb|ABY39102.1| lytic murein transglycosylase [Brucella suis ATCC 23445]
          Length = 408

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 72/335 (21%), Positives = 124/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 10  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 62

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 63  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 122

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 123 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 182

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   Y +D D +GK D+  S  DA+ +AA  L +
Sbjct: 183 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYTVDMDGNGKRDIWNSVPDALGTAANLLHR 242

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 243 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 302

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 303 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|163852687|ref|YP_001640730.1| lytic murein transglycosylase [Methylobacterium extorquens PA1]
 gi|163664292|gb|ABY31659.1| lytic murein transglycosylase [Methylobacterium extorquens PA1]
          Length = 393

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 76/299 (25%), Positives = 122/299 (40%), Gaps = 56/299 (18%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPVSFKDYLD 96
               F  + ++ R  A   G+S KT    FA ++      +AR R+          DYL 
Sbjct: 22  QDGDFSGFVASLRPDATARGISQKTFDAAFAGVQAPDPDVVARTRRQSE-FSRPVWDYLV 80

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           G  S   I +G A  K  +  L  ++ + GVP  +++A WG+E+ FG + G  P    LA
Sbjct: 81  GAVSGARITRGQAQGKRLAATLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTARALA 140

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADE 215
           +LAY   R   F ++   AL +++ G I     +G+  G +GQ QFLP   ++ A+D D 
Sbjct: 141 SLAYARHRGTLFRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDG 200

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP-------------------------- 249
           DG+ D+ +S  DA+AS A +L  LGW     +                            
Sbjct: 201 DGRRDIWRSEADALASIAHYLQSLGWKPGLSWGYEVSLPKDFDLTRYRGPLADFAARGVR 260

Query: 250 ---------------------GEKNF------AILKHWNASLNYNKTIAYIAAHIDGVP 281
                                G   F       +++ +N S +Y   + ++A  + G P
Sbjct: 261 RTDGKPLPTGGEASLFLPGGLGSPVFLITDNFEVIRGYNTSDSYALAVGHLADRLAGGP 319


>gi|21264235|ref|NP_644735.1| lytic murein transglycosylase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21110871|gb|AAM39253.1| lytic murein transglycosylase [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 425

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 74/288 (25%), Positives = 126/288 (43%), Gaps = 12/288 (4%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADR------FGEWKSAARARAVRE 56
            +  L +S+ +    + AQA+     A++                F +W +  R RA+  
Sbjct: 8   LRLTLGVSVCVAATSVAAQAIAPETTASSATDAGGQQQDPAPTSSFEQWLADFRQRALAA 67

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+   T  +  A +         D++          DYLD   +   I +G  L  +   
Sbjct: 68  GIGATTLDNALAGVTPDPAVHELDQRQPE-FTQYLWDYLDARVTPSAIQEGQQLLISQHA 126

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA++ RR  +   Q   AL
Sbjct: 127 LFEKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLAHEGRRTTYGNTQLLAAL 186

Query: 177 DLVKKGV--ISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            +++       S  +G+  G +GQ QF+P     YA+D D D K D+  S  DA+ SAA 
Sbjct: 187 QILQTEKSIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKRDVWNSKADALGSAAN 246

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASL-NYNKTIAYIAAHIDGVP 281
           +L +  WT    +    +  +    +  +     KT+A     +   P
Sbjct: 247 YLKQNNWTSAVPWGQEVQ-LSAGFDYAQADLTIKKTVAEW-QRLGVAP 292



 Score = 44.5 bits (103), Expect = 0.019,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 11/29 (37%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  +  +N S  Y   +  +A    G 
Sbjct: 322 DNFRSILRYNNSTAYALAVGLLADGYAGR 350


>gi|254720679|ref|ZP_05182490.1| Putative peptidoglycan binding domain 1 [Brucella sp. 83/13]
 gi|265985729|ref|ZP_06098464.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|306839369|ref|ZP_07472185.1| lytic murein transglycosylase [Brucella sp. NF 2653]
 gi|264664321|gb|EEZ34582.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|306405617|gb|EFM61880.1| lytic murein transglycosylase [Brucella sp. NF 2653]
          Length = 412

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 73/335 (21%), Positives = 125/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 10  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 62

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 63  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 122

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 123 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 182

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L +
Sbjct: 183 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLHR 242

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 243 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 302

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 303 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|188580261|ref|YP_001923706.1| hypothetical protein Mpop_0994 [Methylobacterium populi BJ001]
 gi|179343759|gb|ACB79171.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 261

 Score =  195 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 101/250 (40%), Positives = 139/250 (55%), Gaps = 10/250 (4%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                C +TA  F  WK    A A  +G +   A    A+  Y   TI+ DR   +   +
Sbjct: 21  AQAAQCGNTAAGFEAWKDEFAAEA--KGRASPAALAALANTSYSTATISADRGQKS-FKL 77

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           S   +L     + I+++G ALK  N+ L  ++++ YGVPPG L+A+WG+ET FG   G  
Sbjct: 78  SLDQFLAKRGGNTIVSRGRALKAQNAALFASIEQRYGVPPGPLLAIWGMETGFGAVKGNV 137

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
             LS +ATLAYDCRR+ +FT+Q + AL LV  GV++    GA  GE+G  QFLP NV+ Y
Sbjct: 138 NTLSAVATLAYDCRRSAYFTDQLYAALKLVDSGVLTPATRGAAHGEVGHTQFLPKNVLTY 197

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKT 269
            +    D       S  +A+ S A FL   GW + AGYQPGE NFA ++ WNA+  Y + 
Sbjct: 198 GVGGSLD-------SAPNALNSTANFLKGHGWQRGAGYQPGEPNFAAIQGWNAAGVYQRA 250

Query: 270 IAYIAAHIDG 279
           IA + A IDG
Sbjct: 251 IALLGARIDG 260


>gi|153011588|ref|YP_001372802.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
 gi|151563476|gb|ABS16973.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
          Length = 412

 Score =  195 bits (495), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 68/339 (20%), Positives = 128/339 (37%), Gaps = 73/339 (21%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M  K    +++ ++   +   +                  +F +W ++ R  A+  G+SP
Sbjct: 12  MKLKAAATVAIAVLASTLTTGSALA-------------DAKFRQWVASFRPVAINAGVSP 58

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T    F  ++  D  + +  +          +Y+D   +   ++ G  + +     L  
Sbjct: 59  STFDRAFRGVDAPDPVVLQKARYQPEFTEPVWNYVDNRVNEHSVSVGQNMARKWGPWLQR 118

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYA 175
           +++ + V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A
Sbjct: 119 IEQRFSVDRNILLAIWSMESNYGEILKRDDVMRDAVRSLATLAYADQRRAKYGRTQLIAA 178

Query: 176 LDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           + +++ G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA 
Sbjct: 179 MKILQTGDIDRGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSIPDALGTAAN 238

Query: 235 FLAKLGWTKCAGYQPG-------------------------EKNFAI------------- 256
            L + GW     +                              N                
Sbjct: 239 LLHRNGWQPGRSWGYEVALPQGRKFPSGSLSIAEWQKIGLVRANGRAFPDPSEKATLKVP 298

Query: 257 ----------------LKHWNASLNYNKTIAYIAAHIDG 279
                           LK +N +  Y   +  +A  I G
Sbjct: 299 DGRQGPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|184156347|ref|YP_001844686.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           baumannii ACICU]
 gi|183207941|gb|ACC55339.1| Membrane-bound lytic murein transglycosylase B [Acinetobacter
           baumannii ACICU]
          Length = 430

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 80/309 (25%), Positives = 132/309 (42%), Gaps = 33/309 (10%)

Query: 3   FKKYLLISLLMMVYPMLAQA---------VTQPKKATTQFICSDTADRFGEWKSAARARA 53
            +++  I   + +    AQA          +      T        + F    +  R++A
Sbjct: 1   MRRFSCIVGSVFLAMTQAQAELVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  T      +L    + I +             DYL GL   E +A G      
Sbjct: 61  IAAGVSGSTYDGYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVALGKQKLVQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L    +EYGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF
Sbjct: 120 HRDVLNRASQEYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFF 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS 
Sbjct: 180 ATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALAST 239

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           A FL K GW     +               G ++   L  W+      + +      IDG
Sbjct: 240 ANFLNKAGWQTGMPWGFEVQIPAGMSIDGEGRRSKKPLSSWS-----ARGV----TRIDG 290

Query: 280 VPIGKGYDT 288
            P+ +G  +
Sbjct: 291 SPLIQGPLS 299



 Score = 47.9 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 321 KNFDAIYSYNAAESYGLAIAHLSDRLRGAGPFVSSWPT 358


>gi|21243951|ref|NP_643533.1| transglycosylase [Xanthomonas axonopodis pv. citri str. 306]
 gi|21109562|gb|AAM38069.1| transglycosylase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 425

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 77/287 (26%), Positives = 127/287 (44%), Gaps = 10/287 (3%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTA------DRFGEWKSAARARAVRE 56
            +  L +S+ +    + AQA+     A++                F +W +  R RA+  
Sbjct: 8   LRLTLGVSVCVAATSVAAQAIAPETTASSATDAGGQQQDPAPTASFEQWLADFRQRALAA 67

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+   T  +  A +         D++          DYLD   +   I +G  L  +   
Sbjct: 68  GIGATTLDNALAGVTPDPAVHELDQRQPE-FTQYLWDYLDARVTPSAIQEGQQLLISQHA 126

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA++ RR  +   Q   AL
Sbjct: 127 LFEKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLAHEGRRTTYGNTQLLAAL 186

Query: 177 DLVKKGV--ISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            +++       S  +G+  G +GQ QF+P     YA+D D D K D+  S  DA+ SAA 
Sbjct: 187 QILQTEKSIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKRDVWNSKADALGSAAN 246

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           +L +  WT    +    +  A   +  A L   KT+A     +   P
Sbjct: 247 YLKQNNWTSAVPWGQEVQLSAGFDYAQADLTIKKTVAEW-QRLGVAP 292



 Score = 44.1 bits (102), Expect = 0.021,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 11/29 (37%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  +  +N S  Y   +  +A    G 
Sbjct: 322 DNFRSILRYNNSTAYALAVGLLADGYAGR 350


>gi|169634920|ref|YP_001708656.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii SDF]
 gi|169153712|emb|CAP02911.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii]
          Length = 430

 Score =  195 bits (495), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 79/307 (25%), Positives = 130/307 (42%), Gaps = 33/307 (10%)

Query: 3   FKKYLLISLLMMVYPMLAQA---------VTQPKKATTQFICSDTADRFGEWKSAARARA 53
            +++  I   + +    AQA          +      T        + F    +  R++A
Sbjct: 1   MRRFSCIVGSVFLAMTQAQAELVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  T      +L    + I +             DYL GL   E +A G      
Sbjct: 61  IAAGVSGSTYDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVALGKQKLAQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L    + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF
Sbjct: 120 HRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFF 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS 
Sbjct: 180 ATMRILRRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALAST 239

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           A FL K GW     +               G ++   L  W+      + +      IDG
Sbjct: 240 ANFLNKAGWQTGMPWGFEVQIPAGMSIDGEGRRSKKPLSSWS-----ARGV----TRIDG 290

Query: 280 VPIGKGY 286
            P+ +G 
Sbjct: 291 SPLIQGP 297



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 321 KNFDAIYSYNAAESYGLAIAHLSDRLRGAGPFVSSWPT 358


>gi|254465328|ref|ZP_05078739.1| lytic murein transglycosylase [Rhodobacterales bacterium Y4I]
 gi|206686236|gb|EDZ46718.1| lytic murein transglycosylase [Rhodobacterales bacterium Y4I]
          Length = 443

 Score =  195 bits (494), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 71/239 (29%), Positives = 113/239 (47%), Gaps = 3/239 (1%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L      L  A         +   +     F  W    R RA+ +G+        FA + 
Sbjct: 45  LASAATDLRPAARPAALKQAEPQPAAAELNFQGWIQGFRDRALAQGIRAPVLDSAFAGVS 104

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y    I RDR        +  +YLD  +S   +  G A  + +   L  ++ +YGV   I
Sbjct: 105 YDPEVIRRDRNQSE-FTKTIWEYLDSAASELRVKNGKAAVREHQARLDQIEAKYGVEKEI 163

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALG 190
           ++A+WGLE+ +G   GK  ++ +LATLA+D RR  FF  Q   AL +++ G +++    G
Sbjct: 164 VVAVWGLESSYGTFRGKMDVIRSLATLAFDGRRGAFFEGQLVAALKILQAGDVAARKMTG 223

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +  G +G  QF+P + + YA+D   DGK D+   +  DA+AS A +L + GW K   + 
Sbjct: 224 SWAGAMGHTQFIPTSYLDYAVDFTGDGKRDIWSDNPSDALASTAAYLKQFGWEKGQPWG 282



 Score = 46.8 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 10/35 (28%), Positives = 19/35 (54%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGY 286
           +NFA+L+ +N +  Y   + ++A  I G    +G 
Sbjct: 343 QNFAVLERYNTADAYVIGVGHLADRIKGGAPIRGD 377


>gi|148558066|ref|YP_001257145.1| putative transglycosylase [Brucella ovis ATCC 25840]
 gi|148369351|gb|ABQ62223.1| putative transglycosylase [Brucella ovis ATCC 25840]
          Length = 412

 Score =  195 bits (494), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 73/335 (21%), Positives = 126/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 10  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 62

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 63  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 122

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 123 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 182

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L +
Sbjct: 183 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLHR 242

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 243 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 302

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   ++ +A  I G
Sbjct: 303 GPAFLMTKNFFVLKRYNNADKYALAVSLLADRIGG 337


>gi|332873283|ref|ZP_08441238.1| lytic murein transglycosylase [Acinetobacter baumannii 6014059]
 gi|322506216|gb|ADX01670.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           baumannii 1656-2]
 gi|332738489|gb|EGJ69361.1| lytic murein transglycosylase [Acinetobacter baumannii 6014059]
          Length = 416

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 75/283 (26%), Positives = 123/283 (43%), Gaps = 24/283 (8%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           +   +      T        + F    +  R++A+  G+S  T      +L    + I +
Sbjct: 13  STISSNATVPVTNSDTYTPNNNFQSCLANLRSQAIAAGVSGSTYDRYTQNLTPDYSVIDK 72

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
                        DYL GL   E +A G      +  +L    + YGVP   ++A+WG+E
Sbjct: 73  LNYQPE-FSTPIWDYLSGLVDEERVALGKQKLAQHRDVLNRASQVYGVPAETIVAVWGVE 131

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQ 198
           ++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++     G+  G  G 
Sbjct: 132 SNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGH 191

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY----------- 247
            QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW     +           
Sbjct: 192 TQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGWQTGMPWGFEVQIPAGMS 251

Query: 248 --QPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT 288
               G ++   L  W+      + +      IDG P+ +G  +
Sbjct: 252 IDGEGRRSKKPLSSWS-----ARGV----TRIDGSPLIQGPLS 285



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 307 KNFDAIYSYNAAESYGLAIAHLSDRLRGAGPFVSSWPT 344


>gi|183179548|ref|ZP_02957759.1| lytic murein transglycosylase, putative [Vibrio cholerae MZO-3]
 gi|183012959|gb|EDT88259.1| lytic murein transglycosylase, putative [Vibrio cholerae MZO-3]
          Length = 323

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 74/328 (22%), Positives = 135/328 (41%), Gaps = 72/328 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L  A++ P  A            F ++    + +A  EG+S +     F D+EY 
Sbjct: 4   LLSIVLGLALSAPVLANEV--------SFEQYVERLKQQAREEGISERILNEAFRDVEYK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             ++  D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 56  PRSVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYTELQRIGKQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 115 ALWGVESNFGAFTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPDAMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W----- 241
            G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ G      W     
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWGRQVK 234

Query: 242 --------------TKCAGYQPGEK----------------------------------- 252
                          K    Q   K                                   
Sbjct: 235 IPKGFDHALEGRQPEKGKTLQEWSKLGVTRYDGKPLPALSDDIKAWLIMPDDEVGRIYLV 294

Query: 253 --NFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSHYFALAVSHLADRIA 322


>gi|298292927|ref|YP_003694866.1| lytic murein transglycosylase [Starkeya novella DSM 506]
 gi|296929438|gb|ADH90247.1| lytic murein transglycosylase [Starkeya novella DSM 506]
          Length = 411

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 87/314 (27%), Positives = 137/314 (43%), Gaps = 61/314 (19%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
           Q  C +    F ++ +  + +AV +G+SP+T       + Y    +A DR        SF
Sbjct: 30  QQSCGNNGAGFDQFIAGFKQQAVAQGVSPRTVATALNGIAYAPDIVATDRGQ-KVFGQSF 88

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
             + D + ++  I QG    + N  L   +++++GVP  +L++ WGLET FG  MG    
Sbjct: 89  FQFSDRMVANYRIQQGRQQIQRNPALFQRIEQQFGVPGAVLVSFWGLETDFGANMGDKST 148

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYA 210
           + ++ATLA+DCRRA  F  Q   AL ++ +G ++     G   GE+GQFQFLP +   Y 
Sbjct: 149 IRSVATLAWDCRRADVFRTQLLAALKIIDRGDLTPQTMRGPWAGELGQFQFLPDHYFNYG 208

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY----------------------- 247
           +D D DG++DL++S  DA+ASAA ++  LGW     +                       
Sbjct: 209 VDFDGDGRVDLIRSAPDALASAANYIRALGWKAGQPWLEEVRVPQNLPWDQADLAIKLPR 268

Query: 248 --------------------------QPGEKNFAILKHW---------NASLNYNKTIAY 272
                                      P  +N      +         N SL Y  + AY
Sbjct: 269 AQWARMGVMRAGGGQLPADQLPASLLLPMGRNGPAFLAYPNFDVFTEWNNSLVYATSAAY 328

Query: 273 IAAHIDGV-PIGKG 285
           +A  + G  P  +G
Sbjct: 329 LATRVTGAGPFNRG 342


>gi|225685937|ref|YP_002733909.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|256261850|ref|ZP_05464382.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|225642042|gb|ACO01955.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|263091326|gb|EEZ15862.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|326410256|gb|ADZ67320.1| lytic murein transglycosylase [Brucella melitensis M28]
 gi|326553549|gb|ADZ88188.1| lytic murein transglycosylase [Brucella melitensis M5-90]
          Length = 412

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 72/335 (21%), Positives = 124/335 (37%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 10  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 62

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++  
Sbjct: 63  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEHH 122

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LAT AY D RRAK+   Q   A+ ++
Sbjct: 123 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATFAYADARRAKYGRTQLIAAMKIL 182

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L +
Sbjct: 183 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLHR 242

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 243 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 302

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 303 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|332854690|ref|ZP_08435477.1| lytic murein transglycosylase [Acinetobacter baumannii 6013150]
 gi|332865570|ref|ZP_08436410.1| lytic murein transglycosylase [Acinetobacter baumannii 6013113]
 gi|332727847|gb|EGJ59249.1| lytic murein transglycosylase [Acinetobacter baumannii 6013150]
 gi|332735222|gb|EGJ66299.1| lytic murein transglycosylase [Acinetobacter baumannii 6013113]
          Length = 416

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 75/283 (26%), Positives = 123/283 (43%), Gaps = 24/283 (8%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           +   +      T        + F    +  R++A+  G+S  T      +L    + I +
Sbjct: 13  STISSNATVPVTNSNTYTPNNNFQSCLANLRSQAIAAGVSGSTYDRYTQNLTPDYSVIDK 72

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
                        DYL GL   E +A G      +  +L    + YGVP   ++A+WG+E
Sbjct: 73  LNYQPE-FSTPIWDYLSGLVDEERVALGKQKLAQHRDVLNRASQVYGVPAETIVAVWGVE 131

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQ 198
           ++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++     G+  G  G 
Sbjct: 132 SNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGH 191

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY----------- 247
            QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW     +           
Sbjct: 192 TQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGWQTGMPWGFEVQIPAGMS 251

Query: 248 --QPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT 288
               G ++   L  W+      + +      IDG P+ +G  +
Sbjct: 252 IDGEGRRSKKPLSSWS-----ARGV----TRIDGSPLIQGPLS 285



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 307 KNFDAIYSYNAAESYGLAIAHLSDRLRGAGPFVSSWPT 344


>gi|260558069|ref|ZP_05830280.1| lytic murein transglycosylase B [Acinetobacter baumannii ATCC
           19606]
 gi|260408423|gb|EEX01730.1| lytic murein transglycosylase B [Acinetobacter baumannii ATCC
           19606]
          Length = 430

 Score =  195 bits (494), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 79/309 (25%), Positives = 130/309 (42%), Gaps = 33/309 (10%)

Query: 3   FKKYLLISLLMMVYPMLAQA---------VTQPKKATTQFICSDTADRFGEWKSAARARA 53
            +++  I   + +    AQA          +      T        + F    +  R++A
Sbjct: 1   MRRFSCIVGSVFLAMTQAQAELVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  T      +L    + I +             DYL GL   E +A G      
Sbjct: 61  IAAGVSGSTYDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVALGKQKLAQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L    + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF
Sbjct: 120 HRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFF 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS 
Sbjct: 180 ATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALAST 239

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           A FL K GW     +               G ++   L  W++              IDG
Sbjct: 240 ANFLNKAGWQTGMPWGFEVQIPAGMSIDGEGRRSKKPLSSWSSRGV---------TRIDG 290

Query: 280 VPIGKGYDT 288
            P+ +G  +
Sbjct: 291 SPLIQGPLS 299



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 321 KNFDAIYSYNAAESYGLAIAHLSDRLRGAGPFVSSWPT 358


>gi|332559599|ref|ZP_08413921.1| membrane bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides WS8N]
 gi|332277311|gb|EGJ22626.1| membrane bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides WS8N]
          Length = 417

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 88/326 (26%), Positives = 130/326 (39%), Gaps = 59/326 (18%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
            ++Q      +A    +          W    R RA+  G+ P T    F DL Y    +
Sbjct: 23  TVSQRPAARAEAAVTEVERAAQAGLEAWVIQFRPRALAAGIRPTTFAAAFRDLRYDADAV 82

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
           ARDR        +  DYLD   S   IA G A    +  LL  ++  YGVP  I++A+WG
Sbjct: 83  ARDRNQAE-FNRTLWDYLDSAVSETRIAGGRAALVQHGALLGRIEARYGVPKEIVVAVWG 141

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEI 196
           +ET +G   G  PL+  LATLA+D RRA+FF EQ   AL ++  G +      G+  G +
Sbjct: 142 METSYGTRRGDHPLVGALATLAHDGRRARFFEEQLIAALKILDNGDVRPEAMTGSWAGAM 201

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGW-------------- 241
           G  QF+P + + +A+D   DG+ D+      DA+AS A +LAK GW              
Sbjct: 202 GHTQFMPTSYLDFAVDFTGDGRRDIWSDDPSDALASTAAYLAKSGWRSGEPWGVEVRLPA 261

Query: 242 ------------TKCAGYQP------------------------------GEKNFAILKH 259
                          A ++                                  NF  +  
Sbjct: 262 GFDFARSGKSLRQPAARWEALGVRRVDGSPLPAGEAALLLPAGAQGAAFLIYPNFRAIAR 321

Query: 260 WNASLNYNKTIAYIAAHIDGVPIGKG 285
           +N +  Y   + ++A  + G P   G
Sbjct: 322 YNPADAYVIGVGHLADRLKGAPAIAG 347


>gi|91793495|ref|YP_563146.1| lytic murein transglycosylase [Shewanella denitrificans OS217]
 gi|91715497|gb|ABE55423.1| Lytic murein transglycosylase [Shewanella denitrificans OS217]
          Length = 437

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 87/336 (25%), Positives = 138/336 (41%), Gaps = 71/336 (21%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTA 63
           K++ ++  L ++  +L  + T               D F    +  +  A + G+S    
Sbjct: 39  KRFSVLLSLGVMASLLGSSSTLAA-----------NDEFSLCVNKLQDTARQRGVSEHII 87

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
           +   A ++++D  IA D +       SF DY +   +   + QG      +  LL  L +
Sbjct: 88  ESSLAKVKFVDKVIALDGQQPE-FSTSFADYFEKRVTPWRVEQGRKYFAIHRELLNQLTQ 146

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
           +YGVP   +MA WGLET+FG   G  P+L +LATLA + RRA++FT +   AL L +K  
Sbjct: 147 KYGVPGQYIMAFWGLETNFGSYKGSMPVLDSLATLACNPRRAEYFTAELMQALKLQEKYQ 206

Query: 184 IS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
            +    +G+  G +G  QF+P     +A+D D DGK+DL  S  D + SAA FL  LGW 
Sbjct: 207 FNSRDMVGSWAGAMGHTQFMPTTYANHAVDGDGDGKVDLWNSVADGLTSAANFLHSLGWK 266

Query: 243 KCAGYQP-------------GEKNFAILKHW----------------------------- 260
           +   +               G K+   L+ W                             
Sbjct: 267 ENERWGREVILPTNYSYEYLGSKDVLALEKWASLNIRQVNNAPLNVADMQAALYLPAGHS 326

Query: 261 ----------------NASLNYNKTIAYIAAHIDGV 280
                           N S  Y  ++ ++A  I+G 
Sbjct: 327 GPAFLGYHNFDVIMRWNRSEFYAISVGHLADRINGA 362


>gi|23499837|ref|NP_699277.1| transglycosylase [Brucella suis 1330]
 gi|161620160|ref|YP_001594046.1| lytic murein transglycosylase [Brucella canis ATCC 23365]
 gi|254702504|ref|ZP_05164332.1| lytic murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|260568590|ref|ZP_05839059.1| lytic murein transglycosylase [Brucella suis bv. 4 str. 40]
 gi|261753077|ref|ZP_05996786.1| lytic Murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|23463407|gb|AAN33282.1| transglycosylase, putative [Brucella suis 1330]
 gi|161336971|gb|ABX63275.1| lytic murein transglycosylase [Brucella canis ATCC 23365]
 gi|260155255|gb|EEW90336.1| lytic murein transglycosylase [Brucella suis bv. 4 str. 40]
 gi|261742830|gb|EEY30756.1| lytic Murein transglycosylase [Brucella suis bv. 3 str. 686]
          Length = 408

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 71/335 (21%), Positives = 123/335 (36%), Gaps = 67/335 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L I +   V   +  A      A            F +W +  R  A++ G++P T  
Sbjct: 10  KKLRIKIAATVALAIIGASLSAGTALA-------DAGFRQWIANFRPVAIKSGIAPSTFD 62

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +   D  +    +          +Y+D   + + +A    + +   + L  ++  
Sbjct: 63  RAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVSQNMARKWGQWLQRIEHH 122

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLV 179
           Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ ++
Sbjct: 123 YSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKIL 182

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G I      G+  G +G  QF+P +   Y +D D +GK D+  S  DA+ +AA  L +
Sbjct: 183 QTGDIERGHLSGSWAGALGHTQFIPTSYQAYTVDMDGNGKRDIWNSVPDALGTAANLLHR 242

Query: 239 LGWTKCAGYQPG-------------------------EKNFAI----------------- 256
            GW     +                              N                    
Sbjct: 243 NGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGHQ 302

Query: 257 ------------LKHWNASLNYNKTIAYIAAHIDG 279
                       LK +N +  Y   +  +A  I G
Sbjct: 303 GPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|24373558|ref|NP_717601.1| membrane-bound lytic transglycolase-related protein [Shewanella
           oneidensis MR-1]
 gi|24347876|gb|AAN55045.1|AE015642_5 membrane-bound lytic transglycolase-related protein [Shewanella
           oneidensis MR-1]
          Length = 433

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 79/232 (34%), Positives = 120/232 (51%), Gaps = 2/232 (0%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
            + Q     ++     I +  A  F    +  + RA REG+S +T  +  A L+++   I
Sbjct: 39  AIVQTQAAAQEVQLNEIITSHAAAFPTCVTNLQKRARREGLSEETINNTVASLQFVPKVI 98

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
             D+        +F +Y    ++   + +G  L K +  LL  L ++YGVPP  +++ WG
Sbjct: 99  EFDQSQPE-FSQTFTNYFTKRATDWRVNEGRRLLKKHRVLLEQLAQQYGVPPQYILSFWG 157

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFGEI 196
           LET++G   GK  +L +LATLA + RR+ +FT +   AL L +K G      +G+  G +
Sbjct: 158 LETNYGSYKGKMSVLDSLATLACEPRRSDYFTTELMQALKLKEKYGFDKRTMVGSWAGAM 217

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           G  QF+P    KYAID D DGK DL  S  DA+ SAA FL  LGW +   + 
Sbjct: 218 GHTQFMPSAYAKYAIDGDGDGKADLWNSTEDALTSAANFLQHLGWQRNERWG 269


>gi|238765468|ref|ZP_04626388.1| Lytic murein transglycosylase [Yersinia kristensenii ATCC 33638]
 gi|238696325|gb|EEP89122.1| Lytic murein transglycosylase [Yersinia kristensenii ATCC 33638]
          Length = 355

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 72/243 (29%), Positives = 121/243 (49%), Gaps = 8/243 (3%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
                +F  +    +++A  +G++  T    FA++ ++D  I  DR  +    V+  DYL
Sbjct: 54  GRDPAQFPAYIEKLKSQARAQGITEATLDIAFANIHFVDRVIQSDRNQLEK-KVTLDDYL 112

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             + +   IAQG  + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L
Sbjct: 113 AKVLTPSKIAQGREIYQRYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVISAL 172

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +TLA++ RR  FFT++   AL ++++G +      G+  G +GQ QF+P + + Y  D D
Sbjct: 173 STLAFEGRREAFFTKELMAALKIIQQGRVEDPQLKGSWAGAMGQSQFMPSSFLTYGADGD 232

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK---NFA-ILKHWNASLNYNKTI 270
            DGK+D+  +  D  AS A +L+  GW     +    +   NF   L     S    KT+
Sbjct: 233 GDGKVDIWNNIDDVFASTANYLSTEGWKPGMDWGQEAQLPENFNIALAGLKDSQ--AKTV 290

Query: 271 AYI 273
              
Sbjct: 291 TQW 293


>gi|229515338|ref|ZP_04404798.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae TMA
           21]
 gi|229348043|gb|EEO13002.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae TMA
           21]
          Length = 323

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 74/328 (22%), Positives = 135/328 (41%), Gaps = 72/328 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L  A++ P  A            F ++    + +A  EG+S +     F D+EY 
Sbjct: 4   LLSIVLGLALSAPVLANEV--------SFEQYVERLKQQAREEGISERILNEAFRDVEYK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             ++  D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 56  PRSVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYTELQRIGKQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 115 ALWGVESNFGAFTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPEAMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W----- 241
            G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ G      W     
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGWNDKYTWGRQVK 234

Query: 242 --------------TKCAGYQPGEK----------------------------------- 252
                          K    Q   K                                   
Sbjct: 235 IPKGFDHTLEGRQSEKGKTLQEWSKLGVTRYDGKPLPALSDDIKAWLIMPDDEAGRIYLV 294

Query: 253 --NFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSHYFALAVSHLADRIA 322


>gi|294625350|ref|ZP_06703986.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292600368|gb|EFF44469.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 425

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 79/287 (27%), Positives = 129/287 (44%), Gaps = 10/287 (3%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTA------DRFGEWKSAARARAVRE 56
            +  L +S+ +    + AQA+     A++    S           F +W +  R RA+  
Sbjct: 8   LRLSLGVSVCVAATSVAAQAIAPQTTASSATEVSAQQQDPAPTASFEQWLADFRQRALAA 67

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+   T  +  A +    +    D++          DYLD   +   I +G  L  +   
Sbjct: 68  GIEATTLDNALAGVTPDPSVHELDQQQPE-FTQYLWDYLDARVTPSAIQEGQQLLISQHA 126

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA++ RR  +   Q   AL
Sbjct: 127 LFQKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLAHEGRRTTYGNTQLLAAL 186

Query: 177 D--LVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
                +K +  S  +G+  G +GQ QF+P     YA+D D D K D+  S  DA+ SAA 
Sbjct: 187 QILQTEKNIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKRDVWNSKADALGSAAN 246

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           +L +  WT    +    +  A   +  A L   KT+A     +   P
Sbjct: 247 YLKQSNWTSAVPWGQEVQLSAGFDYAQADLTIKKTVAEW-RRLGVAP 292



 Score = 44.1 bits (102), Expect = 0.021,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 11/29 (37%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  +  +N S  Y   +  +A    G 
Sbjct: 322 DNFRSILRYNNSTAYALAVGLLADGYAGR 350


>gi|163758871|ref|ZP_02165958.1| putative membrane-bound lytic murein transglycosylase protein
           [Hoeflea phototrophica DFL-43]
 gi|162284161|gb|EDQ34445.1| putative membrane-bound lytic murein transglycosylase protein
           [Hoeflea phototrophica DFL-43]
          Length = 393

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 76/311 (24%), Positives = 132/311 (42%), Gaps = 63/311 (20%)

Query: 31  TQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPV 89
              + +     F +W ++  + A + G++  T    F  +       + + R        
Sbjct: 8   AAPLPAKADAGFRQWVASFYSTAAKSGITQATYNAAFNGVTAPDPRVLEKARFQPE-FTT 66

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
              DYLD   +   IA+G  ++  ++R L  +++++G+   +L+A+W +E++FGE + KT
Sbjct: 67  KVWDYLDSRVNPYTIAKGREMQARHARTLAAIERKFGIDASVLLAIWSMESNFGEILTKT 126

Query: 150 P----LLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLP 203
                +   LATLAY D +RAKF  +Q   AL +++ G I++    G+  G +G  QF+P
Sbjct: 127 DRLHYVPQALATLAYGDRKRAKFARQQLVAALKILQSGDIAAREMTGSWAGAMGHTQFIP 186

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--------------- 248
            + + +A+DAD +G  D+  S  DA+A+AA  L K GW     +                
Sbjct: 187 TSYLAFAVDADGNGHRDIWNSIPDALATAANLLKKNGWRTGETWGYESIAPRGGSKYEGQ 246

Query: 249 -------------------------------PGEKN---------FAILKHWNASLNYNK 268
                                          PG  N         F +LK +N S +Y  
Sbjct: 247 TKTLSQWAALGFTRPGGKGFPVGNRRAELKMPGGANGPAFLMTKNFFVLKRYNNSDSYAL 306

Query: 269 TIAYIAAHIDG 279
            +  +A  I G
Sbjct: 307 AVGVLADEIAG 317


>gi|294664919|ref|ZP_06730235.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292605319|gb|EFF48654.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 425

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 76/288 (26%), Positives = 129/288 (44%), Gaps = 12/288 (4%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTA------DRFGEWKSAARARAVRE 56
            +  L +S+ +    + AQA+     A++    S           F +W +  R RA+  
Sbjct: 8   LRLSLGVSVCVAATSVAAQAIAPETTASSATEVSAQQQDPAPTASFEQWLADFRQRALAA 67

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+   T  +  A +    +    D++          DYLD   +   I +G  L  +   
Sbjct: 68  GIEATTLDNALAGVTPDPSVHELDQQQPE-FTQYLWDYLDARVTPSAIQEGQQLLISQHA 126

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA++ RR  +   Q   AL
Sbjct: 127 LFQKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLAHEGRRTTYGNTQLLAAL 186

Query: 177 DL--VKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            +   +K +  S  +G+  G +GQ QF+P     YA+D D D K D+  S  DA+ SAA 
Sbjct: 187 QILRTEKNIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKRDVWNSKADALGSAAN 246

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASL-NYNKTIAYIAAHIDGVP 281
           +L +  WT    +    +  +    +  +     KT+A     +   P
Sbjct: 247 YLKQSNWTSAVPWGQEVQ-LSAGFDYAQADLTIKKTVAEW-QRLGVAP 292



 Score = 44.5 bits (103), Expect = 0.019,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 11/29 (37%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  +  +N S  Y   +  +A    G 
Sbjct: 322 DNFRSILRYNNSTAYALAVGLLADGYAGR 350


>gi|163803644|ref|ZP_02197508.1| putative lytic murein transglycosylase [Vibrio sp. AND4]
 gi|159172554|gb|EDP57415.1| putative lytic murein transglycosylase [Vibrio sp. AND4]
          Length = 323

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 78/335 (23%), Positives = 136/335 (40%), Gaps = 77/335 (22%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
              I  +M+   M   A               ++D F E+ +  RA A  +G+S +    
Sbjct: 1   MKKILAVMLSLGMCTSAFA-------------SSDGFDEYLNKLRAEARNKGISEQVISA 47

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
            FAD++Y    +  DR       ++  +Y+        + Q   L K +   L  +  E+
Sbjct: 48  AFADVQYKPHAVKADRNQPEK-KLTLDEYIPRAVPKWKVKQAKQLYKEHYAELKRIGDEF 106

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GV P  ++ALWG+E++FG+  G   ++  L+T+A++ RR +FF ++   AL ++ +G I 
Sbjct: 107 GVQPRFIVALWGVESNFGKFTGNYRVIDALSTMAFEGRREEFFRKETMAALQILDEGHIE 166

Query: 186 -SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG---- 240
             +  G+  G +GQ QF+P + +++A D + DGK D+ +S  D  AS A +L+K G    
Sbjct: 167 LKNFKGSWAGAMGQCQFMPSSFLRFAADGNGDGKKDIWQSEADVFASTANYLSKSGWDDT 226

Query: 241 --W-------------------TKCAGYQPGEK--------------------------- 252
             W                    K    Q   K                           
Sbjct: 227 FTWGRQVKVPHGIDPSLQGRKAQKGKYLQEWSKLGITQYDGSPLPKLDEDIKAWLIMPDD 286

Query: 253 ----------NFAILKHWNASLNYNKTIAYIAAHI 277
                     N+ +L  WN S  +   ++++A  I
Sbjct: 287 ENGRTYLVYNNYNVLMKWNRSYYFALAVSHLADRI 321


>gi|323498253|ref|ZP_08103255.1| putative lytic murein transglycosylase [Vibrio sinaloensis DSM
           21326]
 gi|323316681|gb|EGA69690.1| putative lytic murein transglycosylase [Vibrio sinaloensis DSM
           21326]
          Length = 321

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 62/231 (26%), Positives = 114/231 (49%), Gaps = 2/231 (0%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
           ++    AT       +   F ++    +  A  +G+S +     FA++E+    +  DR 
Sbjct: 5   LSVVLGATLASSVWASEPGFEQYIEKLKNEARDKGISEQVISQAFANVEHKPRAVKADRN 64

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                 ++  +Y+        + Q   L K + + L  + KEYGV P  ++ALWG+E++F
Sbjct: 65  QPEK-KLTLDEYIPRAVPDWKVKQARDLYKKHYKELQRIGKEYGVQPRFIVALWGVESNF 123

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQF 201
           G   G   ++  L+T+AYD RR  FF ++   AL ++++G ++     G+  G +GQ QF
Sbjct: 124 GRFTGNYRVIDALSTMAYDGRREAFFRKEAMAALQILEEGHVAYEDFKGSWAGAMGQCQF 183

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
           +P + + +A D + DG+ D+  +  D  AS A +L++ GW     +    K
Sbjct: 184 MPSSFLSFAADGNGDGRKDIWNTKADVFASTANYLSQSGWEDGFTWGRQVK 234



 Score = 39.5 bits (90), Expect = 0.57,   Method: Composition-based stats.
 Identities = 7/27 (25%), Positives = 14/27 (51%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHI 277
             N+ +L  WN S  +   ++++A  I
Sbjct: 293 YNNYNVLMKWNRSYYFALAVSHLADRI 319


>gi|153826382|ref|ZP_01979049.1| lytic murein transglycosylase, putative [Vibrio cholerae MZO-2]
 gi|149739860|gb|EDM54051.1| lytic murein transglycosylase, putative [Vibrio cholerae MZO-2]
          Length = 323

 Score =  194 bits (493), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 74/328 (22%), Positives = 135/328 (41%), Gaps = 72/328 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L  A++ P  A            F ++    + +A  EG+S +     F D+EY 
Sbjct: 4   LLSIVLGLALSAPVLANEV--------SFEQYVERLKQQAREEGISERILNEAFRDVEYK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             ++  D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 56  PRSVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYTELQRIGKQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 115 ALWGVESNFGAFTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPEAMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W----- 241
            G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ G      W     
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWGRQVK 234

Query: 242 --------------TKCAGYQPGEK----------------------------------- 252
                          K    Q   K                                   
Sbjct: 235 IPKGFDHALEGRQPEKGKTLQEWSKLGVTRYDGKPLPALSDDIKAWLIMPDDEAGRIYLV 294

Query: 253 --NFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSHYFALAVSHLADRIA 322


>gi|296535555|ref|ZP_06897736.1| membrane-bound lytic murein transglycosylase B [Roseomonas
           cervicalis ATCC 49957]
 gi|296264071|gb|EFH10515.1| membrane-bound lytic murein transglycosylase B [Roseomonas
           cervicalis ATCC 49957]
          Length = 323

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 73/298 (24%), Positives = 123/298 (41%), Gaps = 60/298 (20%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
            + F  +       A  +G+SP   +  FADL      +  DR+      ++++ Y DG 
Sbjct: 26  QESFEAFLRGVSREAEGQGVSPALLRRAFADLAPNQRVLELDRRQAE-FTLTWERYRDGR 84

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
              + I QG  + + ++ LL  +   Y V P I++A+WGLET++G   G    +  LATL
Sbjct: 85  LVPQRIGQGRRMAEQHAELLQRISARYAVSPRIILAVWGLETNYGGFTGSFSTIQALATL 144

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A+D RR  FF  +   AL ++++G ++     G+  G +G  QF+P +    A+D D DG
Sbjct: 145 AWDGRRRAFFRRELLAALQILEQGDVTPEKMRGSHAGAMGHPQFMPTSFQALAVDFDGDG 204

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGY------------------------------ 247
           + D+  S  DA+AS A +L+  GW     +                              
Sbjct: 205 RRDIWDSRADALASIAHYLSHHGWRGDERWGREVTLPPGFDTSQAGRDTRRPLRDWLSQG 264

Query: 248 ----------------------QPGEKNFA------ILKHWNASLNYNKTIAYIAAHI 277
                                  PG + FA      +++ +N S  Y   I  ++  +
Sbjct: 265 IAAADGSELPPLEMETSILLPGGPGGQAFAVYPNFHVIRRYNPSDFYALAIGLLSDQV 322


>gi|312112921|ref|YP_004010517.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218050|gb|ADP69418.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
          Length = 418

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 88/340 (25%), Positives = 137/340 (40%), Gaps = 61/340 (17%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M     L +   +    + +  V       +   CS ++  F  W S  +A A  +G+S 
Sbjct: 10  MMLDWRLAMRRSVSRMMIASLLVAASASGASAAPCSTSSAGFDRWLSQFKAEARSQGLSS 69

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK-ANSRLLI 119
           +        + +  + I +DR   +    SF ++ D +++   I +   L      R   
Sbjct: 70  RAL-SALDGVTFDQSVINKDRGQ-SVFSQSFLEFSDRMAAKYRIEKARQLIGGKYKREFD 127

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
             ++E+GVP  I+ A W LET FG   G    + +LATLAYDCRR + F E+    L ++
Sbjct: 128 RAEREFGVPGAIISAFWALETDFGANNGNMETVRSLATLAYDCRRPEKFREELLDVLKII 187

Query: 180 KKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
            +G +S+    G   GE+GQ QF+P   +KY ID D DG  DL++S  D I S+A +L  
Sbjct: 188 DRGDLSASEMRGPWAGELGQTQFVPSVYLKYGIDYDGDGHADLIRSAPDVIGSSANYLKA 247

Query: 239 LGWTKCAGY------------------------------------------------QPG 250
           LGW +   +                                                 P 
Sbjct: 248 LGWRRGEPWLKEVRVPESMDWSQADLTIQHPLSEWQRMGVQLSGAERVNGDLPASLLLPM 307

Query: 251 EKNFAILKHWNA---------SLNYNKTIAYIAAHIDGVP 281
            +N      ++          SL Y  T+AY+A  IDG P
Sbjct: 308 GRNGPAFLAFDNFKVFLEWNQSLIYATTVAYLATRIDGAP 347


>gi|306845309|ref|ZP_07477884.1| lytic murein transglycosylase [Brucella sp. BO1]
 gi|306274225|gb|EFM56037.1| lytic murein transglycosylase [Brucella sp. BO1]
          Length = 412

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 74/336 (22%), Positives = 128/336 (38%), Gaps = 69/336 (20%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTA 63
           K  + I+  M +  + A   T    A           RF +W +  R  A++ G++P T 
Sbjct: 11  KLRIKIAATMALAIIGASLSTGTALA---------DARFRQWIANFRPVAIKSGIAPSTF 61

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
              F  +   D  +    +          +Y+D   + + +A G  + +   + L  ++ 
Sbjct: 62  DRAFRGVNEPDPVVLEKARYQPEFTEPVWNYIDNRVNEQSVAVGQNMARKWGQWLQRIEH 121

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDL 178
            Y V   IL+A+W +E+++GE + +  ++     +LATLAY D RRAK+   Q   A+ +
Sbjct: 122 HYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRSLATLAYADARRAKYGRTQLIAAMKI 181

Query: 179 VKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLA 237
           ++ G I      G+  G +G  QF+P +   YA+D D +GK D+  S  DA+ +AA  L 
Sbjct: 182 LQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVDMDGNGKRDIWNSVPDALGTAANLLH 241

Query: 238 KLGWTKCAGYQPG-------------------------EKNFAI---------------- 256
           + GW     +                              N                   
Sbjct: 242 RNGWQPGRTWGYEVMLPAGRKFPSGSLTIAEWQQIGLVRANGRAFPDPHEKATLKVPDGH 301

Query: 257 -------------LKHWNASLNYNKTIAYIAAHIDG 279
                        LK +N +  Y   +  +A  I G
Sbjct: 302 QGPAFLMTKNFFVLKRYNNADKYALAVGLLADRIGG 337


>gi|110677589|ref|YP_680596.1| transglycosylase, putative [Roseobacter denitrificans OCh 114]
 gi|109453705|gb|ABG29910.1| transglycosylase, putative [Roseobacter denitrificans OCh 114]
          Length = 451

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 67/222 (30%), Positives = 108/222 (48%), Gaps = 3/222 (1%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
           A      + +A  F  W +  + RA R+G+   T +  F  + +    I RDR       
Sbjct: 70  AEMALALATSAAEFDAWVAGFKDRAARQGIRSATLESAFQGVRFDSDVIRRDRNQSE-FT 128

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
            +   YL   +S   IA G A    +   L  +++ YGV   +++A+WGLE+ +G   G 
Sbjct: 129 KTIWQYLASAASDRRIANGKAALAKHRTTLEAIERRYGVEKEVVVAVWGLESGYGAYRGS 188

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVV 207
             ++ +LATLAY+ RR  FF EQ   AL +++ G  +  +  G+  G +G  QF+P + +
Sbjct: 189 NDVIRSLATLAYEGRRGAFFEEQLIAALKILQNGDTAPRNMTGSWAGAMGHTQFIPTSYL 248

Query: 208 KYAIDADEDGKIDLVK-SNIDAIASAAKFLAKLGWTKCAGYQ 248
            YA+D   DG+ D+      DA+AS A +L   GW     + 
Sbjct: 249 AYAVDFTGDGRRDIWSEDPTDALASTAAYLKNAGWKTGQPWG 290



 Score = 47.2 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHID-GVPIGKGYDT 288
            NFA ++ +NA+  Y   + +++  I  G PI   + T
Sbjct: 351 DNFAAIERYNAADAYVIGVGHLSDRIKGGGPIRSSWPT 388


>gi|311696248|gb|ADP99121.1| peptidoglycan binding domain protein [marine bacterium HP15]
          Length = 416

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 88/325 (27%), Positives = 138/325 (42%), Gaps = 61/325 (18%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           +++      ++ P  A  Q         F E K+  + +A+  G+S KTA  + + +++L
Sbjct: 18  LLFSGFLSCLSLPAIA--QDSAEVEPAGFAECKARLQEQAIAAGVSSKTASEVMSGVQHL 75

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              I  DR+       +F DYL+   +   +  G  L + +  LL  + +E GVP   L+
Sbjct: 76  ARVIELDRRQPE-FTTTFADYLNRRVNDARVNTGRELLQEHQELLARVTRETGVPAPYLV 134

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GAT 192
           A WGLET+FG   GK P+ S+L TLA D RR+ FFTEQ   AL ++ +G I +  + G+ 
Sbjct: 135 AFWGLETNFGSYFGKMPVPSSLTTLACDPRRSTFFTEQLIAALRIIDEGAIPADQMEGSW 194

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG-- 250
            G +G  QF+P   +K+A+DAD DG+ DL  S  DA+ SA +FL  + W     +     
Sbjct: 195 AGAMGHVQFMPTVFLKHAVDADGDGRRDLWNSLPDAMMSAGRFLESMNWDGDYRWGREVL 254

Query: 251 -EKNFA---------------------------------------------ILKHW---- 260
             +NF                                                  +    
Sbjct: 255 LPENFDYSLADGRRLPLEQWRKMGITDAFGKPLAREPINAALVVPAGHRGPAFLAYHNFR 314

Query: 261 -----NASLNYNKTIAYIAAHIDGV 280
                N S  Y   + ++A  I G 
Sbjct: 315 VIMGWNRSEFYAIAVGHLADRIAGA 339


>gi|297579466|ref|ZP_06941394.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297537060|gb|EFH75893.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 323

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 74/328 (22%), Positives = 135/328 (41%), Gaps = 72/328 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L  A++ P  A            F ++    + +A  EG+S +     F D+EY 
Sbjct: 4   LLSIVLGLALSAPVLANEV--------SFEQYVERLKQQAREEGISERILNEAFRDVEYK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             ++  D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 56  PRSVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYTELQRIGKQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 115 ALWGVESNFGAFTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPDAMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W----- 241
            G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ G      W     
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWGRQVK 234

Query: 242 --------------TKCAGYQPGEK----------------------------------- 252
                          K    Q   K                                   
Sbjct: 235 IPKGFDHALEGRQPEKGKTLQEWSKLGVTRYDGKPLPALSDDIKAWLIMPDDEAGRIYLV 294

Query: 253 --NFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSHYFALAVSHLADRIA 322


>gi|15641958|ref|NP_231590.1| lytic murein transglycosylase, putative [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121590657|ref|ZP_01677991.1| lytic murein transglycosylase, putative [Vibrio cholerae 2740-80]
 gi|121727829|ref|ZP_01680896.1| lytic murein transglycosylase, putative [Vibrio cholerae V52]
 gi|147673674|ref|YP_001217484.1| putative lytic murein transglycosylase [Vibrio cholerae O395]
 gi|153818746|ref|ZP_01971413.1| lytic murein transglycosylase, putative [Vibrio cholerae NCTC 8457]
 gi|153822438|ref|ZP_01975105.1| lytic murein transglycosylase, putative [Vibrio cholerae B33]
 gi|153829241|ref|ZP_01981908.1| putative lytic murein transglycosylase [Vibrio cholerae 623-39]
 gi|227082085|ref|YP_002810636.1| putative lytic murein transglycosylase [Vibrio cholerae M66-2]
 gi|229507952|ref|ZP_04397457.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae BX
           330286]
 gi|229511812|ref|ZP_04401291.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           B33]
 gi|229518949|ref|ZP_04408392.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           RC9]
 gi|229521870|ref|ZP_04411287.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae TM
           11079-80]
 gi|229529020|ref|ZP_04418410.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           12129(1)]
 gi|229607497|ref|YP_002878145.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           MJ-1236]
 gi|254286886|ref|ZP_04961838.1| lytic murein transglycosylase, putative [Vibrio cholerae AM-19226]
 gi|254849042|ref|ZP_05238392.1| lytic murein transglycosylase [Vibrio cholerae MO10]
 gi|255745292|ref|ZP_05419241.1| membrane-bound lytic murein transglycosylase B [Vibrio cholera CIRS
           101]
 gi|262156016|ref|ZP_06029136.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           INDRE 91/1]
 gi|298498010|ref|ZP_07007817.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9656495|gb|AAF95104.1| lytic murein transglycosylase, putative [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121547500|gb|EAX57606.1| lytic murein transglycosylase, putative [Vibrio cholerae 2740-80]
 gi|121629865|gb|EAX62279.1| lytic murein transglycosylase, putative [Vibrio cholerae V52]
 gi|126510709|gb|EAZ73303.1| lytic murein transglycosylase, putative [Vibrio cholerae NCTC 8457]
 gi|126520014|gb|EAZ77237.1| lytic murein transglycosylase, putative [Vibrio cholerae B33]
 gi|146315557|gb|ABQ20096.1| putative lytic murein transglycosylase [Vibrio cholerae O395]
 gi|148875279|gb|EDL73414.1| putative lytic murein transglycosylase [Vibrio cholerae 623-39]
 gi|150423036|gb|EDN14985.1| lytic murein transglycosylase, putative [Vibrio cholerae AM-19226]
 gi|227009973|gb|ACP06185.1| putative lytic murein transglycosylase [Vibrio cholerae M66-2]
 gi|227013853|gb|ACP10063.1| putative lytic murein transglycosylase [Vibrio cholerae O395]
 gi|229332794|gb|EEN98280.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           12129(1)]
 gi|229340795|gb|EEO05800.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae TM
           11079-80]
 gi|229343638|gb|EEO08613.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           RC9]
 gi|229351777|gb|EEO16718.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           B33]
 gi|229355457|gb|EEO20378.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae BX
           330286]
 gi|229370152|gb|ACQ60575.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           MJ-1236]
 gi|254844747|gb|EET23161.1| lytic murein transglycosylase [Vibrio cholerae MO10]
 gi|255737122|gb|EET92518.1| membrane-bound lytic murein transglycosylase B [Vibrio cholera CIRS
           101]
 gi|262030194|gb|EEY48838.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           INDRE 91/1]
 gi|297542343|gb|EFH78393.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|327484494|gb|AEA78901.1| Membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           LMA3894-4]
          Length = 323

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 74/328 (22%), Positives = 135/328 (41%), Gaps = 72/328 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L  A++ P  A            F ++    + +A  EG+S +     F D+EY 
Sbjct: 4   LLSIVLGLALSAPVLANEV--------SFEQYVERLKQQAREEGISERILNEAFRDVEYK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             ++  D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 56  PRSVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYTELQRIGKQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 115 ALWGVESNFGAFTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPEAMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W----- 241
            G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ G      W     
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWGRQVK 234

Query: 242 --------------TKCAGYQPGEK----------------------------------- 252
                          K    Q   K                                   
Sbjct: 235 IPKGFDHALEGRQPEKGKTLQEWSKLGVTRYDGKPLPALSDDIKAWLIMPDDEAGRIYLV 294

Query: 253 --NFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSHYFALAVSHLADRIA 322


>gi|85708664|ref|ZP_01039730.1| lytic murein transglycosylase [Erythrobacter sp. NAP1]
 gi|85690198|gb|EAQ30201.1| lytic murein transglycosylase [Erythrobacter sp. NAP1]
          Length = 349

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 68/252 (26%), Positives = 113/252 (44%), Gaps = 7/252 (2%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ K +  +++L+     L+ A T       Q   +     F  +    +ARA  EG+S 
Sbjct: 1   MTLKHFTSLAILIAASFGLSSAST---PTPAQAQVARDGIDFDAYLERIKARARGEGVSQ 57

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPP----VSFKDYLDGLSSSEIIAQGIALKKANSR 116
            T   + A L      I  D+    +P      +   Y+    +   IA G  + +A+  
Sbjct: 58  STIDRMTAGLTPNPRVIRLDQGQPGTPTRRGYPAMAPYIRTHVNPTRIAGGQRVYRAHVG 117

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
            L  +++EYGVP  I++A++G ET +G   G   L  +LATLA++ RR + F  ++   +
Sbjct: 118 QLRAVEREYGVPGEIIVAIFGHETSYGAITGNFDLSRSLATLAWEGRRRELFEGEWVALM 177

Query: 177 DLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
            +  KG      +G+  G  G  QFLP   ++ A D D DG+ D+  +  D  AS A + 
Sbjct: 178 KVADKGYSRGTLVGSYAGAFGNPQFLPSVYLRLAADGDGDGRADIFNNRADTFASIANYF 237

Query: 237 AKLGWTKCAGYQ 248
              GW     + 
Sbjct: 238 RDAGWRSGQPWG 249



 Score = 41.4 bits (95), Expect = 0.16,   Method: Composition-based stats.
 Identities = 7/35 (20%), Positives = 14/35 (40%)

Query: 243 KCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHI 277
             A       N+ ++  +N S  Y  ++  +A  I
Sbjct: 313 PGAPAYLLTSNYRVILEYNCSNYYAMSVGLLADEI 347


>gi|85860658|ref|YP_462860.1| membrane-bound lytic murein transglycosylase B [Syntrophus
           aciditrophicus SB]
 gi|85723749|gb|ABC78692.1| membrane-bound lytic murein transglycosylase B [Syntrophus
           aciditrophicus SB]
          Length = 432

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 87/328 (26%), Positives = 137/328 (41%), Gaps = 61/328 (18%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           L +   P  A  +  P           +  +F +  S     A+  G+S +T K     +
Sbjct: 26  LSVCFLPFAAFLLALPSPNAVADNAG-SMKQFQKCLSRLENTAIESGVSSQTVKSALESI 84

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
           ++L+  I  DR       ++F  YL+   +   + +G  +  A+  LL  +   YGVPP 
Sbjct: 85  QWLEDVIRADRSQPE-FHLTFWHYLESRVTDARVERGREMYHAHYNLLHKIYLRYGVPPH 143

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHAL 189
            L+ALWG+ET++G   G  PL+S LATLA   RR+  FT +F  AL + + G +  + + 
Sbjct: 144 YLVALWGMETNYGSNFGSVPLMSALATLACGRRRSNMFTREFISALLIQENGAMDLARSK 203

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ- 248
           G+  G IG  QFLP   +K+A+D+D+DG+IDL  S  DA ASAA +  + GW K   +  
Sbjct: 204 GSWAGAIGHMQFLPSTCLKHAVDSDKDGRIDLFGSLPDAFASAANYFHRSGWKKGKRWGR 263

Query: 249 ------------------------------------------------PGEKNFAILKHW 260
                                                           P   N      +
Sbjct: 264 EVLIPLNFNYVLAGLGTNKSVNEWRALGLVDASGEPLPESDIEGSLLLPMGHNGPAFLVY 323

Query: 261 ---------NASLNYNKTIAYIAAHIDG 279
                    NAS+++   + ++A  I G
Sbjct: 324 RNFHIIRKWNASISFALAVGHLADRIAG 351


>gi|326316822|ref|YP_004234494.1| lytic murein transglycosylase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323373658|gb|ADX45927.1| lytic murein transglycosylase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 471

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/259 (27%), Positives = 114/259 (44%), Gaps = 14/259 (5%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
                   F +W +  R  A++ G+ P+T        ++L   I  DR        +   
Sbjct: 94  SAEAEQAGFAQWIAGFRQEALQAGIRPETVAAALDGAQWLPQVIELDRSQPE-FTRTPWA 152

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           YLD   S   I +G  +       L +    YGVP  ++ A+WG+E+++G   G    + 
Sbjct: 153 YLDSAVSPTRIQRGRDVLAEQRAALDSAAARYGVPAEVITAIWGMESNYGSNFGSFRTVD 212

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
            LATLAY+ RR  +   +   AL ++ +G I++  + G+  G +G  QFLP   + YA+D
Sbjct: 213 ALATLAYEGRRRDWARGELLAALRIIDQGDIAADRMIGSWAGAMGHTQFLPSVFLGYAVD 272

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAY 272
           AD DG  D+  S  D  AS A FL+++GW     +    +       +  +      + +
Sbjct: 273 ADGDGHRDIWGSVPDVAASTANFLSRMGWQPGQPWGVEVR-LPPGFDYERAE---LAVRH 328

Query: 273 ----IAAH----IDGVPIG 283
                AA     IDG P+ 
Sbjct: 329 PSTQWAAEGVQSIDGQPLP 347



 Score = 51.0 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 16/30 (53%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
            NF ++  +N S+NY   +  +A  I G P
Sbjct: 369 PNFRVILRYNNSINYALGVGLLARQIAGGP 398


>gi|91227771|ref|ZP_01261998.1| putative lytic murein transglycosylase [Vibrio alginolyticus 12G01]
 gi|91188418|gb|EAS74713.1| putative lytic murein transglycosylase [Vibrio alginolyticus 12G01]
          Length = 300

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 71/257 (27%), Positives = 126/257 (49%), Gaps = 14/257 (5%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +++ F E+ +  RA A  +G+S +     FA++EY    +  DR       ++  +Y+  
Sbjct: 20  SSEGFDEYLNKLRAEARDKGISEQVISAAFANVEYKPRAVKADRNQPEK-KLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  EYGV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQARQLYKEHYTELKRIGDEYGVHPRFIVALWGVESNFGKFTGNFKVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I   +  G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMSALQILDQGHIELENFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNAS--------LNYNK 268
           GK D+ +S  D  AS A +L+K GW     +    K    +     S          Y +
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGWDDKYTWGRQVKVPKNIDR---SLEGRTAEKGKYLQ 255

Query: 269 TIAYIA-AHIDGVPIGK 284
             + +     DG P+ K
Sbjct: 256 EWSQLGITKYDGSPLPK 272


>gi|318605527|emb|CBY27025.1| membrane-bound lytic murein transglycosylase B [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|330863463|emb|CBX73581.1| hypothetical protein YEW_EH18230 [Yersinia enterocolitica W22703]
          Length = 356

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 75/254 (29%), Positives = 126/254 (49%), Gaps = 11/254 (4%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
                +F  +    +A+A  +G+S  T    FA++ ++D  I  DR  +    V+  DYL
Sbjct: 55  GRDPAQFPAYVEQLKAQARAQGISEATLAVAFANIHFVDRVIQSDRNQLEK-KVTLDDYL 113

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             + +   IAQG  + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L
Sbjct: 114 AKVLTPSKIAQGKEIYQHYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVVSAL 173

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +TLA++ RR  FFT++   AL ++++G +      G+  G +GQ QF+P + + Y  D D
Sbjct: 174 STLAFEGRREAFFTKELIAALKIIQQGRVEDPQLKGSWAGAMGQSQFMPSSFLTYGADGD 233

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNAS-----LNYNKT 269
            DGK+D+  +  D  AS A +L+  GW    G+    +       +N +      +  KT
Sbjct: 234 GDGKVDIWNNIDDVFASTANYLSAEGWKPGIGWGQEAQLPD---GFNVALAGLKDSQAKT 290

Query: 270 IAYIAAHIDGVPIG 283
           +A     +   P G
Sbjct: 291 VAQW-QQLGVAPKG 303


>gi|238794482|ref|ZP_04638091.1| Lytic murein transglycosylase [Yersinia intermedia ATCC 29909]
 gi|238726165|gb|EEQ17710.1| Lytic murein transglycosylase [Yersinia intermedia ATCC 29909]
          Length = 360

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 71/234 (30%), Positives = 118/234 (50%), Gaps = 2/234 (0%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
           ML           T         +F  +    +A+A  +G+S  T    FA++ ++D  I
Sbjct: 39  MLNPPAANSSTKMTLSQQGRDPAQFPAYVEQLKAQARAKGISDATLDKAFANIHFVDRVI 98

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
             DR  +    V+  DYL+ + +   +AQG  + +     L  +   YGVP   ++ALWG
Sbjct: 99  QSDRNQLEK-KVTLDDYLNKVLTDAKVAQGKEIYQRYQPQLSQVTARYGVPERYIVALWG 157

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEI 196
           +E+ FG+  GK  ++S L+T+A++ RR  FFT++   AL ++++G +      G+  G +
Sbjct: 158 MESGFGKFQGKEDVISALSTMAFEGRREAFFTKELIAALQIIQQGKVDDPELKGSWAGAM 217

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           GQ QF+P + + Y  D D DGKID+  +  D  AS A +L+  GWT    +   
Sbjct: 218 GQSQFMPSSFLTYGADGDGDGKIDIWNNIDDVFASTANYLSTEGWTPGIDWGQE 271


>gi|293395844|ref|ZP_06640126.1| type III effector HopAJ2 [Serratia odorifera DSM 4582]
 gi|291421781|gb|EFE95028.1| type III effector HopAJ2 [Serratia odorifera DSM 4582]
          Length = 320

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/226 (30%), Positives = 114/226 (50%), Gaps = 2/226 (0%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
                 TT          F  +  A + +AV +G+  +T    FA++ ++D  I  DR  
Sbjct: 5   PTAPADTTLAQTGRDPAEFPAYVEALKRQAVAQGIDRQTVDSAFANVHFVDRVIKADRNQ 64

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
           +    ++   YL  + S   I QG  L +     L      YGVP   ++ALW +E+H+G
Sbjct: 65  LEK-KITLDVYLQRVLSPTKIQQGRQLLRQYQPQLARATARYGVPERYIVALWAMESHYG 123

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFL 202
           +  GK  ++S L+TLA++ RR  FF++Q   AL ++++G + +    G+  G +GQ QF+
Sbjct: 124 KIQGKEDVVSALSTLAFEGRREAFFSKQLMAALQIIQQGHVPAEQLTGSWAGAMGQCQFM 183

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           P + + Y  D D DG+ID+  +  D  AS A +LA  GW    G+ 
Sbjct: 184 PSSFLSYGADGDGDGRIDIWHNLDDVFASTANYLATEGWKPGIGWG 229


>gi|127513069|ref|YP_001094266.1| lytic murein transglycosylase [Shewanella loihica PV-4]
 gi|126638364|gb|ABO24007.1| lytic murein transglycosylase [Shewanella loihica PV-4]
          Length = 395

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 81/239 (33%), Positives = 120/239 (50%), Gaps = 11/239 (4%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           LL     +LA  +                  F    SA + +A+  G+S KT +     +
Sbjct: 4   LLTFASLILATGLPSLSALAQ---------DFDTCVSALKQKALAAGVSSKTVEEGLGQV 54

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
           +Y+   I  D+K       +F +Y     +   + +G  L K + +LL  L++EYG+PP 
Sbjct: 55  KYVARVIELDKKQPE-FSQTFDNYFSKRVTDWRVQEGRRLLKQHGQLLHKLQQEYGIPPQ 113

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHAL 189
            L+A WGLET+FG   GK P++ +L TLA D RR+ +FT +   AL L +      +   
Sbjct: 114 YLVAFWGLETNFGSYKGKMPVIDSLTTLACDPRRSDYFTGELIQALKLKEAYQFDNAQMQ 173

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           G+  G +G  QF+P    KYA+DAD DGK DL  S  DA++SAA FL  LGW +   + 
Sbjct: 174 GSWAGAMGHTQFMPSAYAKYAVDADGDGKADLFNSTQDALSSAANFLNNLGWMRNERWG 232


>gi|170740321|ref|YP_001768976.1| hypothetical protein M446_2079 [Methylobacterium sp. 4-46]
 gi|168194595|gb|ACA16542.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 266

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 95/247 (38%), Positives = 133/247 (53%), Gaps = 10/247 (4%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
            C +    F  WK      A     S  + + L     Y   TIA DR   +   +S + 
Sbjct: 29  QCGNGPGGFEAWKREFAEEARGRA-SAASLQALM-GTSYSSPTIAADRGQKS-FRLSLEQ 85

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           ++       I+++G AL+ +N+ L   +++ YGVPPG L+A+WG+ET FG   G    LS
Sbjct: 86  FMAKRGGPAIVSRGRALRASNAALFAGIEQRYGVPPGPLLAIWGMETGFGAVKGNVNTLS 145

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
            +ATLAYDCRR+ +FT+Q + AL L+ +GV+S    GA  GE+G  QFLP NV+ Y    
Sbjct: 146 AVATLAYDCRRSAYFTDQLYAALALIDRGVMSPSTRGAAHGEVGHTQFLPKNVLNYGTGG 205

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
             D       +  +A+ S A FL   GW + AGYQPGE NFA ++ WNA+  Y + IA I
Sbjct: 206 SLD-------NVSNALNSTANFLRAHGWQRGAGYQPGEPNFAAIQGWNAASVYQRAIAII 258

Query: 274 AAHIDGV 280
              IDG 
Sbjct: 259 GKRIDGG 265


>gi|163743754|ref|ZP_02151128.1| peptidoglycan binding domain protein [Phaeobacter gallaeciensis
           2.10]
 gi|161383015|gb|EDQ07410.1| peptidoglycan binding domain protein [Phaeobacter gallaeciensis
           2.10]
          Length = 448

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 67/226 (29%), Positives = 110/226 (48%), Gaps = 4/226 (1%)

Query: 25  QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
            P  A      +     F  W +A R RA  EG+S  T     + +E+    + RD    
Sbjct: 64  APAPAEPGVSPAKQRA-FEGWIAAFRPRARAEGLSQATLDRALSGVEFDPKIVQRDGNQS 122

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
                    YL+   S   I  G A  + +++ L  ++ +YGV   ++ A+WG+E+++G 
Sbjct: 123 E-FVTPIWTYLERAVSDARIQNGKAALRDHAQTLARIEAKYGVDREVVAAVWGMESNYGT 181

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLP 203
             G+  ++ +LATLA+D RR  FF  Q   AL +++ G ++     G+  G +G  QF+P
Sbjct: 182 FRGERDIIRSLATLAFDGRRGAFFESQLIAALQILQAGDVTPEAMTGSWAGAMGHTQFMP 241

Query: 204 VNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
            + + YA+D   DGK D+      DA+AS A +L + GW K   + 
Sbjct: 242 TSYLAYAVDFTGDGKRDIWSDDPADALASTAAYLKRFGWVKDQPWG 287



 Score = 45.2 bits (105), Expect = 0.010,   Method: Composition-based stats.
 Identities = 9/37 (24%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDG-VPIGKGY 286
            +NFA+++ +NA+  Y   + +++  + G  PI   +
Sbjct: 347 YRNFAVIERYNAADAYVIGVGHLSDRLRGTGPIRASW 383


>gi|332161545|ref|YP_004298122.1| putative lipoprotein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325665775|gb|ADZ42419.1| putative lipoprotein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 352

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 75/254 (29%), Positives = 126/254 (49%), Gaps = 11/254 (4%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
                +F  +    +A+A  +G+S  T    FA++ ++D  I  DR  +    V+  DYL
Sbjct: 51  GRDPAQFPAYVEQLKAQARAQGISEATLAVAFANIHFVDRVIQSDRNQLEK-KVTLDDYL 109

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             + +   IAQG  + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L
Sbjct: 110 AKVLTPSKIAQGKEIYQHYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVVSAL 169

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +TLA++ RR  FFT++   AL ++++G +      G+  G +GQ QF+P + + Y  D D
Sbjct: 170 STLAFEGRREAFFTKELIAALKIIQQGRVEDPQLKGSWAGAMGQSQFMPSSFLTYGADGD 229

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNAS-----LNYNKT 269
            DGK+D+  +  D  AS A +L+  GW    G+    +       +N +      +  KT
Sbjct: 230 GDGKVDIWNNIDDVFASTANYLSAEGWKPGIGWGQEAQLPD---GFNVALAGLKDSQAKT 286

Query: 270 IAYIAAHIDGVPIG 283
           +A     +   P G
Sbjct: 287 VAQW-QQLGVAPKG 299


>gi|163738128|ref|ZP_02145544.1| Lytic murein transglycosylase [Phaeobacter gallaeciensis BS107]
 gi|161388744|gb|EDQ13097.1| Lytic murein transglycosylase [Phaeobacter gallaeciensis BS107]
          Length = 448

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 67/226 (29%), Positives = 110/226 (48%), Gaps = 4/226 (1%)

Query: 25  QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
            P  A      +     F  W +A R RA  EG+S  T     + +E+    + RD    
Sbjct: 64  APAPAEPGVSPAKQRA-FEGWIAAFRPRARAEGLSQATLDRALSGVEFDPKIVQRDGNQS 122

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
                    YL+   S   I  G A  + +++ L  ++ +YGV   ++ A+WG+E+++G 
Sbjct: 123 E-FVTPIWTYLERAVSDARIQNGKAALRDHAQTLARIEAKYGVDREVVAAVWGMESNYGT 181

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLP 203
             G+  ++ +LATLA+D RR  FF  Q   AL +++ G ++     G+  G +G  QF+P
Sbjct: 182 FRGERDIIRSLATLAFDGRRGAFFESQLIAALQILQAGDVTPEAMTGSWAGAMGHTQFMP 241

Query: 204 VNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
            + + YA+D   DGK D+      DA+AS A +L + GW K   + 
Sbjct: 242 TSYLAYAVDFTGDGKRDIWSDDPADALASTAAYLKRFGWVKDQPWG 287



 Score = 45.2 bits (105), Expect = 0.011,   Method: Composition-based stats.
 Identities = 9/37 (24%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDG-VPIGKGY 286
            +NFA+++ +NA+  Y   + +++  + G  PI   +
Sbjct: 347 YRNFAVIERYNAADAYVIGVGHLSDRLRGTGPIRASW 383


>gi|15966561|ref|NP_386914.1| putative membrane-bound lytic murein transglycosylase protein
           [Sinorhizobium meliloti 1021]
 gi|307300402|ref|ZP_07580182.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
 gi|307318267|ref|ZP_07597702.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|15075832|emb|CAC47387.1| Membrane-bound lytic murein transglycosylase precursor
           [Sinorhizobium meliloti 1021]
 gi|306895949|gb|EFN26700.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|306904568|gb|EFN35152.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
          Length = 405

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 76/309 (24%), Positives = 123/309 (39%), Gaps = 63/309 (20%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPVSF 91
              +     F  W +   A A + G+S  T +  FA ++      + +            
Sbjct: 24  SSPARADQGFQNWINNFYATAAKNGISQATYRKAFAGVKTPDPAVLEKAAYQPE-FKHKI 82

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP- 150
            +Y+D   +      G  +   ++R L  L++ YGV   IL+A+W +E+++G  + K   
Sbjct: 83  WEYVDARVNPYTKRIGQEMAAKHARTLNALERHYGVDKSILLAIWSMESNYGAILQKDDR 142

Query: 151 ---LLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVN 205
              +   LATLAY D RR+KF   Q   AL +++ G I+     G+  G +G  QF+P +
Sbjct: 143 LHYVPRALATLAYADSRRSKFAKTQLIAALKILQSGDITPRELTGSWAGAMGHTQFIPTS 202

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ----------------- 248
            + YA+DAD +G  D+  S  DA+A+AA  L K GW     +                  
Sbjct: 203 YLLYAVDADGNGHRDIWNSVPDALATAANLLRKNGWRPGETWGYEVVPPANGAKYSGQTK 262

Query: 249 -----------------------------PGEKN---------FAILKHWNASLNYNKTI 270
                                        PG  N         F ++K +NAS +Y   +
Sbjct: 263 TLGQWAALGFARPGGKGFSNPKMRAELKLPGGGNGPGFLMTKNFFVIKRYNASDSYALGV 322

Query: 271 AYIAAHIDG 279
             +A  I G
Sbjct: 323 GLLADQIAG 331


>gi|308049439|ref|YP_003913005.1| lytic murein transglycosylase [Ferrimonas balearica DSM 9799]
 gi|307631629|gb|ADN75931.1| lytic murein transglycosylase [Ferrimonas balearica DSM 9799]
          Length = 324

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 79/237 (33%), Positives = 120/237 (50%), Gaps = 2/237 (0%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           A+     + +    +  AD F ++ S  +  A  +G +P T    FAD++     I+ DR
Sbjct: 5   ALVAALLSVSASASAVDADGFSQYVSQLKQEAGEKGYAPATIDAAFADIKLFKRAISADR 64

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
                   +   YL        + +   L K +  LL  + K YGV P  ++ALWG+ET+
Sbjct: 65  NQPE-FKKTLDTYLPQAVPQWKVDKARKLYKEHRELLEEIGKAYGVQPRFIVALWGIETN 123

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQ 200
           FG   G  P+LST A+LAY+ RR  FF EQFF A+ ++ +G IS+    G+  G +GQ Q
Sbjct: 124 FGGYTGNYPVLSTTASLAYEGRREDFFKEQFFAAMTILDQGHISADAMRGSWAGAMGQTQ 183

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAIL 257
           F+P + + YA D D DG+ D+  S  D  ASAA +L+ +GW     +    K    +
Sbjct: 184 FMPTSFLSYAEDYDGDGRKDIWGSLPDVFASAANYLSNVGWQYNQTWARQVKLAQPV 240



 Score = 38.7 bits (88), Expect = 0.91,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 12/29 (41%)

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHID 278
              N+  L  WN S  +   + Y++  I 
Sbjct: 291 AYANYDALMRWNRSHYFAVAVGYLSDRIK 319


>gi|262377636|ref|ZP_06070856.1| lytic murein transglycosylase B [Acinetobacter lwoffii SH145]
 gi|262307395|gb|EEY88538.1| lytic murein transglycosylase B [Acinetobacter lwoffii SH145]
          Length = 430

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 81/349 (23%), Positives = 134/349 (38%), Gaps = 71/349 (20%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAV-------TQPKKATTQFICSDTADRFGEWKSAARARA 53
           M      + S+++      A+ +            +++      + + F    +  R++A
Sbjct: 1   MQRLALFIGSVVLAASQAQAELIINGQRVTPTDLTSSSNIPNYASQNNFQNCLANLRSQA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           V  G+S  T      +L    + I R             DYL GL   E +  G    + 
Sbjct: 61  VARGVSGSTYDRYTQNLNPDYSVIERLNYQPE-FSTPIWDYLSGLVDEERVQLGRQKLQQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L  +   YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF
Sbjct: 120 HREVLNRVAATYGVPAETVVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRGEFF 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + L+++G +      G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS 
Sbjct: 180 TTMKLLQRGDVREEQLKGSWAGAFGHTQFMPSTYDELAVDFDGDGRRDLVSSIPDALAST 239

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHW------------------- 260
           A FL+K GW     +               G +N   L  W                   
Sbjct: 240 ANFLSKRGWQSGQPWGFEVKIPQGMSVSGEGRRNKKSLSSWINQGVVRADGSALVQGNLS 299

Query: 261 ------------------------------NASLNYNKTIAYIAAHIDG 279
                                         NA+ +Y   IA+++  + G
Sbjct: 300 QSSQAGLLTPAGPSGPVFLVFKNFDAIYSYNAAESYALAIAHLSDRLQG 348


>gi|240137544|ref|YP_002962015.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
 gi|240007512|gb|ACS38738.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
          Length = 254

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 99/250 (39%), Positives = 137/250 (54%), Gaps = 10/250 (4%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                C + A  F  WK    A A  +G +   +    A+  Y   TI+ DR   +   +
Sbjct: 14  AQAAQCGNNAAGFEAWKDEFAAEA--KGRASPASLAALANTSYSTATISADRGQKS-FKL 70

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           S   +L     + I+++G ALK  N+ L  ++++ YGVPPG L+A+WG+ET FG   G  
Sbjct: 71  SLDQFLAKRGGNTIVSRGRALKAQNAALFASIEQRYGVPPGPLLAIWGMETGFGAVKGNV 130

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
             LS +ATLAYDCRR+ +FT+Q + AL LV  GV++    GA  GE+G  QFLP NV+ Y
Sbjct: 131 NTLSAVATLAYDCRRSAYFTDQLYAALKLVDSGVLTPATRGAAHGEVGHTQFLPKNVLTY 190

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKT 269
            +    D       S   A+ S A FL   GW + AGYQPGE NFA ++ WNA+  Y + 
Sbjct: 191 GVGGSLD-------SAPVALNSTANFLKGHGWQRGAGYQPGEPNFAAIQGWNAAGVYQRA 243

Query: 270 IAYIAAHIDG 279
           IA + A IDG
Sbjct: 244 IALLGARIDG 253


>gi|294675803|ref|YP_003576418.1| membrane-bound lytic murein transglycosylase B [Rhodobacter
           capsulatus SB 1003]
 gi|294474623|gb|ADE84011.1| membrane-bound lytic murein transglycosylase B [Rhodobacter
           capsulatus SB 1003]
          Length = 419

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 72/256 (28%), Positives = 120/256 (46%), Gaps = 10/256 (3%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATT-------QFICSDTADRFGEWKSAARARA 53
           M      L+  L+    + A      +   +         + + T      W +  + RA
Sbjct: 1   MKHALKPLLVTLLAFSALTACGGPLDRGGVSMNTIEEIPPVDAATQAGMDAWVAGFKPRA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  T      ++ Y    I R +           DY+D  +S E IA G A    
Sbjct: 61  MAAGISEATWNRAMRNVPYNPKVIERQQFQAE-FVKPIWDYMDSAASEERIANGRAALAQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
              +L  ++  YGV   +++A+WG+E+ +G   G T ++  LATLA+D RRA+FF  Q  
Sbjct: 120 YDGVLREIEARYGVDKEVVVAVWGMESRYGAKRGNTLIIPALATLAHDGRRAQFFESQLI 179

Query: 174 YALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIAS 231
            AL +++ G I    + G+  G +G  QF+P + + +A+D   DGK D+   +  DA+AS
Sbjct: 180 GALKILQAGDIDPGHMTGSWAGAMGHTQFIPTSYLAFAVDFTGDGKRDIWSDNPADALAS 239

Query: 232 AAKFLAKLGWTKCAGY 247
            A +LA+ GW+K   +
Sbjct: 240 TAAYLARSGWSKGQPW 255


>gi|238751616|ref|ZP_04613106.1| Lytic murein transglycosylase [Yersinia rohdei ATCC 43380]
 gi|238710178|gb|EEQ02406.1| Lytic murein transglycosylase [Yersinia rohdei ATCC 43380]
          Length = 322

 Score =  193 bits (490), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 71/232 (30%), Positives = 116/232 (50%), Gaps = 2/232 (0%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           +       TT          F  +    +A+A  +G+S  T    FA++ ++D  I  DR
Sbjct: 5   STNNSHPPTTLSQQGRDPALFPAYVEQLKAQARAKGISDATLNLAFANIHFVDRVIQSDR 64

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
             +    V+  DYL  + +   I QG  + +     L  +   YGVP   ++ALWG+E+ 
Sbjct: 65  NQLEK-KVTLDDYLAKVLTPSKIEQGKEIYQRYQPQLSQVTARYGVPERYIVALWGMESG 123

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQ 200
           FG+  GK  ++S L+TLA++ RR  FFT++   AL ++++G +      G+  G +GQ Q
Sbjct: 124 FGKIQGKEDVISALSTLAFEGRREAFFTKELIAALQIIQQGKVDDPQLKGSWAGAMGQSQ 183

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
           F+P + + Y  D D DGKID+  +  D  AS A +L+  GW    G+    +
Sbjct: 184 FMPSSFLTYGADGDGDGKIDIWNNIDDVFASTANYLSTEGWKPGIGWGQEAQ 235


>gi|254454008|ref|ZP_05067445.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
 gi|198268414|gb|EDY92684.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
          Length = 359

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 72/225 (32%), Positives = 110/225 (48%), Gaps = 3/225 (1%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
           P   +           F  W S  R RA R+G+   T    F  + Y  T I RDR    
Sbjct: 37  PVHVSPITRVQTANQGFNAWISGFRNRATRQGILTATFDAAFDGIIYNTTVIERDRNQSE 96

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
               S  DYLD   S E +  G      N +LL  ++  +GV   +++A+WGLE+ +G  
Sbjct: 97  -FTKSLWDYLDTAVSDERVRNGRRALDNNRQLLNRIEDTFGVDKDVVVAIWGLESAYGAV 155

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPV 204
            G T ++  +ATLAYD RR +FF +Q   AL +++ G  +  +  G+  G +G  QF+P 
Sbjct: 156 RGSTNVIEAMATLAYDGRRGEFFEQQLIAALQILQAGDTAPRNMTGSWAGAMGHTQFIPT 215

Query: 205 NVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
           + + YA+D + DG+ D+      DA+AS A +L   GW +   + 
Sbjct: 216 SFLDYAVDGNGDGRRDIWADDPTDALASTANYLRSFGWVQGQPWG 260



 Score = 39.5 bits (90), Expect = 0.66,   Method: Composition-based stats.
 Identities = 6/26 (23%), Positives = 14/26 (53%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHI 277
            NFA+++ +N +  Y   +  ++  I
Sbjct: 321 PNFAVIERYNTADAYVMGVGLLSGRI 346


>gi|119944833|ref|YP_942513.1| lytic murein transglycosylase [Psychromonas ingrahamii 37]
 gi|119863437|gb|ABM02914.1| lytic murein transglycosylase [Psychromonas ingrahamii 37]
          Length = 349

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 78/337 (23%), Positives = 142/337 (42%), Gaps = 63/337 (18%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADR---FGEWKSAARARAVREGMSP 60
           K + L S + M++     ++   + A    +  +   +   F E+    +  A   G+ P
Sbjct: 5   KNFTLSSPMKMLFMTFFSSLLFSQLANAGKVNDNETLQKIPFAEYVEQIKIEAKENGIDP 64

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
              ++ FA++E+L  ++  D++      ++   Y+        + Q     + + +LL  
Sbjct: 65  DVIENAFANVEFLQRSVKSDKEQPE-FKLTLDTYIPRAVPEWKVKQARKAYQEHYQLLHE 123

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +   YGV P  ++ALWG+ET+FG   G   ++S+L T+AY+ RR   F +Q F AL +++
Sbjct: 124 IGNAYGVQPRFIVALWGIETNFGRFTGNHYIISSLTTMAYEGRREALFKKQLFAALIILQ 183

Query: 181 KGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G +     +G+  G +GQ QF+P + + YA+D D DGK D+  +N D  ASAA +L   
Sbjct: 184 QGHVDPEDFIGSWAGAMGQVQFMPTSYLNYAVDYDGDGKKDIWNTNADIFASAANYLKTE 243

Query: 240 GWTKCAG--------------------------YQP------------------------ 249
           GW                               +Q                         
Sbjct: 244 GWNNNETWGRQVLLPDNFDLQLSESKQKKSLQEWQDLGVRRYDGSALPKVDINASIVIPD 303

Query: 250 --------GEKNFAILKHWNASLNYNKTIAYIAAHID 278
                      N+ +L HWN S  +   ++Y++  I+
Sbjct: 304 DKDGRIYLAYNNYHVLMHWNRSYYFATAVSYLSERIN 340


>gi|89053649|ref|YP_509100.1| hypothetical protein Jann_1158 [Jannaschia sp. CCS1]
 gi|88863198|gb|ABD54075.1| hypothetical protein Jann_1158 [Jannaschia sp. CCS1]
          Length = 273

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 95/263 (36%), Positives = 146/263 (55%), Gaps = 3/263 (1%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            ++   +     A     C + A  F  W+    A A   G+     +   A   Y   T
Sbjct: 12  AIVTSLLLGAPMAAVAATCGNDASGFARWQQEFAAEAAAAGVGQAGLQ-ALAATTYATRT 70

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I+ DR   +    S ++++    +  I+ QG     AN     +L++ YGVP  +++A+ 
Sbjct: 71  ISADRNQRS-FSYSLEEFMRIRGADAIVRQGRQRIAANPEFYASLERAYGVPAAVIVAIH 129

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEI 196
           G+ET FG  MG   ++S +ATLAYDCRR+ FF+E    AL LV +G IS +++GA  GE+
Sbjct: 130 GMETGFGNFMGDANVVSAIATLAYDCRRSAFFSEHALAALILVDRGAISPNSIGAMHGEL 189

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAI 256
           G  QFLP NV++Y +D + DG+IDL  +  DA+AS A FL + GW +  GYQ G++NF  
Sbjct: 190 GHTQFLPGNVLRYGVDGNGDGRIDL-SNFTDAMASTANFLRQNGWRQGRGYQEGQRNFRA 248

Query: 257 LKHWNASLNYNKTIAYIAAHIDG 279
           ++ WNA+  Y + IA +A+ I+G
Sbjct: 249 IQAWNAAPVYQRAIAIMASRIEG 271


>gi|317401785|gb|EFV82401.1| peptidoglycan-binding protein [Achromobacter xylosoxidans C54]
          Length = 372

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 81/327 (24%), Positives = 126/327 (38%), Gaps = 61/327 (18%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           A +    A T    +  AD F    +  RA A + G+S  T     A+L      I    
Sbjct: 6   AASLATLALTLSTSAQAADAFATCLAGLRAPAAKAGVSGATFATHTANLAPDMAVIGLLD 65

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
                      DY+  L   E +A G          L      YGV P  + A+WG+E++
Sbjct: 66  AQPE-FKTPIWDYMAALVDDERVADGKEGIARWRAELDRAASRYGVDPATIAAVWGVESN 124

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQ 200
           +G T+G  PLL++L+TL+   RR  +F  +F+  L +++   I      G+  G  GQ Q
Sbjct: 125 YGRTLGGRPLLTSLSTLSCFGRRQAYFRGEFYATLKIIQDEHIDPDKLKGSWAGAFGQTQ 184

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY------------- 247
           F+P   ++ A+D D DG+ DL+ S  DA+AS A FL + GW     +             
Sbjct: 185 FMPSTYLRLAVDFDGDGRRDLIDSVPDALASTANFLKRAGWNSGLDWGYEVRLPAGLATA 244

Query: 248 QPGEKNFA---------------------------------------------ILKHWNA 262
             G KN                                                L  +NA
Sbjct: 245 GAGRKNKRPLSSWRGQGVTRADGTPLPPGETPAGLLLPAGPTGPAFLVTRNFDALYSYNA 304

Query: 263 SLNYNKTIAYIAAHID-GVPIGKGYDT 288
           + +Y   IA+++  +  G P+ + + T
Sbjct: 305 AESYALAIAHLSDRLRGGGPLAQAWPT 331


>gi|56698311|ref|YP_168684.1| peptidoglycan binding domain-containing protein [Ruegeria pomeroyi
           DSS-3]
 gi|56680048|gb|AAV96714.1| peptidoglycan binding domain protein [Ruegeria pomeroyi DSS-3]
          Length = 423

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 75/259 (28%), Positives = 113/259 (43%), Gaps = 16/259 (6%)

Query: 7   LLISLLMMVYPMLAQ---AVTQPKKATT----------QFICSDTADRFGEWKSAARARA 53
            L SL + +   +A    A   P  A +            +  D   +F  W    RARA
Sbjct: 4   FLTSLALCLGGSVAAETPATLIPAVAQSLRPVLRPDLLTPVSQDIEAQFQTWLIEFRARA 63

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G++P T       L Y    + RDR        +  DYLD   S   IA G      
Sbjct: 64  LTLGITPATLNAALPGLSYDAEVVRRDRNQAE-FTKTIWDYLDTAVSEARIANGRKAVAR 122

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  LL  ++  +GV   ++ A+WGLE+ +G   G    L +LA+LA+D RRA+FF  Q  
Sbjct: 123 HRDLLARIEARWGVDRHVVAAIWGLESAYGAVRGGDSTLRSLASLAFDTRRAEFFEGQLI 182

Query: 174 YALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIAS 231
            AL ++  G        G+  G +G  QF+P +  ++A+D   DG+ D+      DA+AS
Sbjct: 183 AALRILDSGDARLRDLRGSWAGAMGHTQFMPTSYQEHAVDFTGDGRRDIWSDDPSDALAS 242

Query: 232 AAKFLAKLGWTKCAGYQPG 250
            A +L   GW     +   
Sbjct: 243 TAAYLKANGWVSGQPWGIE 261



 Score = 47.9 bits (112), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/34 (26%), Positives = 18/34 (52%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
            NFA+++ +N +  Y   + ++A  I G    +G
Sbjct: 320 DNFAVIETYNTADAYVIGVGHLADRIAGGGPIRG 353


>gi|221640620|ref|YP_002526882.1| Lytic murein transglycosylase [Rhodobacter sphaeroides KD131]
 gi|221161401|gb|ACM02381.1| Lytic murein transglycosylase precursor [Rhodobacter sphaeroides
           KD131]
          Length = 417

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 88/326 (26%), Positives = 129/326 (39%), Gaps = 59/326 (18%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
            ++Q      +A               W    R RA+  G+ P T    F DL Y    +
Sbjct: 23  TVSQRPAARAEAAVTEAERAAQAGLEAWVIQFRPRALAAGIRPATFAAAFRDLRYDADAV 82

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
           ARDR        +  DYLD   S   IA G A    +  LL  ++  YGVP  I++A+WG
Sbjct: 83  ARDRNQAE-FNRTLWDYLDSAVSETRIAGGRAALVQHGALLGRIEGRYGVPKEIVVAVWG 141

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEI 196
           +ET +G   G  PL+  LATLA+D RRA+FF EQ   AL ++  G +      G+  G +
Sbjct: 142 METSYGTRRGDHPLVGALATLAHDGRRARFFEEQLIAALKILDNGDVRPEAMTGSWAGAM 201

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGW-------------- 241
           G  QF+P + + +A+D   DG+ D+      DA+AS A +LAK GW              
Sbjct: 202 GHTQFMPTSYLDFAVDFTGDGRRDIWSDDPSDALASTAAYLAKSGWRSGEPWGVEVRLPA 261

Query: 242 ------------TKCAGYQP------------------------------GEKNFAILKH 259
                          A ++                                  NF  +  
Sbjct: 262 GFDFARSGKSLRQPAARWEALEVRRVDGSPLPAGEAALLLPAGAQGAAFLIYPNFRAIAR 321

Query: 260 WNASLNYNKTIAYIAAHIDGVPIGKG 285
           +N +  Y   + ++A  + G P   G
Sbjct: 322 YNPADAYVIGVGHLADRLKGAPAIAG 347


>gi|153834502|ref|ZP_01987169.1| membrane-bound lytic murein transglycosylase B [Vibrio harveyi
           HY01]
 gi|156973685|ref|YP_001444592.1| membrane-bound lytic murein transglycosylase B [Vibrio harveyi ATCC
           BAA-1116]
 gi|148869088|gb|EDL68127.1| membrane-bound lytic murein transglycosylase B [Vibrio harveyi
           HY01]
 gi|156525279|gb|ABU70365.1| hypothetical protein VIBHAR_01388 [Vibrio harveyi ATCC BAA-1116]
          Length = 323

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 116/221 (52%), Gaps = 2/221 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           ++D F E+ +  RA A  +G+S +     FAD+EY    +  DR       ++  +Y+  
Sbjct: 20  SSDGFDEYLNKLRAEARDKGISEQVISAAFADVEYKPRAVKADRNQPEK-KLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  E+GV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQAKQLYKEHYAELKRIGDEFGVQPRFIVALWGVESNFGKFTGNFRVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I   +  G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMAALQILDEGHIELENFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAIL 257
           GK D+ +S  D  AS A +L+K GW     +    K    +
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGWDDKFTWGRQVKVPHGI 239



 Score = 39.5 bits (90), Expect = 0.57,   Method: Composition-based stats.
 Identities = 7/27 (25%), Positives = 14/27 (51%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHI 277
             N+ +L  WN S  +   ++++A  I
Sbjct: 295 YNNYNVLMKWNRSYYFALAVSHLADRI 321


>gi|262404312|ref|ZP_06080867.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. RC586]
 gi|262349344|gb|EEY98482.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. RC586]
          Length = 325

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 72/280 (25%), Positives = 131/280 (46%), Gaps = 22/280 (7%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L   ++ P  A            F E+    + +A  EG+S +     F D+EY 
Sbjct: 4   LLSIVLGLTLSAPVLANEV--------SFEEYVERLKQQAREEGISERILNEAFRDVEYK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 56  PRAVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYDELQRIGKQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+   + G+ 
Sbjct: 115 ALWGVESNFGALTGNFSVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPETMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ GW     +    +
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWG---R 231

Query: 253 NFAILKHWNA-----SLNYNKTIAYIAA----HIDGVPIG 283
              I K +N           KT+   +       DG P+ 
Sbjct: 232 QVKIPKGFNHDLEGRQPEKGKTLQEWSKLGVTRYDGKPLP 271


>gi|269961087|ref|ZP_06175456.1| Membrane-bound lytic murein transglycosylase B [Vibrio harveyi
           1DA3]
 gi|269834306|gb|EEZ88396.1| Membrane-bound lytic murein transglycosylase B [Vibrio harveyi
           1DA3]
          Length = 323

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 127/255 (49%), Gaps = 10/255 (3%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           ++D F E+ +  RA A  +G+S +     FAD+EY    +  DR       ++  +Y+  
Sbjct: 20  SSDGFDEYLNKLRAEARDKGISEQVISAAFADVEYKPRAVKADRNQPEK-KLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  E+GV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQAKQLYKEHYAELKRIGDEFGVQPRFIVALWGVESNFGKFTGNFRVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I   +  G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMAALQILDEGHIELENFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWN------ASLNYNKTI 270
           GK D+ +S  D  AS A +L+K GW     +    K    + H N          Y +  
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGWDDKFTWGRQVKVPHGIDH-NLQGREAEKGKYLQDW 257

Query: 271 AYIA-AHIDGVPIGK 284
           + +     DG P+ K
Sbjct: 258 SKLGITKYDGSPLPK 272



 Score = 39.5 bits (90), Expect = 0.61,   Method: Composition-based stats.
 Identities = 7/27 (25%), Positives = 14/27 (51%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHI 277
             N+ +L  WN S  +   ++++A  I
Sbjct: 295 YNNYNVLMKWNRSYYFALAVSHLADRI 321


>gi|28897650|ref|NP_797255.1| putative lytic murein transglycosylase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260364581|ref|ZP_05777190.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus K5030]
 gi|260876452|ref|ZP_05888807.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AN-5034]
 gi|260895876|ref|ZP_05904372.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus Peru-466]
 gi|260902774|ref|ZP_05911169.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AQ4037]
 gi|28805863|dbj|BAC59139.1| putative lytic murein transglycosylase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|308086781|gb|EFO36476.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus Peru-466]
 gi|308092793|gb|EFO42488.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AN-5034]
 gi|308108635|gb|EFO46175.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AQ4037]
 gi|308115359|gb|EFO52899.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus K5030]
 gi|328473368|gb|EGF44216.1| putative lytic murein transglycosylase [Vibrio parahaemolyticus
           10329]
          Length = 323

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 64/223 (28%), Positives = 115/223 (51%), Gaps = 2/223 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +++ F E+    RA A  +G+S +     FA++EY    +  DR       ++  +Y+  
Sbjct: 20  SSEGFEEYLDKLRAEARNQGISEQVISAAFANVEYKPRAVTADRNQPEK-KLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q  AL K +   L  +  +YGV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQAKALYKEHYAELKRIGDQYGVQPRFIVALWGVESNFGKFTGNFRVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I      G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMAALQILDQGHIELDNFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH 259
           GK D+ +S  D  AS A +L++ GW     +    K    +  
Sbjct: 199 GKKDIWQSEADVFASTANYLSESGWDDKFTWGRQVKVPKGIDR 241


>gi|170746792|ref|YP_001753052.1| hypothetical protein Mrad2831_0346 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653314|gb|ACB22369.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 264

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 96/255 (37%), Positives = 136/255 (53%), Gaps = 11/255 (4%)

Query: 25  QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
                     C +TA  F  WK      A   G +   +     +  Y   TI+ DR   
Sbjct: 20  LSAGQVQAAQCGNTAAGFDAWKRQFAEEA--RGRASAASLAALQNTTYSTATISADRGQH 77

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
           +   +S   +L       I+ +G ALK+ N+ L  ++++ YGVPPG L+A+WG+ET FG 
Sbjct: 78  S-FKLSLDQFLAKRGGPTIVKRGRALKQQNAALFDSIEQRYGVPPGPLLAIWGMETGFGA 136

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPV 204
             G    LS +ATLAYDCRR+++FT+Q + AL L+ +G+++ +  GA  GE+G  QFLP 
Sbjct: 137 VRGNVNTLSAVATLAYDCRRSEYFTDQLYAALTLIDRGLLTPNTRGAAHGEVGHTQFLPK 196

Query: 205 NVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASL 264
           NV+ Y       G  DL  +   A++S A FL   GW   AGYQPGE NFA ++ WNA+ 
Sbjct: 197 NVLAY-------GTGDL-NNVGAALSSTANFLKAHGWRAGAGYQPGEPNFAAIQGWNAAP 248

Query: 265 NYNKTIAYIAAHIDG 279
            Y K IA +   ID 
Sbjct: 249 VYEKAIALLGRQIDN 263


>gi|153837957|ref|ZP_01990624.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AQ3810]
 gi|149748648|gb|EDM59507.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AQ3810]
          Length = 323

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 64/223 (28%), Positives = 115/223 (51%), Gaps = 2/223 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +++ F E+    RA A  +G+S +     FA++EY    +  DR       ++  +Y+  
Sbjct: 20  SSEGFEEYLDKLRAEARNQGISEQVISAAFANVEYKPRAVTADRNQPEK-KLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q  AL K +   L  +  +YGV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQAKALYKEHYAELKRIGDQYGVQPRFIVALWGVESNFGKFTGNFRVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I      G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMAALQILDQGHIELDNFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH 259
           GK D+ +S  D  AS A +L++ GW     +    K    +  
Sbjct: 199 GKKDIWQSEADVFASTANYLSESGWDDKFTWGRQVKVPKGIDR 241


>gi|258626492|ref|ZP_05721332.1| Membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM603]
 gi|262165279|ref|ZP_06033016.1| membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM223]
 gi|262171055|ref|ZP_06038733.1| membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           MB-451]
 gi|258581203|gb|EEW06112.1| Membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM603]
 gi|261892131|gb|EEY38117.1| membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           MB-451]
 gi|262024995|gb|EEY43663.1| membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM223]
          Length = 323

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 74/328 (22%), Positives = 133/328 (40%), Gaps = 72/328 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L   ++ P  A            F ++    + +A  EG+S +     F D+EY 
Sbjct: 4   LLSIVLGLTLSAPVLANEV--------SFEQYVERLKQQAREEGISERILSEAFRDVEYK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 56  PRAVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYDELQRIGKQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 115 ALWGVESNFGALTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPEAMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W----- 241
            G +GQ QF+P + + +A D D DGK D+  +  D  AS A +L++ G      W     
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGDGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWGRQVK 234

Query: 242 --------------TKCAGYQPGEK----------------------------------- 252
                          K    Q   K                                   
Sbjct: 235 IPKGFDHDLEGRQSEKGKTLQEWSKLGVTRYDGKPLPALSDDIKAWLIMPDDEAGRIYLV 294

Query: 253 --NFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSYYFALAVSHLADRIK 322


>gi|90411628|ref|ZP_01219638.1| putative lytic murein transglycosylase [Photobacterium profundum
           3TCK]
 gi|90327518|gb|EAS43871.1| putative lytic murein transglycosylase [Photobacterium profundum
           3TCK]
          Length = 323

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 125/256 (48%), Gaps = 15/256 (5%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
             K L+ +++++   + + A +               + F E+ S  +  A   G+S   
Sbjct: 1   MHKRLISAMVVIGLGISSSAFSA-------------NEGFDEYVSGLKVEARNNGISESI 47

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
               F +++Y +  +  D+       ++  +Y+        + Q   L + +   L  + 
Sbjct: 48  INSAFDNIQYTERAVKADKNQPEK-KLTLDEYIPRAVPDWKVKQANRLYQEHKTALERIG 106

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           +EYGV P  ++ALWG+E++FG  MG   ++  L+TLAYD RR  FF +Q   AL ++ +G
Sbjct: 107 REYGVQPRFIVALWGVESNFGRLMGNYNVVEALSTLAYDGRREAFFRKQVMAALQILNEG 166

Query: 183 VISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            IS  +  G+  G +GQ QF+P + + YA+D + DGKID+ ++  D  ASAA +L   GW
Sbjct: 167 HISPENMKGSWAGAMGQPQFMPTSFLTYAVDGNNDGKIDIWQNVDDVFASAANYLKMSGW 226

Query: 242 TKCAGYQPGEKNFAIL 257
                +    K  + +
Sbjct: 227 NDEYTWGRQVKLVSPV 242


>gi|307944460|ref|ZP_07659800.1| lytic murein transglycosylase family protein [Roseibium sp.
           TrichSKD4]
 gi|307772209|gb|EFO31430.1| lytic murein transglycosylase family protein [Roseibium sp.
           TrichSKD4]
          Length = 415

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 73/291 (25%), Positives = 119/291 (40%), Gaps = 17/291 (5%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M    +   S L +    L    T  +              F ++       A   G+ P
Sbjct: 10  MRLSGFKWFSRLKVSLFSLVFLCTGLQAQADP--------GFNQFLRDFWPTAQSYGIQP 61

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
                +F  +     T+    K          +YLD   S   + +G  L      +L  
Sbjct: 62  DVYNKVFIGMTPDKDTLRLMNKQSE-FVKPIWEYLDSAVSETRVERGRELLVEYRDVLAA 120

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY-DCRRAKFFTEQFFYALDLV 179
           ++  YGV    ++A+WG+ET++G  MGK  ++  LATLAY   RR KF+ ++   AL +V
Sbjct: 121 IEARYGVDREAVLAIWGMETNYGSFMGKHNVIQALATLAYGAPRRQKFWRKELLKALAIV 180

Query: 180 KKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           + G +      G+  G +G  QF+P +   Y++D D DG+ D+  +  DA+AS A +L K
Sbjct: 181 QGGHVKFEDMEGSWAGAMGHTQFMPTSWNAYSVDFDGDGRRDIWTTIPDALASTAFYLKK 240

Query: 239 LGWTKCAGYQPG---EKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGY 286
            GW     +       +NF       A  +   T+   A    G   G+ +
Sbjct: 241 HGWQTGKTWGYEISLPRNFD--FRL-ADDDTTLTLGEWARRGVGRVNGRQF 288



 Score = 52.2 bits (123), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 10/44 (22%), Positives = 19/44 (43%), Gaps = 1/44 (2%)

Query: 244 CAGYQPGEKNFAILKHWNASLNYNKTIAYIAAH-IDGVPIGKGY 286
                   KNF ++K +N +  Y   + ++A   I G P+   +
Sbjct: 304 NGPKFLMLKNFYVIKRYNNATAYALAVGHLADRLIGGGPLAGDW 347


>gi|260432728|ref|ZP_05786699.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416556|gb|EEX09815.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 387

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 77/327 (23%), Positives = 122/327 (37%), Gaps = 63/327 (19%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           +  V  ++A  +            +     F  +    +A A ++G    T    F  ++
Sbjct: 1   MRFVSSLVAACL------FAAPALAQCGGGFNAFVRGLKAEAAQQGFDTATVDAFFNGVQ 54

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
                +  DR         F ++   L S + I +G A+ +    +   ++ EYGV  G+
Sbjct: 55  QDPKVLKADRAQG-VFQKPFIEFSRRLISQDRIRRGQAMAQKYDAVFDRIEAEYGVSRGV 113

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-G 190
           L+A W  ET +G   G     + L TLA+DCRR + F  Q F A++L + G    +   G
Sbjct: 114 LLAFWAFETDYGAFQGDFNTRNALVTLAHDCRRPELFRPQIFAAIELFRNGDFDPNRTTG 173

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY--- 247
           A  GEIG  Q LP ++++  +D D DG + L  S  DA+ S  K L+ LGW     +   
Sbjct: 174 AWAGEIGMVQMLPRDILENGVDGDGDGHVRLKTSAPDALMSGGKMLSHLGWQPGQPWLQE 233

Query: 248 ------------QPGEK----------------------------------------NFA 255
                        PG+                                         NF 
Sbjct: 234 VTVPAQIDWSLSGPGKPRPISDWQAMGVQARSGSLANLPASLILPQGRNGPAFLAYPNFD 293

Query: 256 ILKHWNASLNYNKTIAYIAAHIDGVPI 282
           +   WN S  Y  T AY    ++G  +
Sbjct: 294 VYFEWNQSFVYVLTAAYFGTRLEGAQV 320


>gi|109899737|ref|YP_662992.1| lytic murein transglycosylase [Pseudoalteromonas atlantica T6c]
 gi|109702018|gb|ABG41938.1| lytic murein transglycosylase [Pseudoalteromonas atlantica T6c]
          Length = 428

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 83/349 (23%), Positives = 132/349 (37%), Gaps = 71/349 (20%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKK-----------ATTQFICSDTADRFGEWKSAA 49
           M      L +++            Q               +     +     F +     
Sbjct: 1   MQTALKKLSAIVCCSLLSGISVAAQQDATDMNVLGDQEVVSEAQEVASPQALFAQCVVDL 60

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           + +A   G+S +    +     Y +  I+ DR        +F DY +   ++  I +G  
Sbjct: 61  QGQAKTAGVSKRVTDEVLGGARYKEKIISLDRNQPE-FVQTFTDYFEKRVNTWRIEKGQQ 119

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           +   +   L  L KEYGVP   L+A WGLET+FG   GK+P++ +L TLA D RR+++F+
Sbjct: 120 MMAKHRAFLGELNKEYGVPAQYLLAFWGLETNFGSYKGKSPVIDSLVTLACDNRRSRYFS 179

Query: 170 EQFFYALDLVKKGV-ISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            +   AL L+ +        +G+  G +G  QF+P   +KYA+D D+DG+I+L  S  DA
Sbjct: 180 SELMQALLLIDREKLDDKKMVGSWAGAMGHTQFMPSAYMKYAVDGDKDGQINLWDSEQDA 239

Query: 229 IASAAKFLAKLGWTKCAGYQ-------------PGEKNFAILKHW--------------- 260
           +ASAA FL  LGW     +               G+ +   L  W               
Sbjct: 240 LASAANFLKNLGWQSGYKWGREVSLPDSFDYTLAGKNDPKALSVWNGAGVTRTDGHAIGN 299

Query: 261 ------------------------------NASLNYNKTIAYIAAHIDG 279
                                         N S  Y   + ++A  I G
Sbjct: 300 ADIKGALLVPAGHAGPAFLAYKNFNVILRWNNSEYYGIAVGHLADRIAG 348


>gi|217972932|ref|YP_002357683.1| lytic murein transglycosylase [Shewanella baltica OS223]
 gi|217498067|gb|ACK46260.1| lytic murein transglycosylase [Shewanella baltica OS223]
          Length = 436

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 80/229 (34%), Positives = 122/229 (53%), Gaps = 3/229 (1%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
            A   P    +  + ++ A+ F    +  +ARA  EG+S  T     A+L+++   I  D
Sbjct: 46  AAEANPMPDISASVQAN-AEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELD 104

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           ++       +F +Y    ++   + +G  L K +S LL  L KEYGVPP  +++ WGLET
Sbjct: 105 QQQPE-FSQTFDNYFSKRATEWRVNEGRRLLKKHSVLLNQLAKEYGVPPQYILSFWGLET 163

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           ++G   GK  +L++LATLA + RR+ +FT +   AL L +K       + G+  G +G  
Sbjct: 164 NYGSYKGKMSVLNSLATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHT 223

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P    KYA+D D DGK DL  S  DA+ SAA FL  LGW +   + 
Sbjct: 224 QFMPSAYAKYAVDGDGDGKADLWNSTTDALTSAANFLQHLGWQRNERWG 272


>gi|123442610|ref|YP_001006587.1| putative lipoprotein [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122089571|emb|CAL12420.1| putative lipoprotein [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 307

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 69/218 (31%), Positives = 117/218 (53%), Gaps = 2/218 (0%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
             +  +F  +    +A+A  +G+S  T +  FA++ ++D  I  DR  +    V+  DYL
Sbjct: 6   GRSPAQFPAYVEQLKAQARAQGISEATLEIAFANIHFVDRVIQSDRNQLEK-KVTLDDYL 64

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             + +   IAQG  + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L
Sbjct: 65  AKVLTPSKIAQGKEIYQRYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVISAL 124

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +TLA++ RR  FFT++   AL ++++G +      G+  G +GQ QF+P + + Y  D D
Sbjct: 125 STLAFEGRREAFFTKELIAALKIIQQGRVEDPQLKGSWAGAMGQSQFMPSSFLTYGADGD 184

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            DGK+D+  +  D  AS A +L+  GW    G+    +
Sbjct: 185 GDGKVDIWNNIDDVFASTANYLSTEGWKPGIGWGQEAQ 222


>gi|209694628|ref|YP_002262556.1| hypothetical protein VSAL_I1069 [Aliivibrio salmonicida LFI1238]
 gi|208008579|emb|CAQ78754.1| putative exported protein [Aliivibrio salmonicida LFI1238]
          Length = 324

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 122/247 (49%), Gaps = 15/247 (6%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
            KK LL+ ++ ++      A T                 F ++    +  A   G+S   
Sbjct: 1   MKKRLLLGIVSLLMATSVSANTP-------------EGDFQDYIVNLKNEARENGISEPI 47

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
            +  F ++ + +  +  DR       ++  +Y+        I Q   L + +  +L  + 
Sbjct: 48  LERAFKNVAFKEKAVKSDRNQPEK-KLTLDEYIPRAVPKWKIKQANDLYQKHHEVLTRIG 106

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           KEYGV P  ++ALWG+E++FG+  G   ++  L TLAYD RR  FF +Q   AL ++++G
Sbjct: 107 KEYGVQPRFIVALWGVESNFGKLTGGYNVIEALTTLAYDGRREAFFRKQTMAALTILEQG 166

Query: 183 VISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I+  +  G+  G +GQ QF+P + + YA+D ++DG+ D+  ++ D  ASAA +L ++GW
Sbjct: 167 HITPENMKGSWAGAMGQCQFMPTSFLAYAVDGNDDGRKDIWTTHADVFASAANYLKQVGW 226

Query: 242 TKCAGYQ 248
                + 
Sbjct: 227 DDTYTWG 233


>gi|254229937|ref|ZP_04923340.1| Membrane-bound lytic murein transglycosylase B [Vibrio sp. Ex25]
 gi|262394855|ref|YP_003286709.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. Ex25]
 gi|151937573|gb|EDN56428.1| Membrane-bound lytic murein transglycosylase B [Vibrio sp. Ex25]
 gi|262338449|gb|ACY52244.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. Ex25]
          Length = 323

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 116/223 (52%), Gaps = 2/223 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +++ F E+ +  RA A  +G+S +     FA++EY    +  DR       ++  +Y+  
Sbjct: 20  SSEGFDEYLNKLRAEARDKGISEQVISAAFANVEYKPRAVKADRNQPEK-KLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  EYGV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQARQLYKEHYTELKRIGDEYGVQPRFIVALWGVESNFGKFTGNFKVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I   +  G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMSALQILDQGHIELENFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH 259
           GK D+ +S  D  AS A +L+K GW     +    K    +  
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGWDDKYIWGRQVKVPKGIDR 241


>gi|84500323|ref|ZP_00998589.1| hypothetical protein OB2597_10284 [Oceanicola batsensis HTCC2597]
 gi|84392257|gb|EAQ04525.1| hypothetical protein OB2597_10284 [Oceanicola batsensis HTCC2597]
          Length = 389

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 83/309 (26%), Positives = 116/309 (37%), Gaps = 58/309 (18%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
              +     FG + S  +A AV+ G    T    FA +      I  DR       + F 
Sbjct: 17  PAFAACGGSFGTFVSGLKAEAVQRGHDRATVDRFFASVRQDPKVIRADRAQG-VFQLDFT 75

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            +   L S   +  G A  +    +   ++ EYGV  G+L+A W  ET +G   G    L
Sbjct: 76  TFARRLISQHRLNAGAANARKYDSIFDRIEAEYGVNRGVLLAFWAFETDYGAFQGDFNTL 135

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAI 211
           + LATLA+DCRR   F  Q F AL+L + G        GA  GEIG  Q LP ++++  +
Sbjct: 136 NALATLAHDCRRPDLFRPQIFSALELYENGDFDPARTTGAWAGEIGMVQMLPGDIIENGV 195

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG------------------------- 246
           D D DG + L  S  DA+ S A+ L  LGW                              
Sbjct: 196 DGDGDGHVTLKTSAPDALMSGARMLRHLGWRPGEPWLQEIDVPDGMDWSKTGLRTAMSPQ 255

Query: 247 -YQP------------------------------GEKNFAILKHWNASLNYNKTIAYIAA 275
            +Q                                  NF++   WN S  Y  T AY A 
Sbjct: 256 QWQQMGVRPRSGRWLSDQPASVIIPQGRKGPAFLAYPNFSVYFEWNQSFTYVLTAAYFAT 315

Query: 276 HIDGVPIGK 284
            ++G P+  
Sbjct: 316 RLEGAPVFD 324


>gi|304409229|ref|ZP_07390850.1| lytic murein transglycosylase [Shewanella baltica OS183]
 gi|307303232|ref|ZP_07582987.1| lytic murein transglycosylase [Shewanella baltica BA175]
 gi|304353050|gb|EFM17447.1| lytic murein transglycosylase [Shewanella baltica OS183]
 gi|306913592|gb|EFN44014.1| lytic murein transglycosylase [Shewanella baltica BA175]
          Length = 438

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 80/228 (35%), Positives = 122/228 (53%), Gaps = 3/228 (1%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           A   P    +  + ++ A+ F    +  +ARA  EG+S  T     A+L+++   I  D+
Sbjct: 49  AEANPMPDISASVQAN-AEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELDQ 107

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
           +       +F +Y    ++   + +G  L K +S LL  L KEYGVPP  +++ WGLET+
Sbjct: 108 QQPE-FSQTFDNYFSKRATEWRVNEGRRLLKKHSVLLNQLAKEYGVPPQYILSFWGLETN 166

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQ 200
           +G   GK  +L++LATLA + RR+ +FT +   AL L +K       + G+  G +G  Q
Sbjct: 167 YGSYKGKMSVLNSLATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHTQ 226

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           F+P    KYA+D D DGK DL  S  DA+ SAA FL  LGW +   + 
Sbjct: 227 FMPSAYAKYAVDGDGDGKADLWNSTTDALTSAANFLQHLGWQRNERWG 274


>gi|254507810|ref|ZP_05119941.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus 16]
 gi|219549335|gb|EED26329.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus 16]
          Length = 323

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 70/274 (25%), Positives = 122/274 (44%), Gaps = 12/274 (4%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
           ++    AT           F ++    +  A   G+S +     F+D+ Y    +  DR 
Sbjct: 5   LSVVLGATIASSVWANEQSFEQYVDGLKQEAREHGISEQVISAAFSDVTYKPRAVKADRN 64

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                 ++  +Y+        + Q   L + +   L  +  EYGV P  ++ALWG+E++F
Sbjct: 65  QPEK-KLTLDEYIPRAVPDWKVKQAKELYEKHYETLSRIGDEYGVQPRFIVALWGVESNF 123

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQF 201
           G   G   ++  L+T+AYD RR  FF ++   AL ++++G I      G+  G +GQ QF
Sbjct: 124 GRFTGNYSVIDALSTMAYDGRREAFFRKEAMAALQILEEGHIPVEDFKGSWAGAMGQCQF 183

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN----FAIL 257
           +P + + +A D + DGK D+ ++  D  ASAA +L++ GW     +    K        +
Sbjct: 184 MPSSFLAFAADGNGDGKKDIWQTEADVFASAANYLSESGWGDKYTWGRQVKLPQGFDTSI 243

Query: 258 KHWNASLNYNKTIAYIAA----HIDGVPIGKGYD 287
           +    S    K +   +       DG P+ K  D
Sbjct: 244 QG--RSEEKGKYLQEWSKLGVTRYDGRPLPKLDD 275



 Score = 39.5 bits (90), Expect = 0.61,   Method: Composition-based stats.
 Identities = 7/27 (25%), Positives = 14/27 (51%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHI 277
             N+ +L  WN S  +   ++++A  I
Sbjct: 295 YNNYNVLMKWNRSYYFALAVSHLADRI 321


>gi|110833131|ref|YP_691990.1| glycosidases [Alcanivorax borkumensis SK2]
 gi|110646242|emb|CAL15718.1| glycosidases [Alcanivorax borkumensis SK2]
          Length = 401

 Score =  192 bits (487), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 83/320 (25%), Positives = 126/320 (39%), Gaps = 60/320 (18%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           A          +    +     F +  +  RA+A  EG+  +        ++  +  I  
Sbjct: 6   ATLFAGSTLLASHASYALDKAEFEQCMAQLRAQAHEEGIPAQVISRSLNTVKLNERVIEL 65

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR        SF DY     S   I  G    +    LL  L +EYGVP   L+A WGLE
Sbjct: 66  DRSQPE-FTSSFSDYYTRRVSETRIETGRKKYREQQPLLQELAREYGVPGHYLVAFWGLE 124

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQ 198
           T++G  +G  P+L +L+TLA + RR ++F+ + F AL +++ G   +  + G+  G +GQ
Sbjct: 125 TNYGGFLGSIPVLDSLSTLACEGRRGEYFSGELFNALRIIQAGDAEAKQMEGSWAGAMGQ 184

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ---------- 248
            QF+P   ++YA+D D DGK +L KS  DA+ASAA FL  LGW +   +           
Sbjct: 185 TQFMPAVFLRYAVDHDGDGKRNLWKSTDDALASAANFLQGLGWEREQRWGREVRLPKSFD 244

Query: 249 ---------------------------------------PGEKNFAILKHW--------- 260
                                                  P   N      +         
Sbjct: 245 YQLTGFSHQRSLSDWADMGITMPNGQPLPQADMQAAVIVPSGHNGPAFLAYQNFRVIMGW 304

Query: 261 NASLNYNKTIAYIAAHIDGV 280
           N S +Y   +  +A  I G 
Sbjct: 305 NRSESYAIAVGRLADRIAGG 324


>gi|239992933|ref|ZP_04713457.1| putative transglycosylase [Alteromonas macleodii ATCC 27126]
          Length = 360

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 68/238 (28%), Positives = 117/238 (49%), Gaps = 2/238 (0%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L++    L+ ++T   +         +   F  + +  +  A  +G+        FAD+ 
Sbjct: 33  LVLSSITLSFSLTVHAENQPSNDSGLSETGFKSYVAQLKKEAAEKGIDKTKLDLAFADIT 92

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           +  T +  D+       ++  DYL        + Q +     +  LL  + ++YGV    
Sbjct: 93  FRPTVVKSDKSQPEK-KITLDDYLATRVPDWKVKQAVEQYNEHKVLLDEIAQKYGVQARF 151

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LG 190
           ++ALWG E++FG+  G   +LS LA+LAY+ RR K F + FF AL ++ +G IS  A  G
Sbjct: 152 IVALWGNESNFGKIQGNFSVLSALASLAYEGRREKLFKDNFFAALQILDEGHISVEALKG 211

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +  G +GQ QF+P++ + YA+D D DG+ D+  +  D  AS A +L+  GW     + 
Sbjct: 212 SWAGAMGQTQFMPISFLNYAVDYDGDGRKDIWGTKADVFASIANYLSSEGWDSEGTWG 269


>gi|332307208|ref|YP_004435059.1| lytic murein transglycosylase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174537|gb|AEE23791.1| lytic murein transglycosylase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 331

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 66/241 (27%), Positives = 118/241 (48%), Gaps = 4/241 (1%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +S L     ++   +   + A  Q   S     F  +  + +  A+ +G        +F 
Sbjct: 1   MSRLAFFILIITSVLLLLEPANAQADKSQE--GFERYIQSFKEEAIVKGYDASFLDRVFT 58

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
           D  +    +  D+       ++   YL        + Q + L + +  +L  ++K++GV 
Sbjct: 59  DATFRQRVVTADKNQPER-KLTLDTYLATRVPDWKVQQAVDLLRKHKDVLDKVEKKFGVQ 117

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
              ++ALWG E++FG+ MG+ P++S+L T+AY+ RR   F +Q + ALD++++G I+   
Sbjct: 118 ARFIVALWGNESNFGKIMGEYPVISSLTTMAYEGRRESMFKKQLYAALDILQQGHINQEQ 177

Query: 189 L-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G +GQ QF+P + + YA D D D K D+  +  D  AS A FL   GW+  A +
Sbjct: 178 FLGSWAGAMGQSQFMPTSFLHYAYDFDGDDKKDIWNNPADVFASIANFLKTEGWSDSATW 237

Query: 248 Q 248
            
Sbjct: 238 G 238


>gi|89899658|ref|YP_522129.1| lytic murein transglycosylase [Rhodoferax ferrireducens T118]
 gi|89344395|gb|ABD68598.1| Lytic murein transglycosylase [Rhodoferax ferrireducens T118]
          Length = 432

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 73/269 (27%), Positives = 114/269 (42%), Gaps = 22/269 (8%)

Query: 1   MSFKKYLLISL------LMMVYPMLAQAVTQPKKATTQFICSDTADR------------- 41
           M    +  +S         +    +A   + P   T     S                  
Sbjct: 4   MQIPFHFPVSARCWLVPAWLAIVSVAGCASAPSVETQAPPASTVGANPTRAGSIDVEHSQ 63

Query: 42  -FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
            F  W       A   G+   T +  F D+ ++   I  D         +  DYLD   S
Sbjct: 64  KFARWVLEFSTTARAAGIDEATLRSAFDDVHFIPRVIELDSAQPE-FTRTVWDYLDSALS 122

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  IA+G         ++  +   YGVP  +L+A+WG+E++FG  +G  P +  LATL +
Sbjct: 123 TRRIARGRDKLLQLHPVVEPIAARYGVPAEVLVAIWGMESNFGSNVGDIPTIDALATLGF 182

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR ++   Q   AL +++   I  +  +G+  G +GQ QFLP N + YA+DAD DG+ 
Sbjct: 183 EGRREQWARGQLLAALRILQNRDIDRAQMMGSWAGAMGQTQFLPSNFLAYAVDADADGRR 242

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           D+  S  D +AS A FLA  GW     + 
Sbjct: 243 DIWNSLADVMASTANFLASSGWQVGPPWG 271



 Score = 50.6 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 8/35 (22%), Positives = 15/35 (42%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGY 286
            NF  +  +N S +Y   +  +A  + G P  +  
Sbjct: 332 PNFRTILRYNNSTSYALAVGLLAQQLAGGPATQAP 366


>gi|254429098|ref|ZP_05042805.1| lytic murein transglycosylase subfamily [Alcanivorax sp. DG881]
 gi|196195267|gb|EDX90226.1| lytic murein transglycosylase subfamily [Alcanivorax sp. DG881]
          Length = 398

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 81/320 (25%), Positives = 121/320 (37%), Gaps = 60/320 (18%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           A          +    +     F +  +  RA+A   G+  +        ++     I  
Sbjct: 6   AALFASATLLASHASYALDNAEFEQCMAQLRAQADEAGIPAQVISRSLNTVKLNQRVIEL 65

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR        SF DY     S   I  G    +    LL  L +EYG+P   L+A WGLE
Sbjct: 66  DRSQPE-FTSSFSDYYTRRVSETRIETGRKKYREQQPLLQALTREYGIPGHYLVAFWGLE 124

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQ 198
           T++G  +G  P+L  L+TLA + RR  +F+ +   AL +++ G + +  + G+  G +GQ
Sbjct: 125 TNYGGFLGSIPVLDALSTLACEGRRGDYFSGELMNALRIIQSGDVEASQMEGSWAGAMGQ 184

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ---------- 248
            QF+P   +KYAID D DG  +L KS  DA+ASAA FL  LGW +   +           
Sbjct: 185 TQFMPAIFLKYAIDHDGDGHRNLWKSEDDALASAANFLQGLGWQREQRWGREVTLPDNFD 244

Query: 249 ---------------------------------------PGEKNFAILKHW--------- 260
                                                  P   N      +         
Sbjct: 245 FQLTGFAHQRSLSDWAKLGVRMPNGQPLPQADMEAALVVPSGHNGPAFLAYQNFRVIMGW 304

Query: 261 NASLNYNKTIAYIAAHIDGV 280
           N S +Y   +  +A  I G 
Sbjct: 305 NRSESYAIAVGRLADRIAGG 324


>gi|89899141|ref|YP_521612.1| lytic murein transglycosylase [Rhodoferax ferrireducens T118]
 gi|89343878|gb|ABD68081.1| Lytic murein transglycosylase [Rhodoferax ferrireducens T118]
          Length = 434

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 68/240 (28%), Positives = 108/240 (45%), Gaps = 3/240 (1%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADR-FGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
             P    A   P  AT   + +    + F  W +   A A   G+   T    F +  +L
Sbjct: 39  AAPSTTSANPTPAGATPATLDAVENSQKFARWVAEFSATARTAGIDEATLHIAFDNARFL 98

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              I  DR        +  DYLD   S+  + +G        + +  +   YGVP  +L+
Sbjct: 99  PRVIESDRAQPE-FTRTPWDYLDTAVSALRVTRGQDKLLQLRQQIDPIAVRYGVPTEVLL 157

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK-KGVISSHALGAT 192
           A+WG+E+ +G  +G  P +  LATL ++ RR  +   Q   AL +++   ++    +G+ 
Sbjct: 158 AIWGMESSYGSFVGDLPTIDALATLGFEGRREAWARNQLLVALKILQSHDIVRVQMVGSW 217

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QFLP   + YA+DAD DG+ D+  S  D +AS A FL   GW     +    +
Sbjct: 218 AGAMGQTQFLPSVFLAYAVDADGDGRRDIWGSVPDVMASTANFLVGSGWQAGQPWGAEVR 277



 Score = 47.9 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 8/32 (25%), Positives = 15/32 (46%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVPIGK 284
           NF  +  +N S +Y   +  +A  + G P  +
Sbjct: 335 NFRTILRYNNSTSYALGVHLLAQRLAGGPAIQ 366


>gi|153001147|ref|YP_001366828.1| lytic murein transglycosylase [Shewanella baltica OS185]
 gi|151365765|gb|ABS08765.1| lytic murein transglycosylase [Shewanella baltica OS185]
          Length = 438

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 79/229 (34%), Positives = 121/229 (52%), Gaps = 3/229 (1%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
            A   P    +  +  + A+ F    +  +ARA  EG+S  T     A+L+++   I  D
Sbjct: 48  AAEANPMPDISASVQEN-AEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELD 106

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           ++       +F +Y    ++   + +G  L + +S LL  L KEYGVPP  +++ WGLET
Sbjct: 107 QQQPE-FSQTFDNYFSKRATEWRVNEGRRLLQKHSVLLNQLAKEYGVPPQYILSFWGLET 165

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           ++G   GK  +L++LATLA + RR+ +FT +   AL L +K       + G+  G +G  
Sbjct: 166 NYGSYKGKMSVLNSLATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHT 225

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QF+P    KYA+D D DGK DL  S  DA+ SAA FL  LGW +   + 
Sbjct: 226 QFMPSAYAKYAVDGDGDGKADLWNSTTDALTSAANFLQHLGWQRNERWG 274


>gi|258621278|ref|ZP_05716312.1| Membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM573]
 gi|258586666|gb|EEW11381.1| Membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM573]
          Length = 331

 Score =  192 bits (486), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 75/328 (22%), Positives = 134/328 (40%), Gaps = 72/328 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L   ++ P  A            FG++    + +A  EG+S +     F D+EY 
Sbjct: 12  LLSIVLGLTLSAPVLANEV--------SFGQYVERLKQQAREEGISERILSEAFRDVEYK 63

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 64  PRAVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYDELQRIGKQYGVQPRFIV 122

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 123 ALWGVESNFGALTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPEAMKGSW 182

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W----- 241
            G +GQ QF+P + + +A D D DGK D+  +  D  AS A +L++ G      W     
Sbjct: 183 AGAMGQCQFMPSSFLNFAADGDGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWGRQVK 242

Query: 242 --------------TKCAGYQPGEK----------------------------------- 252
                          K    Q   K                                   
Sbjct: 243 IPKGFDHDLEGRQSEKGKTLQEWSKLGVTRYDGKPLPALSDDIKAWLIMPDDEAGRIYLV 302

Query: 253 --NFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 303 YNNYNVLMKWNRSYYFALAVSHLADRIK 330


>gi|27378970|ref|NP_770499.1| hypothetical protein blr3859 [Bradyrhizobium japonicum USDA 110]
 gi|27352120|dbj|BAC49124.1| blr3859 [Bradyrhizobium japonicum USDA 110]
          Length = 270

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 95/267 (35%), Positives = 141/267 (52%), Gaps = 10/267 (3%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           ++    + A A+           C  +   F  WK    A A  +G+ P           
Sbjct: 6   IVATAVIGAAALLLSLPVANAAQCGSSPAGFEGWKREFSAEAQGKGIGPTAI-SALMQTN 64

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y   TIA DR   +   +S   +L    ++ I+A+G  LK++ + L  ++++ YGVPPG 
Sbjct: 65  YASATIAADRGQRS-FSLSLDQFLAKRGATTIVAKGRQLKQSQAALFASIQQRYGVPPGP 123

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGA 191
           L+A+WG+ET FG   G   +LS++ATLAYDCRR +FFT+Q + AL L+ +G +S    G+
Sbjct: 124 LIAIWGMETGFGSQRGNQNMLSSIATLAYDCRRPEFFTDQLYAALKLIDRGTLSGATRGS 183

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             GE+GQ QF+P N++ Y            ++   +A+ S A FL   GW   AGYQPGE
Sbjct: 184 MHGEVGQTQFMPKNILAYGTGN--------LEVAANALNSTANFLKAHGWRAGAGYQPGE 235

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHID 278
            NFA ++ WNA+  Y K IA +   ID
Sbjct: 236 PNFAAIEAWNAAGVYQKAIALMGRQID 262


>gi|312963230|ref|ZP_07777714.1| lytic murein transglycosylase [Pseudomonas fluorescens WH6]
 gi|311282496|gb|EFQ61093.1| lytic murein transglycosylase [Pseudomonas fluorescens WH6]
          Length = 441

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 74/294 (25%), Positives = 127/294 (43%), Gaps = 25/294 (8%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQPKKATTQFIC----------------------SDTADR 41
           + +L   +      +L     +P  A  Q +                             
Sbjct: 8   RWHLRQLIAASSLILLVACAEKPTAADAQPLPKLSTAPVVAPAVVAPLAVDNLDIQPTQT 67

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EW++  R  A++ G++     + FA++      I  DR           +YLDG  S 
Sbjct: 68  FAEWQAGFRVDALKAGITAAVFDNAFANVTPDMAVIRADRSQPE-FSRPVWEYLDGALSP 126

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G AL    + +L ++++ YGV    L+++WG+E++FG+  G   ++ +LATLAY+
Sbjct: 127 VRVRNGQALLIKYADILQSIEQRYGVDRQALVSVWGMESNFGQFQGNNSVIRSLATLAYE 186

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  F   Q   AL +++ G I +  + G+  G +GQ QF+P     +A+D D DG+ D
Sbjct: 187 GRRPAFAQAQLLAALQIIQHGDIQADQMKGSWAGAMGQTQFIPTTYNTHAVDFDGDGRRD 246

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKT-IAYI 273
           +  S  DA+AS A +L   GW K   +    K       +  +    +  +A  
Sbjct: 247 IWNSPADALASTAHYLQSSGWQKGQPWGFEVKQLPANFDYALADGGVRKSVAEW 300


>gi|262374693|ref|ZP_06067965.1| lytic murein transglycosylase B [Acinetobacter junii SH205]
 gi|262310349|gb|EEY91441.1| lytic murein transglycosylase B [Acinetobacter junii SH205]
          Length = 430

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 78/359 (21%), Positives = 132/359 (36%), Gaps = 72/359 (20%)

Query: 1   MSFKKYLLISLLMMVY-------PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
           M       +   +           ++  A       T        +  F    +  R++A
Sbjct: 1   MKHSLRFFLGTALFTLFNQAHAELVINGATISATTVTPTSNVYSPSSNFQGCLANLRSQA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  T      +L    + I +             DYL GL  +E +  G      
Sbjct: 61  IASGVSASTYDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDNERVQAGQQKLTQ 119

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L  +++ YGVP   ++A+WG+E+++G+  GK PLL  L TL+ + RR  +F  +FF
Sbjct: 120 HQDVLRRVEQAYGVPAETVVAVWGVESNYGDISGKYPLLQALGTLSCEGRRQGYFRGEFF 179

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + ++++G ++     G+  G  G  QF+P      A+D D DG+ DLV S  DA+AS 
Sbjct: 180 ATMRILQRGDLTQDQLYGSWAGAFGHTQFMPSTYESLAVDFDGDGRRDLVSSTTDALAST 239

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHW------------------- 260
           A FL + GW     +                 +N   L HW                   
Sbjct: 240 ANFLKRAGWQTGMPWGFEVKIPDGMSISGESRRNKKSLNHWIAQGLTRADGTALIQGNLS 299

Query: 261 ------------------------------NASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
                                         NA+ +Y   IA+++  + G  P    + T
Sbjct: 300 GSTLAGLMAPAGSNGPVFLVFKNFDAIYSYNAAESYGLAIAHLSDRLRGGTPFLTSWPT 358


>gi|120611895|ref|YP_971573.1| lytic murein transglycosylase [Acidovorax citrulli AAC00-1]
 gi|120590359|gb|ABM33799.1| lytic murein transglycosylase [Acidovorax citrulli AAC00-1]
          Length = 470

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 70/259 (27%), Positives = 112/259 (43%), Gaps = 14/259 (5%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
                   F EW +  R  A++ G+ P+         ++L   I  DR        +   
Sbjct: 93  SAEAEQAGFAEWIAGFRQEALQAGIRPEAVAAALDGAQWLPQVIELDRSQPE-FTRTPWA 151

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           YLD   S   I +G          L +    YGVP  ++ A+WG+E+++G   G    + 
Sbjct: 152 YLDSAVSPTRIQRGRDALAEQRAALDSAAARYGVPAEVITAIWGMESNYGSNFGTFRTVD 211

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
            LATLAY+ RR  +   +   AL ++ +G I++  + G+  G +G  QFLP   + YA+D
Sbjct: 212 ALATLAYEGRRRDWARGELLAALRIIDQGDIAADRMIGSWAGAMGHTQFLPSVFLGYAVD 271

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAY 272
           AD DG  D+  S  D  AS A FL+++GW     +    +       +  +      + +
Sbjct: 272 ADGDGHRDIWGSVPDVAASTANFLSRMGWQPGQPWGVEVR-LPPGFDYERAE---LAVRH 327

Query: 273 ----IAAH----IDGVPIG 283
                AA     IDG P+ 
Sbjct: 328 PSTQWAAEGVQAIDGQPLP 346



 Score = 50.2 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
            NF ++  +N S+NY   +  +A+ I G P
Sbjct: 368 PNFRVILRYNNSINYALGVGLLASQIAGGP 397


>gi|197336114|ref|YP_002156523.1| membrane-bound lytic murein transglycosylase B [Vibrio fischeri
           MJ11]
 gi|197317604|gb|ACH67051.1| membrane-bound lytic murein transglycosylase B [Vibrio fischeri
           MJ11]
          Length = 323

 Score =  191 bits (485), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 68/247 (27%), Positives = 120/247 (48%), Gaps = 16/247 (6%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
            K+ LL+ ++ +     A A  +                F  +    +  A   G+S   
Sbjct: 1   MKRKLLLGIVSLFLATSASATPE--------------GDFQYYIVGLKNEAREIGISEPI 46

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
            +  F ++ + +  +  DR       ++  +Y+        I Q   L K + + L  + 
Sbjct: 47  LERAFKNVAFKEKAVKSDRNQPEK-KLTLDEYIPRAVPKWKIKQANDLYKKHYKELNRIG 105

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           +EYGV P  ++ALWG+E++FG+  G   ++  L TLAYD RR  FF +Q   AL ++++G
Sbjct: 106 EEYGVQPRFIVALWGVESNFGKLTGGYNVIEALTTLAYDGRREAFFKKQTMAALTILQQG 165

Query: 183 VISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I+  +  G+  G +GQ QF+P + + YA+D + DGK D+  ++ D  ASAA +L ++GW
Sbjct: 166 HITPENMKGSWAGAMGQCQFMPTSFLSYAVDGNGDGKKDIWNTHADVFASAANYLKQVGW 225

Query: 242 TKCAGYQ 248
                + 
Sbjct: 226 DDTYTWG 232



 Score = 36.8 bits (83), Expect = 4.0,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 296 YNNYQVLMDWNRSHYFALAVSHLADSIK 323


>gi|163733182|ref|ZP_02140626.1| transglycosylase, putative [Roseobacter litoralis Och 149]
 gi|161393717|gb|EDQ18042.1| transglycosylase, putative [Roseobacter litoralis Och 149]
          Length = 451

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 108/222 (48%), Gaps = 3/222 (1%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
           A T    + +A  F  W S  + RA R+G+   T    F  + +    I RDR       
Sbjct: 70  AETALALATSAAGFDAWVSGFKQRATRQGIRSATLDPAFRGVTFDSDVIRRDRNQSE-FT 128

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
            +   YL   +S   IA G A    +   L  +++ YGV   +++A+WGLE+ +G   G 
Sbjct: 129 KTIWQYLASAASDRRIANGKAALAKHRTTLEAIERRYGVEKEVVVAVWGLESGYGAYRGS 188

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVV 207
             ++ +L+TLAY+ RR  FF EQ   AL +++ G  +  +  G+  G +G  QF+P + +
Sbjct: 189 NDVIRSLSTLAYEGRRGAFFEEQLIAALKILQNGDTAPRNMTGSWAGAMGHTQFIPTSYL 248

Query: 208 KYAIDADEDGKIDLVK-SNIDAIASAAKFLAKLGWTKCAGYQ 248
            YA+D   DG+ D+      DA+AS A +L   GW     + 
Sbjct: 249 AYAVDFTGDGRRDIWSEDPTDALASTAAYLKNAGWKTGQPWG 290



 Score = 47.6 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHID-GVPIGKGYDT 288
            NFA ++ +NA+  Y   + +++  I  G PI   + T
Sbjct: 351 DNFAAIERYNAADAYVIGVGHLSDRIKGGGPIRSSWPT 388


>gi|114766698|ref|ZP_01445637.1| Membrane-bound lytic murein transglycosylase B [Pelagibaca
           bermudensis HTCC2601]
 gi|114541088|gb|EAU44143.1| Membrane-bound lytic murein transglycosylase B [Roseovarius sp.
           HTCC2601]
          Length = 415

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 74/250 (29%), Positives = 124/250 (49%), Gaps = 6/250 (2%)

Query: 4   KKYLLIS---LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           +++LL+S   L ++       +V+ P       +       +  W +A R RA   G+S 
Sbjct: 5   RRHLLVSGGALALLSACGGGTSVSAPSGGLDPDLLPQPNPGYDAWVAAFRGRAAARGISA 64

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T    F    YL   + RDR        + +DYL   +S + ++ G A  + N  LL  
Sbjct: 65  GTLDAAFRGAGYLPGVVTRDRSQTE-FTRTLEDYLAIAASEQKVSTGRAELRRNMALLRE 123

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++  YGVPP ++ A+WG+E+++G   G  P++S  +TLAYD RR +FF  Q   AL +++
Sbjct: 124 IEGRYGVPPEVVTAVWGMESNYGTRRGDIPVVSATSTLAYDGRRGEFFEAQLISALRILE 183

Query: 181 KGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAKFLAK 238
           +G  +     G+  G +G  QF+P     YA+D   DG+ D+      D +AS A +L++
Sbjct: 184 RGDTTPSRLTGSWAGAMGHTQFIPTTYQDYAVDFRGDGRRDIWSEDPTDGLASTANYLSR 243

Query: 239 LGWTKCAGYQ 248
            GW +   + 
Sbjct: 244 SGWRRGEPWG 253



 Score = 46.4 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 6/34 (17%), Positives = 17/34 (50%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
           +NF ++  +N +  Y   + +++  + G    +G
Sbjct: 313 QNFNVILRYNNAEKYGVGVGHLSDRLAGGGPVRG 346


>gi|54308274|ref|YP_129294.1| putative lytic murein transglycosylase [Photobacterium profundum
           SS9]
 gi|46912702|emb|CAG19492.1| putative lytic murein transglycosylase [Photobacterium profundum
           SS9]
          Length = 323

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 69/251 (27%), Positives = 122/251 (48%), Gaps = 15/251 (5%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
             K L+ +++++   + + A +               + F E+ S  +  A   G+S   
Sbjct: 1   MHKRLISAMVVIGLGISSSAFSA-------------NEGFDEYVSGLKVEARSNGISESI 47

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
               F +++Y +  +  D+       ++  +Y+        + Q   L   +   L  + 
Sbjct: 48  INSAFDNIQYTERAVKADKNQPEK-KLTLDEYIPRAVPDWKVKQANRLYNEHKTALDRIG 106

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           +EYGV P  ++ALWG+E++FG  MG   ++  L+TLAYD RR  FF +Q   AL ++ +G
Sbjct: 107 REYGVQPRFIVALWGVESNFGRLMGDYNVVEALSTLAYDGRREAFFRKQVMAALQILNEG 166

Query: 183 VISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I+  +  G+  G +GQ QF+P + + YA+D + DGKID+ ++  D  ASAA +L   GW
Sbjct: 167 HIAPENMKGSWAGAMGQPQFIPTSFLTYAVDGNNDGKIDIWQNVDDVFASAANYLKMSGW 226

Query: 242 TKCAGYQPGEK 252
                +    K
Sbjct: 227 NDEYTWGRQVK 237


>gi|160875817|ref|YP_001555133.1| lytic murein transglycosylase [Shewanella baltica OS195]
 gi|160861339|gb|ABX49873.1| lytic murein transglycosylase [Shewanella baltica OS195]
 gi|315268008|gb|ADT94861.1| lytic murein transglycosylase [Shewanella baltica OS678]
          Length = 438

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 79/228 (34%), Positives = 122/228 (53%), Gaps = 3/228 (1%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           A   P    +  + ++ A+ F    +  +ARA  EG+S  T     A+L+++   I  D+
Sbjct: 49  AEANPMPDISASVQAN-AEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELDQ 107

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
           +       +F +Y    ++   + +G  L + +S LL  L KEYGVPP  +++ WGLET+
Sbjct: 108 QQPE-FSQTFDNYFSKRATEWRVNEGRRLLQKHSVLLNQLAKEYGVPPQYILSFWGLETN 166

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQ 200
           +G   GK  +L++LATLA + RR+ +FT +   AL L +K       + G+  G +G  Q
Sbjct: 167 YGSYKGKMSVLNSLATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHTQ 226

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           F+P    KYA+D D DGK DL  S  DA+ SAA FL  LGW +   + 
Sbjct: 227 FMPSAYAKYAVDGDGDGKADLWNSTTDALTSAANFLQHLGWQRNERWG 274


>gi|118588409|ref|ZP_01545818.1| Lytic murein transglycosylase [Stappia aggregata IAM 12614]
 gi|118439115|gb|EAV45747.1| Lytic murein transglycosylase [Stappia aggregata IAM 12614]
          Length = 439

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 65/228 (28%), Positives = 106/228 (46%), Gaps = 3/228 (1%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
                      + +     F  + S     A   G+S +T   +F  ++  + T+    K
Sbjct: 48  AAATGTLLAVSLPAQADQGFSRFVSGFWPTARAAGISSQTYNAVFTGMQPDEDTLRLMSK 107

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                     DYLD   S   + +G  + K  S++L  ++  YGV    ++A+WG+ET++
Sbjct: 108 QSE-FVKPIWDYLDSAVSDTRVEKGREMLKEYSQVLAVIENRYGVDREAVLAIWGMETNY 166

Query: 143 GETMGKTPLLSTLATLAYD-CRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQ 200
           G  MG+  ++  LATLAY   RR  F+ ++   AL +V+ G +      G+  G +G  Q
Sbjct: 167 GGFMGRHNVIQALATLAYAAPRRKSFWEKELVTALAIVQAGHVRFQDMEGSWAGAMGHTQ 226

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           F+P +   YA D D DG+ D+  S  DA+AS A +L K GW     + 
Sbjct: 227 FMPSSWKAYAADYDGDGRRDIWTSIPDALASTAAYLQKHGWQTGKTWG 274



 Score = 51.8 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/138 (15%), Positives = 44/138 (31%), Gaps = 18/138 (13%)

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
            +   LA+ A   ++  + T + +     +  G     A G     +G          +Y
Sbjct: 250 SIPDALASTAAYLQKHGWQTGKTWGYEVALPSGFDYHMADGEKTLTLG-------EWGRY 302

Query: 210 AIDA-DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNK 268
            I   +         + I  + + A                  KNF ++K +N +  Y  
Sbjct: 303 GIRRTNGKDFPRPSDNAILVLPAGA----------SGPAFLMLKNFYVIKRYNNATAYAL 352

Query: 269 TIAYIAAHIDGVPIGKGY 286
            + ++A  I G    +G 
Sbjct: 353 AVGHLADRIIGGGPIEGD 370


>gi|254453385|ref|ZP_05066822.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
 gi|198267791|gb|EDY92061.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
          Length = 267

 Score =  191 bits (485), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 92/266 (34%), Positives = 135/266 (50%), Gaps = 3/266 (1%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++      AV+          C + A  F  WK A    A   G+         A+ +Y 
Sbjct: 4   LLSAAFTAAVSLAVAPALAAPCGNDASGFSAWKLAFAQEAAAAGVGQSGL-SALANAQYS 62

Query: 74  DTTIARDRKM-VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
            +TI  DR        ++    +   S     +Q    +  N     +L++ YGVP GIL
Sbjct: 63  HSTIRADRNQTGVRYELNDFIRIRLGSLDSFASQMRREQNKNPTFYASLEQAYGVPAGIL 122

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+ G+ET FG TMG TP++ +++T+AYDCRR+ FFT     AL LV +G +     GA 
Sbjct: 123 LAIHGMETGFGRTMGSTPVVDSISTVAYDCRRSAFFTPHAIAALMLVDQGGLDPTQQGAA 182

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GE+G  QFLP N ++Y +DAD +G++DL  S  D++AS A FL + GW     +Q G  
Sbjct: 183 HGEMGHTQFLPGNALRYGVDADGNGRVDLY-SITDSLASTANFLRQKGWQPGQSFQEGSA 241

Query: 253 NFAILKHWNASLNYNKTIAYIAAHID 278
           NF +L  WNA+  Y + IA  AA + 
Sbjct: 242 NFRVLNDWNAATVYQQAIALSAARLQ 267


>gi|227823392|ref|YP_002827365.1| putative peptidoglycan-binding protein [Sinorhizobium fredii
           NGR234]
 gi|227342394|gb|ACP26612.1| putative peptidoglycan-binding protein [Sinorhizobium fredii
           NGR234]
          Length = 405

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 73/309 (23%), Positives = 122/309 (39%), Gaps = 63/309 (20%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPVSF 91
              +     F  W ++  A A + G++  T +  FA ++      I +            
Sbjct: 24  PSAARADQGFQNWINSFYATAAKSGITQATYRKAFAGVKTPDPAVIEKANYQPE-FKHKI 82

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP- 150
            +Y+D   +      G  +   + R L  +++ +GV   IL+A+W +E+++G  + K   
Sbjct: 83  WEYIDSRVNPYTRRIGQEMAAKHGRTLDAIERHFGVDRSILLAVWSMESNYGAVLQKDDR 142

Query: 151 ---LLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVN 205
              +   LATLAY D +RAKF   Q   AL +++ G I+     G+  G +G  QF+P +
Sbjct: 143 LHYVPRALATLAYADPKRAKFAKTQLIAALKILQSGDITPRELTGSWAGAMGHTQFIPTS 202

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ----------------- 248
            + YA+DAD +G  D+  S  DA+A+AA  L K GW     +                  
Sbjct: 203 YLLYAVDADGNGHRDIWNSVPDALATAANLLRKNGWQAGETWGYEVVPPANAGKYSGQTK 262

Query: 249 ------------PGEKNFA--------------------------ILKHWNASLNYNKTI 270
                       P  K F                           ++K +NAS +Y   +
Sbjct: 263 TLGQWAALGFLRPNGKGFRNAKTRAELKLPGGGGGPGFLMTRNFFVIKRYNASDSYALGV 322

Query: 271 AYIAAHIDG 279
             +A  I G
Sbjct: 323 GLLADQISG 331


>gi|269967934|ref|ZP_06181974.1| Membrane-bound lytic murein transglycosylase B [Vibrio
           alginolyticus 40B]
 gi|269827457|gb|EEZ81751.1| Membrane-bound lytic murein transglycosylase B [Vibrio
           alginolyticus 40B]
          Length = 323

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 71/257 (27%), Positives = 126/257 (49%), Gaps = 14/257 (5%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +++ F E+ +  RA A  +G+S +     FA++EY    +  DR       ++  +Y+  
Sbjct: 20  SSEGFDEYLNKLRAEARDKGISEQVISAAFANVEYKPRAVKADRNQPEK-KLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  EYGV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQARQLYKEHYTELKRIGDEYGVHPRFIVALWGVESNFGKFTGNFKVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I   +  G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMSALQILDQGHIELENFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNAS--------LNYNK 268
           GK D+ +S  D  AS A +L+K GW     +    K    +     S          Y +
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGWDDKYTWGRQVKVPKNIDR---SLEGRTAEKGKYLQ 255

Query: 269 TIAYIA-AHIDGVPIGK 284
             + +     DG P+ K
Sbjct: 256 EWSQLGITKYDGSPLPK 272


>gi|297182413|gb|ADI18577.1| membrane-bound lytic murein transglycosylase b [uncultured
           Oceanospirillales bacterium HF4000_23O15]
          Length = 385

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 81/312 (25%), Positives = 120/312 (38%), Gaps = 61/312 (19%)

Query: 28  KATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSP 87
               Q         F EW +A RA A+  G+S  T       LE +   +  D       
Sbjct: 4   AVPIQAQAQTLEQSFDEWITALRAEAIALGISEATL-AALDQLEPVSRVLELDNSQPE-F 61

Query: 88  PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
             +F  YL    +   I +G +L + ++ LL  ++  YGV P  L A W +E++FG   G
Sbjct: 62  VQTFTHYLGLRVTEAQIERGQSLLRQHAALLEEVRSRYGVQPHYLAAFWAIESNFGRNTG 121

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNV 206
              +L  LATLAYD RRA+FF  +   AL ++  G I++ ++ G+  G +GQ QFLP   
Sbjct: 122 GFSVLQALATLAYDPRRAEFFRRELLTALQIIDDGHIAADSMSGSWAGAMGQLQFLPSVF 181

Query: 207 VKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY------------------- 247
             Y +D D DG+ID+  S  D   SAA FL++ GW     +                   
Sbjct: 182 YSYGVDGDNDGRIDIWNSLPDIFHSAANFLSESGWRGDERWGREVILPVNFDFRLSGTGT 241

Query: 248 ---------------------------------QPGEKNFAILKHW------NASLNYNK 268
                                                  F    ++      N S  Y  
Sbjct: 242 RKRLQEWKELGIIQTSGAPIPVADMDASIVLPVGAAGPAFLAYDNYRTTLVYNPSTFYAL 301

Query: 269 TIAYIAAHIDGV 280
           T+ ++A    G 
Sbjct: 302 TVGHLADRFTGS 313


>gi|166713682|ref|ZP_02244889.1| transglycosylase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 425

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 77/280 (27%), Positives = 126/280 (45%), Gaps = 11/280 (3%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADR------FGEWKSAARARAVRE 56
            +  L +S+ +    + AQA+     AT                 F +W +  R RA+  
Sbjct: 8   LRLSLGVSVCVAATSVAAQAIAPETTATPTTDAGAQQQDPAPIVSFEQWLADFRQRALAA 67

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+   T  + FA +    +  A D++          DYLD   +   I +G  L  +   
Sbjct: 68  GIRATTLDNAFAGVTPDPSVQALDQQQPE-FTRYLWDYLDARVTPSAIQEGQQLLISKHA 126

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           L   L+++YGV PGIL A+W +E+ +G  +G   ++ +LATLA++ RR  +   Q   AL
Sbjct: 127 LFQKLRQQYGVDPGILTAIWSMESGYGTQIGDFYVIRSLATLAHEGRRTTYGNTQLLAAL 186

Query: 177 D--LVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
                +K +  S  +G+  G +GQ QF+P     YA+D D D K D+  S  DA+ SAA 
Sbjct: 187 QILQTEKNIDRSQLVGSWAGAMGQTQFVPSTYRDYAVDEDGDQKRDVWNSKADALGSAAN 246

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASL-NYNKTIAYI 273
           +L +  W     +   E + +    +  +     KT+A  
Sbjct: 247 YLKQNNWNSAIPWGQ-EVHLSASFDYAQADLTIKKTVAQW 285



 Score = 43.7 bits (101), Expect = 0.035,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 11/28 (39%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDG 279
            NF  +  +N S  Y   +  +A    G
Sbjct: 322 DNFRSILRYNNSTAYALAVGLLADGYAG 349


>gi|289669825|ref|ZP_06490900.1| transglycosylase [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 425

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 79/279 (28%), Positives = 127/279 (45%), Gaps = 9/279 (3%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATT------QFICSDTADRFGEWKSAARARAVRE 56
            +  L +S+ +    + AQA+     A++      Q   S     F +W +  R RA+  
Sbjct: 8   LRLTLGVSVCVAATSVAAQAIAPETTASSVTDAGGQQQDSAPTASFEQWLADFRQRALAA 67

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+   T  + FA +    +    D++          DYLD   +   I +G  L  +   
Sbjct: 68  GIEATTLDNAFAGVTPDPSVQKLDQQQPE-FTSYLWDYLDARVTPSAIQEGQQLLISQHA 126

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           L   L++ YGV PGIL A+W +E+ +G  +G   ++ +LATLA++ RR  +   Q   AL
Sbjct: 127 LFEKLRQHYGVDPGILTAIWSMESGYGTQIGDFYVIRSLATLAHEGRRTTYGNTQLLAAL 186

Query: 177 DLVKKGVI--SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            +++       S  +G+  G +GQ QF+P     YA+D D D K D+  S  DA+ SAA 
Sbjct: 187 QILQTEKSIARSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKRDVWNSKADALGSAAN 246

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
           +L +  WT    +       A   +  A L   KT+A  
Sbjct: 247 YLKQNNWTSAVPWGQEVHLPAGFDYAQADLTIKKTVAEW 285



 Score = 44.5 bits (103), Expect = 0.021,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 11/29 (37%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  +  +N S  Y   +  +A    G 
Sbjct: 322 DNFRSILRYNNSTAYALAVGLLADGYAGR 350


>gi|271500438|ref|YP_003333463.1| lytic murein transglycosylase [Dickeya dadantii Ech586]
 gi|270343993|gb|ACZ76758.1| lytic murein transglycosylase [Dickeya dadantii Ech586]
          Length = 440

 Score =  191 bits (484), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 63/255 (24%), Positives = 111/255 (43%), Gaps = 4/255 (1%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
             +T      T        + F +WK+  R  A+ +G++  T    FA L   +  +A  
Sbjct: 48  SLLTAHGITDTPTGLPTPDESFEQWKAEVRQDALAQGITADTFDSAFAGLTPDNDVVAAT 107

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           +K        +  Y+    + + +AQG AL K   ++   +++ Y V P +L A   +E+
Sbjct: 108 QKQPEVIVPVWT-YIAQRVTPDNLAQGKALLKQYQKVTARIEQRYQVDPPLLFAFLSIES 166

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQF 199
           ++G   G   ++ +LATL Y   R  F  +    AL +++ G        G+  G +G  
Sbjct: 167 NYGANTGNKAVVRSLATLDYYNYRRAFNRQNLIAALRMIQNGDARPEQIKGSWAGAMGMP 226

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH 259
           QF+P + ++YA+D D D   D+  S  D +AS A ++ +  W     +   E N      
Sbjct: 227 QFIPTSYLQYAVDFDGDHHPDIWTSFPDTLASVANYMQQAKWKAGVPWG-MEVNLPARFD 285

Query: 260 WNASLN-YNKTIAYI 273
           +  S     KT+A  
Sbjct: 286 YAVSGLDNQKTVADW 300


>gi|157370994|ref|YP_001478983.1| lytic murein transglycosylase [Serratia proteamaculans 568]
 gi|157322758|gb|ABV41855.1| lytic murein transglycosylase [Serratia proteamaculans 568]
          Length = 346

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 71/221 (32%), Positives = 117/221 (52%), Gaps = 4/221 (1%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
                   +F  +    + +A+ +G+SP      FA++ ++D  I  DR       ++  
Sbjct: 42  AETGRDPAQFPAYVEQLKRQALAQGISPAIVASAFANVHFVDRVIKADRNQPEK-KITLD 100

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  +     IAQG AL +     L  +   YGVP   ++ALWG+E+ FG+  G+  ++
Sbjct: 101 DYLKRVLPPAKIAQGRALYRQYQPQLSRVTAHYGVPGRYVVALWGMESAFGKIQGREDVI 160

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAI 211
           S LATLA++ RR  FF++Q   AL ++++G +S     G+  G +GQ QF+P + + Y  
Sbjct: 161 SALATLAFEGRREAFFSQQLMAALRILEQGHVSREQLKGSWAGAMGQCQFMPTSFLNY-- 218

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            AD DG+ID+  +  D  AS A++L++ GW    G+    K
Sbjct: 219 AADGDGRIDIWNNVDDVFASTARYLSREGWQPGVGWGREVK 259


>gi|332533390|ref|ZP_08409255.1| membrane-bound lytic murein transglycosylase B precursor
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037099|gb|EGI73556.1| membrane-bound lytic murein transglycosylase B precursor
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 338

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 74/278 (26%), Positives = 126/278 (45%), Gaps = 29/278 (10%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +    ++ P  A TQ         F ++ +  +  A+ +G   K     FA   Y 
Sbjct: 5   LIVILCGVCLSSPVMAKTQ-------AEFQDYLANLKQEAIAKGYEAKLIDDAFATATYK 57

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
           +  ++ D+        + + YL        I +   L   N  +L  + KE+GV    ++
Sbjct: 58  EKVVSADKNQPEV-KETLETYLPKRVPQWKIDRARKLYAENKEVLEKVAKEFGVQARFIV 116

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GAT 192
           ALWGLE++FG   G   ++S+L TLA+D RR   +  Q + ALD++K G I+     G+ 
Sbjct: 117 ALWGLESNFGTIQGGHNVISSLVTLAFDGRREALYKRQLWAALDILKSGHITLDKFKGSW 176

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QF+P +   YA+D + DG+ D+  +  DA AS A +L + GW     +    +
Sbjct: 177 AGAMGQTQFMPTSFNAYAVDYNNDGRKDIWTTKEDAFASIANYLKQEGWNDSLTWGRQVQ 236

Query: 253 ---NFAI--------------LKHWNASLNYNKTIAYI 273
              NF                L++WN S    +++A  
Sbjct: 237 LPENFDSKYVLVRGTKTRKQWLEYWNDSE---RSLADW 271



 Score = 37.9 bits (86), Expect = 1.9,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHI 277
              N+ +  HWN S  +  ++ Y++  I
Sbjct: 306 AYDNYKVFMHWNRSYYFATSVGYLSDRI 333


>gi|114705817|ref|ZP_01438720.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Fulvimarina pelagi HTCC2506]
 gi|114538663|gb|EAU41784.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Fulvimarina pelagi HTCC2506]
          Length = 274

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 87/265 (32%), Positives = 138/265 (52%), Gaps = 7/265 (2%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI- 77
           +A A++    +     C +    F +WK      A + G+  +  +   A   Y   TI 
Sbjct: 13  IAAALSLGATSAYAQQCGNGPGGFEQWKQQFAGVAQQNGVGSRGLQ-ALASARYNQKTIQ 71

Query: 78  --ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
                ++  ++  +S   +L     + I+A G      N  +  ++++ YGVPPG ++A+
Sbjct: 72  IDRAAQRGGSAFTMSLDTFLKKRGGASIVATGKRKLAQNRGMFQDIERRYGVPPGPILAI 131

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGE 195
           WG+ET FG  MG   ++S+ AT+AYDCRR  FF      AL LV +G +S ++ GA  GE
Sbjct: 132 WGMETGFGGFMGGENVVSSAATIAYDCRRTDFFKPHLIAALQLVDRGGLSPNSRGAGHGE 191

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFA 255
            G  QFL  N+++Y +DAD +G++DL  S  DA+ S A FL   G T    YQ G+  + 
Sbjct: 192 YGHTQFLAANILRYGVDADGNGRVDLASSR-DALYSTANFLRSHGMT--QNYQQGQAGYR 248

Query: 256 ILKHWNASLNYNKTIAYIAAHIDGV 280
            ++ WNA+  Y + IAY+ + ID  
Sbjct: 249 GIQGWNAAPVYQQAIAYLGSQIDAA 273


>gi|332141835|ref|YP_004427573.1| putative transglycosylase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551857|gb|AEA98575.1| putative transglycosylase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 353

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 125/249 (50%), Gaps = 4/249 (1%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L+ S + +++ ML   ++   +A T      T   F  + +  +  A+ +G+      
Sbjct: 22  KRLIASKVPLIFIMLTLLLSASIEAATN--SELTERGFNAYVAQLKEEALSKGIDRPLLD 79

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             FAD+ +  T +  D+       ++  DYL        + Q +A  K +  LL  + + 
Sbjct: 80  AAFADIAFRPTVVKSDKNQPEK-KITLDDYLATRVPDWKVKQAVAQYKDHKALLEEIAQR 138

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGV    ++ALWG E++FG+  G   +LS LA+LAY+ RR K F + FF AL ++ KG  
Sbjct: 139 YGVQSRFIVALWGNESNFGKIQGNYSVLSALASLAYEGRREKLFKDNFFAALQILAKGHT 198

Query: 185 SSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           S +   G+  G +GQ QF+PV+ + YA+D D DG+ D+  +  D  AS A +LA  GW  
Sbjct: 199 SVNELKGSWAGAMGQTQFMPVSFLNYAVDYDGDGRKDIWGTKADVFASIANYLASEGWNS 258

Query: 244 CAGYQPGEK 252
              +    K
Sbjct: 259 EGTWGRQVK 267


>gi|254226498|ref|ZP_04920083.1| lytic murein transglycosylase, putative [Vibrio cholerae V51]
 gi|125621004|gb|EAZ49353.1| lytic murein transglycosylase, putative [Vibrio cholerae V51]
          Length = 323

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 75/328 (22%), Positives = 135/328 (41%), Gaps = 72/328 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L  A++ P  A            F ++    + +A  EG+S +     F D+EY 
Sbjct: 4   LLSIVLGLALSAPVLANEV--------SFEQYVERLKQQAREEGISERILNEAFRDVEYK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             ++A D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 56  PRSVAADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYTELQRIGKQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 115 ALWGGESNFGAFTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPDAMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W----- 241
            G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ G      W     
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWGRQVK 234

Query: 242 --------------TKCAGYQPGEK----------------------------------- 252
                          K    Q   K                                   
Sbjct: 235 IPKGFDHALEGRQPEKGKTLQEWSKLGVTRYDGKPLPALSDDIKAWLIMPDDEAGRIYLV 294

Query: 253 --NFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSHYFALAVSHLADRIA 322


>gi|229523972|ref|ZP_04413377.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae bv.
           albensis VL426]
 gi|229337553|gb|EEO02570.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae bv.
           albensis VL426]
          Length = 323

 Score =  190 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 120/240 (50%), Gaps = 10/240 (4%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L  A++ P  A            F ++    + +A  EG+S +     F D+E+ 
Sbjct: 4   LLSIVLGLALSAPVLANEV--------SFEQYVERLKQQAREEGISERILNEAFRDVEFK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             ++  D+       ++  +Y+        + Q  +L + +   L  + K+YGV P  ++
Sbjct: 56  PRSVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQSLYEKHYTELQRIGKQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 115 ALWGVESNFGAFTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPEAMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ GW     +    K
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTREDVFASTANYLSQSGWDDKYTWGRQVK 234



 Score = 41.4 bits (95), Expect = 0.17,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSHYFALAVSHLADRIA 322


>gi|300717014|ref|YP_003741817.1| Lytic murein transglycosylase [Erwinia billingiae Eb661]
 gi|299062850|emb|CAX59970.1| Lytic murein transglycosylase [Erwinia billingiae Eb661]
          Length = 362

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 68/236 (28%), Positives = 120/236 (50%), Gaps = 2/236 (0%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
                      Q    TT          F  +    +A+A+++G+   T    FA++ ++
Sbjct: 37  PASAPSQGGFLQQPSKTTLAATGRDPAEFPGYVEQLKAQALQQGIDRATVDAAFANVHFV 96

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
           D  I  DR  +    V+  DYL  + + + I QG    +     L+ + ++ GV P  ++
Sbjct: 97  DHVITSDRNQLEK-KVTLSDYLSRVMTDKKIQQGRDNLQLYQGQLMPVSQQTGVQPQYIV 155

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GAT 192
           ALW +E+ FG+  G+  ++S+L+TLA++ RR  FFT++   AL ++++  I    + G+ 
Sbjct: 156 ALWAMESSFGKIQGREDVISSLSTLAFEGRREAFFTKELIAALKIIQQQHIEPEEMKGSW 215

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            G +GQ QF+P ++++Y  D D DGKID+  +  D  AS A +L+K GW     + 
Sbjct: 216 AGAMGQNQFMPSSLMQYGADGDGDGKIDIWNNVDDVFASTANYLSKEGWKAGESWG 271


>gi|149915539|ref|ZP_01904065.1| hypothetical protein RAZWK3B_06277 [Roseobacter sp. AzwK-3b]
 gi|149810431|gb|EDM70274.1| hypothetical protein RAZWK3B_06277 [Roseobacter sp. AzwK-3b]
          Length = 389

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 78/327 (23%), Positives = 127/327 (38%), Gaps = 62/327 (18%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
           + P++          + +    +    F  +  A +  AV  G +P T +  FA +    
Sbjct: 3   ILPLICVLALTAGPLSAE----ECGGSFAGFVGAMKQEAVARGHAPATVERFFAGVRQDP 58

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
             +  DR+      + F D+   L S   + +G  L + +  +   ++++YG+  G+L+A
Sbjct: 59  AVLQADRRQG-VFQMPFTDFARRLISQNRMTKGRDLAQRHDAIFDRIERDYGIDRGVLLA 117

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATF 193
            W  ET +G   G    ++ L TLA+DCRR + F  Q F AL+L + G +      GA  
Sbjct: 118 FWAFETDYGAFQGDYNTVNALVTLAHDCRRPELFRPQVFAALELFENGDLDPATTTGAWA 177

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY------ 247
           GEIG  Q LP +++++  D D DG + L  S  DA+ S A+ L+ LGW     +      
Sbjct: 178 GEIGMVQMLPRDIIEHGSDGDGDGHVSLTSSPEDALLSGARMLSALGWRPNEPWLQEVTV 237

Query: 248 --------------------------------------------QPGEKNF------AIL 257
                                                         G   F       + 
Sbjct: 238 PGDMDWSQSGLRTQMPGADWAAMGLRPRHGEIAGGLQASLLLPQGRGGPAFLAYPNFRVY 297

Query: 258 KHWNASLNYNKTIAYIAAHIDGVPIGK 284
             WN S  Y  T AY A  + G P+ +
Sbjct: 298 FEWNQSFVYVMTAAYFANRLQGAPVFE 324


>gi|325123472|gb|ADY82995.1| transglycosylase, putative [Acinetobacter calcoaceticus PHEA-2]
          Length = 393

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 73/268 (27%), Positives = 118/268 (44%), Gaps = 24/268 (8%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
                   + F    +  R++A+  G+S  T      +L    + I +            
Sbjct: 2   ASEDYTPNNNFQSCLANLRSQAIAAGVSGTTYDRYTQNLTPDYSVIDKLNYQPE-FSTPI 60

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
            DYL GL   E +  G      +  +L    + YGVP   ++A+WG+E++FG+  GK PL
Sbjct: 61  WDYLSGLVDEERVELGKQKLAQHRDVLNRASQTYGVPLETIVAVWGVESNFGDISGKYPL 120

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYA 210
           L  L TL+ + RR  +F  +FF  + ++++G ++     G+  G  G  QF+P    + A
Sbjct: 121 LQALGTLSCEGRRQNYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLA 180

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY-------------QPGEKNFAIL 257
           +D D DG+ DLV S  DA+AS A FL K GW     +               G ++   L
Sbjct: 181 VDFDGDGRRDLVSSTADALASTANFLNKAGWQTGMPWGFEVKVPQGMSIDGEGRRSKKAL 240

Query: 258 KHWNASLNYNKTIAYIAAHIDGVPIGKG 285
             W+      + +      IDG P+ +G
Sbjct: 241 SSWS-----ARGV----TRIDGSPLVQG 259



 Score = 47.2 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 284 KNFDAIYSYNAAESYGLAIAHLSDRLKGAGPFVASWPT 321


>gi|49473830|ref|YP_031872.1| peptidoglycan-binding protein [Bartonella quintana str. Toulouse]
 gi|49239333|emb|CAF25666.1| Peptidoglycan-binding protein [Bartonella quintana str. Toulouse]
          Length = 418

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 73/341 (21%), Positives = 129/341 (37%), Gaps = 73/341 (21%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           + + +++ S+ ++   ++                      F  W    +  A+   +S  
Sbjct: 17  NVRTFIICSVALLSAFLMFFTSFSHA-----------DSNFKCWIKEFKQTALANNISLA 65

Query: 62  TAKHLFADL-EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           T    F  +       + R             +Y D       I +G    +   + L  
Sbjct: 66  TFDMAFRTVNTIDPEVLERAAHQPE-FVDPSWNYFDNRVHDVAIVEGQRQAQKWKKWLHQ 124

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGK----TPLLSTLATLAY-DCRRAKFFTEQFFYA 175
           ++K +GV   IL+A+W +E+++G+ +         + +LATLAY D +RAK+   Q   A
Sbjct: 125 IEKRFGVDRNILLAIWSIESNYGKVLTNKSVIRDTIRSLATLAYADKKRAKYARAQLIAA 184

Query: 176 LDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           + +++ G I  +  +G+  G +GQ QF+P + + YAID DEDG+ D+  S  DA+A+AA 
Sbjct: 185 MKILQSGEITRAQLIGSWAGAMGQTQFIPSSYLAYAIDMDEDGRRDIWLSVPDALATAAN 244

Query: 235 FLAKLGWTKCAGYQ-----PGEKN------------------------------------ 253
            L   GW     +      P  KN                                    
Sbjct: 245 LLHMNGWQPNLPWGVEVKLPQGKNLPKDWHSFEQWTKLGVKHANGHPFPSPSEQAMLKYP 304

Query: 254 -------------FAILKHWNASLNYNKTIAYIAAHIDGVP 281
                        F ++K +N +  Y   +A +A  I G P
Sbjct: 305 DGLEGPIFLVTKNFFVIKRYNNADRYAFAVALLANRIAGHP 345


>gi|261253479|ref|ZP_05946052.1| membrane-bound lytic murein transglycosylase B [Vibrio orientalis
           CIP 102891]
 gi|260936870|gb|EEX92859.1| membrane-bound lytic murein transglycosylase B [Vibrio orientalis
           CIP 102891]
          Length = 321

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 72/325 (22%), Positives = 127/325 (39%), Gaps = 70/325 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++   L  A+     A            F ++    +  A  +G+S +  K  FA++E+ 
Sbjct: 4   LLSVALGLAIASTAYANEV--------SFEQYIEGLKKEAREKGISEQVVKQAFANVEHK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  D        ++  +Y+        + Q  +L K +   L  + +EYGV P  ++
Sbjct: 56  PRAVKADNNQPEK-RLTLDEYIPRAVPDWKVKQAKSLYKEHYAELSKIGEEYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGAT 192
           ALWG+E++FG   G  P++  L+T+AYD RR  FF ++   AL ++ +G I      G+ 
Sbjct: 115 ALWGIESNFGRFTGNYPVIDALSTMAYDGRREAFFRKETMAALQILDEGHIPYEDFKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ---- 248
            G +GQ QF+P + + +A D + DGK D+  S  D  ASAA +L++ GW     +     
Sbjct: 175 AGAMGQCQFMPSSFLSFAADGNGDGKKDIWNSEADVFASAANYLSQYGWNDKFTWGRQVK 234

Query: 249 -----------------------------------------------PGEKNFAILKHWN 261
                                                          P   N  +   +N
Sbjct: 235 LPHGFDMNLEGRVEGKEKTLAQWNQLGITRYDGSSLPQVDVDAWLTAPDNANGRVYLVYN 294

Query: 262 A---------SLNYNKTIAYIAAHI 277
                     S  +   ++++A  I
Sbjct: 295 NYNVLMKWNRSYYFALAVSHLADRI 319


>gi|89067811|ref|ZP_01155255.1| Membrane-bound lytic murein transglycosylase B [Oceanicola
           granulosus HTCC2516]
 gi|89046409|gb|EAR52465.1| Membrane-bound lytic murein transglycosylase B [Oceanicola
           granulosus HTCC2516]
          Length = 419

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 80/323 (24%), Positives = 126/323 (39%), Gaps = 59/323 (18%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
            A      A    +       +  W +A R RA   G+S  T    FAD  +L   I RD
Sbjct: 31  LAAGPADTAPDPALLPQPNPGWDAWVAAFRGRAAARGISAATLDTAFADAGFLPGVIERD 90

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R        + +DYL   +S E +A G A    +   L  ++  YGVP  ++ A+WGLE+
Sbjct: 91  RNQTE-FTRTLEDYLAIAASDERLALGRAAFARHRGALSAIEARYGVPAHVVAAVWGLES 149

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQF 199
            +G  MG  P++S  +TLAY+ RR  FF  Q   AL +++ G     +  G+  G +G  
Sbjct: 150 RYGTRMGDIPVVSATSTLAYEGRRGAFFEAQLMAALRILQSGDTVPSNMTGSWAGAMGHT 209

Query: 200 QFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGY----------- 247
           QF+P     +A+D   DG+ D+      DA+AS A   A  GW +   +           
Sbjct: 210 QFIPTTYEAFAVDFTGDGRRDIWSDDPSDALASTANHFADHGWRQGQPWGMEVVLPAGLD 269

Query: 248 ---------------------------------------QPGEKNF------AILKHWNA 262
                                                  Q G   F       ++  +N 
Sbjct: 270 AGLLGRGKTRAISDWNARGVRTPAGQPIPDYGSAAILVPQAGGPAFMAFRNFEVIARYNN 329

Query: 263 SLNYNKTIAYIAAHIDGVPIGKG 285
           +++Y   + +++  + G P   G
Sbjct: 330 AVSYVIGVGHLSDRLAGGPPLSG 352


>gi|88857332|ref|ZP_01131975.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas tunicata D2]
 gi|88820529|gb|EAR30341.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas tunicata D2]
          Length = 341

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 77/243 (31%), Positives = 126/243 (51%), Gaps = 8/243 (3%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           + ++V+      +T    AT Q       D+F  + +A +  A  +G S    +  FA +
Sbjct: 4   IALVVFSAAGLCLTSAVHATEQ------HDKFNHYVAALKQEAALKGYSNDLIEQAFATV 57

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
           ++ +  I+ D+        + + YL        I +   L + N  LL ++ KEYGV   
Sbjct: 58  QFKEKVISADKNQPEV-KETLETYLPKRVPQWKIDKARRLYQENKPLLDDIAKEYGVQAR 116

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL- 189
            ++ALWGLE++FG+  G  P++S+L TLA+D RR + +  Q + ALD++K G I      
Sbjct: 117 FIVALWGLESNFGKIQGSFPVVSSLVTLAFDGRREEMYKNQLWAALDILKDGHIDIDHFK 176

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
           G+  G +GQ QF+P + V YA+D D+DGK D+ ++  DA AS A +L + GW     +  
Sbjct: 177 GSWAGAMGQTQFMPTSFVAYAVDYDKDGKKDIWQNQKDAFASIANYLKQAGWNNNLTWGR 236

Query: 250 GEK 252
             K
Sbjct: 237 QVK 239



 Score = 39.1 bits (89), Expect = 0.87,   Method: Composition-based stats.
 Identities = 8/29 (27%), Positives = 14/29 (48%)

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHID 278
              N+  L HWN S  +  ++ Y++  I 
Sbjct: 309 AYDNYKALMHWNRSYYFATSVGYLSDRIA 337


>gi|89075747|ref|ZP_01162135.1| putative lytic murein transglycosylase [Photobacterium sp. SKA34]
 gi|89048479|gb|EAR54054.1| putative lytic murein transglycosylase [Photobacterium sp. SKA34]
          Length = 322

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 63/240 (26%), Positives = 112/240 (46%), Gaps = 8/240 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
            +  ++A  +     A          + F  + +  +A A   G+S       F  + + 
Sbjct: 5   FISAVVALGLGISSTAYAAD------EGFNAYINKLKAEARSNGISEPILDSAFKGITFT 58

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  D+       ++   Y+    +   + Q   L + N   L  + KEYGV P  ++
Sbjct: 59  HRAVKADKNQPEK-KLTLDQYIPRAVTDWKVKQARRLYQENKTTLDRIGKEYGVQPRFIV 117

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GAT 192
           ALWG+E++FG+  G   ++  L TLAY+ RR   F +Q   AL ++++G I+   + G+ 
Sbjct: 118 ALWGVESNFGKLQGNYHVVEALTTLAYEGRREALFRKQVMAALQILQEGHITIDEMKGSW 177

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QF+P + + +A+D + DG+ D+  +  D  ASAA +L K GW     +    K
Sbjct: 178 AGAMGQCQFMPTSYLTFAVDGNNDGRADIWNTKADVFASAANYLKKSGWNDKYTWGRQVK 237


>gi|150397906|ref|YP_001328373.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
 gi|150029421|gb|ABR61538.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
          Length = 405

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 75/308 (24%), Positives = 122/308 (39%), Gaps = 61/308 (19%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
              +     F  W +   A A + G+S  T +  FA ++  D  +               
Sbjct: 24  SSPARADQGFQNWINNFYATAAKSGISQATYRKAFAGVKTPDQAVLEKAAYQPEFKHKIW 83

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP-- 150
           +Y+D   +      G  +   ++R L  L++ YGV   +L+A+W +E+++G  + K    
Sbjct: 84  EYIDARVNPYTKRTGQEMAAKHARTLNALERHYGVDKSVLLAIWSMESNYGAILEKDDRL 143

Query: 151 --LLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNV 206
             +   LATLAY D +RAKF   Q   AL +++ G I+     G+  G +G  QF+P + 
Sbjct: 144 HYVPRALATLAYADKKRAKFARTQLIAALKILQSGDITPRELTGSWAGAMGHTQFIPTSY 203

Query: 207 VKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ------------------ 248
           + YA+D D +G  D+  S  DA+A+AA  L K GW     +                   
Sbjct: 204 LLYAVDVDGNGHRDIWNSVPDALATAANLLRKNGWRSGETWGYEIVPPANAAQYSGQTKT 263

Query: 249 ----------------------------PGEKN---------FAILKHWNASLNYNKTIA 271
                                       PG  N         F ++K +NAS +Y   + 
Sbjct: 264 LGQWAALGFARPNGKGFSNSKMRAVLKMPGGSNGPGFLVTKNFFVIKRYNASDSYALGVG 323

Query: 272 YIAAHIDG 279
            +A  I G
Sbjct: 324 LLADQIAG 331


>gi|319781607|ref|YP_004141083.1| lytic murein transglycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167495|gb|ADV11033.1| lytic murein transglycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 406

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 78/339 (23%), Positives = 130/339 (38%), Gaps = 66/339 (19%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           MS +    I   +M    L+ A+  P  A            F +W +  RA AV+ G+S 
Sbjct: 1   MSVRNAAKIFTSVMAAASLSLALLMPGPAFA-------DAGFRQWVAGFRATAVQSGVSG 53

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
                 F ++  +D  +    +          DY D     + +A G  + +     L  
Sbjct: 54  ALYDQAFRNIRDIDPVVLEKARTQPEFTAPAWDYFDNRVHDQSVAVGQQMARKWKPWLDR 113

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLST----LATLAY-DCRRAKFFTEQFFYA 175
           ++  +GV   IL+A+W +E+++GE + +  ++      LATLAY D +RAKF   Q   A
Sbjct: 114 IEARFGVDRYILLAIWSMESNYGEILKRDDIMRNVVRSLATLAYADPKRAKFARTQLIAA 173

Query: 176 LDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L +++ G I      G+  G +G  QF+P + + YA+D D +GK D+  S  DA+A++A 
Sbjct: 174 LKILQTGDIDESHLSGSWAGAMGHTQFIPTSYLHYAVDMDGNGKRDIWNSIPDALATSAN 233

Query: 235 FLAKLGWTKCAGYQPG-------------------------------------------- 250
            L K GW     +                                               
Sbjct: 234 LLKKNGWQAGKTWGYEVALPAGKLPGGSKTLSQWQALGVARANGKPFKNGSDKATLKVPD 293

Query: 251 ---EKNFAILK------HWNASLNYNKTIAYIAAHIDGV 280
                 F ++K       +N +  Y   +  +A  I G 
Sbjct: 294 GRSGPAFLMIKNFTVIKAYNNADKYALAVGLLADEIAGS 332


>gi|270158264|ref|ZP_06186921.1| lytic murein transglycosylase family protein [Legionella
           longbeachae D-4968]
 gi|289163479|ref|YP_003453617.1| lytic murein transglycosylase [Legionella longbeachae NSW150]
 gi|269990289|gb|EEZ96543.1| lytic murein transglycosylase family protein [Legionella
           longbeachae D-4968]
 gi|288856652|emb|CBJ10463.1| lytic murein transglycosylase [Legionella longbeachae NSW150]
          Length = 323

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 79/299 (26%), Positives = 125/299 (41%), Gaps = 57/299 (19%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           +     + +W +  RA A+++G+SP+     FA++      I           ++F  Y 
Sbjct: 18  AFAQQNWNQWVAGVRAEALQQGISPEIFDEAFANIHEPSHQIKGLLHSQPEHRLTFIKYR 77

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
           +    S  IA G    K N  +L  + K+YGV P  +++ WG+ET +G  MG  P++  L
Sbjct: 78  NTRVDSYRIAIGRKEYKRNQAVLDAVAKQYGVNPCFIVSFWGMETSYGTYMGNFPVIKAL 137

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLAYD  R +FF ++ F AL ++ +G +  +   G   G  GQ QFLP + VKYA+D D
Sbjct: 138 ATLAYDSNRKEFFRKELFIALRILNEGHVDLADFKGEWAGASGQPQFLPSSWVKYAVDYD 197

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP------------------------- 249
            DG+ D+ +S  D  AS A ++ + GW     +                           
Sbjct: 198 GDGRKDIWRSKPDVFASIANYMKQNGWQTGEPWAIQVKLPPKFNMAMAGKTIVKPVSEWN 257

Query: 250 -------------------------GEKNFAI------LKHWNASLNYNKTIAYIAAHI 277
                                    G   F        + H+N S+ Y   + Y+A  I
Sbjct: 258 AVGVRTEDGQPLPYQNLQASIVQPLGGPTFLAFPNYKMILHYNNSIYYAGAVGYLADKI 316


>gi|118602106|ref|YP_903321.1| lytic murein transglycosylase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567045|gb|ABL01850.1| lytic murein transglycosylase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 394

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 79/298 (26%), Positives = 128/298 (42%), Gaps = 59/298 (19%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
            F ++ S  R +A + G+S  T  + F DL      +  DR       ++F  YL+   +
Sbjct: 27  SFEQFLSNIRFQATKLGISQTTLNNAFNDLTPNPKVLEYDRNQAE-FNLNFWRYLNLRVN 85

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G+   +   + L    K+YGVP  I++A WGLET++G+ +GK  L+ +LATL++
Sbjct: 86  QNRLDKGMEKLQQYQKYLQENYKKYGVPSQIVVAFWGLETNYGKNVGKMHLIRSLATLSF 145

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           D RR +FFT +    L L+ +  +  +A G+  G +G  QF+P NV  YAIDA+ DGKID
Sbjct: 146 DKRRREFFTHELLTLLKLIDEKKLPLNAQGSWAGAMGNMQFIPTNVAAYAIDANTDGKID 205

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAIL----------------------- 257
           L  +  D +ASAA FL K GW +   +                                 
Sbjct: 206 LWHTQADILASAAHFLKKNGWHQGERWGREVNIPKAFNYHLANLSTKKTVNEWQTLGIRT 265

Query: 258 ------------------KHWN-----------------ASLNYNKTIAYIAAHIDGV 280
                               +N                  S+ Y  ++ +++  + G 
Sbjct: 266 IYNTNLPNSTMQASLILPMGYNGPAFLVYQNFHAILRWNHSILYALSVGHLSDRLIGA 323


>gi|325917841|ref|ZP_08180020.1| lytic murein transglycosylase [Xanthomonas vesicatoria ATCC 35937]
 gi|325535952|gb|EGD07769.1| lytic murein transglycosylase [Xanthomonas vesicatoria ATCC 35937]
          Length = 720

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 75/303 (24%), Positives = 121/303 (39%), Gaps = 64/303 (21%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F    +  + +A  +G+   + +   A +    + +               DYL  L  S
Sbjct: 25  FDRCLAGLQTQAAAKGVDAASFQRFTAGVAPDPSVLPLLDAQPE-FSTPIWDYLASLVDS 83

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           + +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL +LATL+  
Sbjct: 84  QRVTDGQAMLVTHRDLLTRLSEQTGVDPATIVAVWGVESDYGRVTGKRPLLVSLATLSCA 143

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF  +F   L L+++G +S     G+  G  GQ QF+P    + A+D D DG+ D
Sbjct: 144 GRRQPFFRGEFLALLSLLQRGDLSPEQLTGSWAGAFGQTQFMPSTYARIAVDGDGDGRRD 203

Query: 221 LVKSNIDAIASAAKFLAKLGW--------------------------TKCAGYQPGE--- 251
           LV S  DA+AS A +L K GW                               +Q      
Sbjct: 204 LVASIPDALASTANYLVKAGWERARPWGMEVALPRGFDASKAGRTRRQPLQAWQAAGLRG 263

Query: 252 ---------------------------------KNFAILKHWNASLNYNKTIAYIAAHID 278
                                            +N+  +  +NA+ +Y  +IA +A  + 
Sbjct: 264 TDGKPLAPTGLPGETPAALLLPAGPTGPAFLVFRNYDAIYAYNAAESYALSIALLADRLR 323

Query: 279 GVP 281
           G P
Sbjct: 324 GGP 326


>gi|229592793|ref|YP_002874912.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
 gi|229364659|emb|CAY52587.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
          Length = 441

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 73/268 (27%), Positives = 123/268 (45%), Gaps = 24/268 (8%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQPKKATTQFIC----------------------SDTADR 41
           + +L   +      +L     +P  A  Q +                             
Sbjct: 8   RWHLRQLIAASSLILLVACAEKPTAADAQPLPKLQTAPVVAPAVVAPLAVDNLDIQPTQT 67

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EW++A R +A++ G++     + FA++      I  DR           +YLDG  S 
Sbjct: 68  FAEWQAAFRVQALQAGITAAVFDNAFANVTPDMAVIRADRSQPE-FSRPVWEYLDGALSP 126

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G AL    + +L ++++ YGV    L+++WG+E++FG+  G   ++ +LATLAY+
Sbjct: 127 VRVRNGQALLIKYADILQSIEQRYGVDRQALVSVWGMESNFGQFQGNNSVIRSLATLAYE 186

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  F   Q   AL +++ G I +  + G+  G +GQ QF+P     +A+D D DG+ D
Sbjct: 187 GRRPAFAQAQLLAALQIIQHGDIQADQMKGSWAGAMGQTQFIPTTYNTHAVDFDGDGRRD 246

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +  S  DA+AS A +L   GW K   + 
Sbjct: 247 IWNSPADALASTAHYLQSSGWQKGQPWG 274


>gi|90580082|ref|ZP_01235890.1| putative lytic murein transglycosylase [Vibrio angustum S14]
 gi|90438967|gb|EAS64150.1| putative lytic murein transglycosylase [Vibrio angustum S14]
          Length = 322

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 111/240 (46%), Gaps = 8/240 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
            +  ++A  +     A          + F  + +  +A A   G+S       F  + + 
Sbjct: 5   FISAVVALGLGISSTAFA------DDEGFNAYINKLKAEARSNGISEPILDSAFKGITFT 58

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  D+       ++   Y+        + Q   L + N   L  + KEYGV P  ++
Sbjct: 59  HRAVKADKNQPEK-KLTLDQYIPRAVPDWKVKQARRLYQENKTTLDRIGKEYGVQPRFIV 117

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GAT 192
           ALWG+E++FG+  G   ++  L TLAY+ RR   F +Q   AL ++++G I+   + G+ 
Sbjct: 118 ALWGVESNFGKLQGNYHVVEALTTLAYEGRREALFRKQVMAALQILQEGHITIDEMKGSW 177

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QF+P + + +A+D + DGK D+  +  D  ASAA +L K GW     +    K
Sbjct: 178 AGAMGQCQFMPTSYLTFAVDGNNDGKADIWNTKADVFASAANYLKKSGWNDKYTWGRQVK 237



 Score = 37.9 bits (86), Expect = 1.7,   Method: Composition-based stats.
 Identities = 7/27 (25%), Positives = 13/27 (48%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHI 277
             N+  L  WN S  +   ++++A  I
Sbjct: 296 YGNYQTLMKWNRSHYFALAVSHLADRI 322


>gi|89055359|ref|YP_510810.1| lytic murein transglycosylase [Jannaschia sp. CCS1]
 gi|88864908|gb|ABD55785.1| Lytic murein transglycosylase [Jannaschia sp. CCS1]
          Length = 425

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 70/318 (22%), Positives = 124/318 (38%), Gaps = 60/318 (18%)

Query: 28  KATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSP 87
            +T           +  W    R RA   G+S          + YL   + RDR      
Sbjct: 44  PSTDPDFRPQPNASYDAWLDGFRDRAQAAGISEDALTRGLRGVGYLPGVVERDRNQTE-F 102

Query: 88  PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
             S +DYL  ++  + ++ G +   A   +L +++  YGVP  +  A+WG+E+ +G  +G
Sbjct: 103 RRSTEDYLALVAGDDDVSLGRSRFNAQRSVLADVEARYGVPAEVCCAVWGVESRYGTRLG 162

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNV 206
             P++S ++TLA++ RR  FF  Q   AL +++ G  ++  + G+  G +G  Q +P   
Sbjct: 163 DIPVISAVSTLAWEGRRGDFFEAQTIAALRIIQNGDTTTDRMLGSWAGAMGHTQLIPTTY 222

Query: 207 VKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ------------PGEKN 253
            +YA+D   DG+ D+      DA AS A + ++  W     +              G  N
Sbjct: 223 EEYAVDFRGDGRRDIWTNDPTDAFASTASYFSRFNWRTGQPWGMEVELPSGFSAATGRNN 282

Query: 254 FA--------------------------------------------ILKHWNASLNYNKT 269
                                                         ++  +NAS NY   
Sbjct: 283 RRSVASWSGLGVRRAGGGALPDHGQAAIHAPGGAGAPAWILYHNFNVILRYNASTNYGIG 342

Query: 270 IAYIAAHID-GVPIGKGY 286
           + Y++  I  G P+ + +
Sbjct: 343 VGYLSDRIAGGGPLRQSF 360


>gi|88703918|ref|ZP_01101633.1| membrane-bound lytic murein transglycosylase [Congregibacter
           litoralis KT71]
 gi|88701745|gb|EAQ98849.1| membrane-bound lytic murein transglycosylase [Congregibacter
           litoralis KT71]
          Length = 422

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 89/333 (26%), Positives = 137/333 (41%), Gaps = 68/333 (20%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
            +S+      +L    T       Q         F    +    RA + G+       + 
Sbjct: 24  RVSIGFCSLLLLTLCPTASAAVDQQA--------FDSCIADLGDRARQAGVETSLVAAVL 75

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
            ++  L+  I  DRK       +F  Y+D   +   + +G AL   +   L  L + YGV
Sbjct: 76  PEIAPLERVIELDRKQPE-FVQTFGAYVDTRVTESRVERGRALLAKHQPFLQTLLERYGV 134

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           PP  L+A WGLET+FG  +G  P L+ LATLA D RR+ FF  +F  AL+L+++  +   
Sbjct: 135 PPRYLIAFWGLETNFGSYLGNIPTLNALATLACDPRRSDFFAGEFVNALELMEREALPLD 194

Query: 188 A-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
              G+  G +G  QF+P + ++YA+D D+DG+I+L +S  DA+AS A FL  LGWT    
Sbjct: 195 TLRGSWAGALGHTQFMPSSYLRYAVDGDDDGRINLWESERDALASGANFLRSLGWTPELR 254

Query: 247 YQPG---EKNF----------AILKHW--------------------------------- 260
           +       +NF            L+ W                                 
Sbjct: 255 WGRQVVLPENFPYELASLSGERSLRAWAPLGVRQLDGATVPALDLEAALLLPAGHLGPAF 314

Query: 261 ------------NASLNYNKTIAYIAAHIDGVP 281
                       N SL+Y  ++  +A  + G P
Sbjct: 315 LVYENFRVVMRWNQSLSYALSVGLLADRLAGAP 347


>gi|148257621|ref|YP_001242206.1| putative lytic murein transglycosylase [Bradyrhizobium sp. BTAi1]
 gi|146409794|gb|ABQ38300.1| putative lytic murein transglycosylase [Bradyrhizobium sp. BTAi1]
          Length = 254

 Score =  189 bits (480), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 93/258 (36%), Positives = 138/258 (53%), Gaps = 10/258 (3%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
           +           C  +   F  WK      A  +G+             Y   TIA DR 
Sbjct: 1   MLAGLSGAQAAQCGTSPAGFDAWKREFSEEARAKGVGGTAI-AALMQTNYASATIAADRG 59

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
             +   +S   +L    ++ I+A+G  LK++ + +  ++++ YGVPPG L+A+WG+E+ F
Sbjct: 60  QRS-FQLSLDQFLAKRGAAAIVARGRQLKQSQAAMFASIEQRYGVPPGPLIAIWGMESAF 118

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFL 202
           G   G   +LS++ATLAYDCRR +FFTEQ + AL L+ +GV+S +  G+  GE+GQ QF+
Sbjct: 119 GSQRGNQHMLSSIATLAYDCRRPEFFTEQLYAALKLIDRGVLSGNTRGSMHGEVGQTQFM 178

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNA 262
           P N++ Y +          +    +A+AS A FL   GW   AGYQPGE NFA ++ WNA
Sbjct: 179 PKNILAYGVGN--------LDVAANALASTANFLRANGWKAGAGYQPGEPNFAAIEAWNA 230

Query: 263 SLNYNKTIAYIAAHIDGV 280
           +  Y K IA +   IDG 
Sbjct: 231 AGVYQKAIALMGRQIDGG 248


>gi|126174804|ref|YP_001050953.1| lytic murein transglycosylase [Shewanella baltica OS155]
 gi|125998009|gb|ABN62084.1| lytic murein transglycosylase [Shewanella baltica OS155]
          Length = 411

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 79/228 (34%), Positives = 122/228 (53%), Gaps = 3/228 (1%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           A   P    +  + ++ A+ F    +  +ARA  EG+S  T     A+L+++   I  D+
Sbjct: 22  AEANPMPDISASVQAN-AEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELDQ 80

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
           +       +F +Y    ++   + +G  L + +S LL  L KEYGVPP  +++ WGLET+
Sbjct: 81  QQPE-FSQTFDNYFSKRATEWRVNEGRRLLQKHSVLLNQLAKEYGVPPQYILSFWGLETN 139

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQ 200
           +G   GK  +L++LATLA + RR+ +FT +   AL L +K       + G+  G +G  Q
Sbjct: 140 YGSYKGKMSVLNSLATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHTQ 199

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           F+P    KYA+D D DGK DL  S  DA+ SAA FL  LGW +   + 
Sbjct: 200 FMPSAYAKYAVDGDGDGKADLWNSTTDALTSAANFLQHLGWQRNERWG 247


>gi|94496386|ref|ZP_01302963.1| Lytic murein transglycosylase [Sphingomonas sp. SKA58]
 gi|94424132|gb|EAT09156.1| Lytic murein transglycosylase [Sphingomonas sp. SKA58]
          Length = 338

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 117/255 (45%), Gaps = 7/255 (2%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA 78
           +A A      AT     + T+  F  +  + R +A   G+S  T   +F+DL      I 
Sbjct: 3   VAVATASVGAATPVPAVAQTSGDFRSYLESLRPQARAMGISDATLNGVFSDLTPNPRVIE 62

Query: 79  RDRKMV----TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
            D+        +P  +F+ Y      +  I++G    +AN   L  ++ E GVP  I++A
Sbjct: 63  LDQNQPGGGAYAPIPNFQPYRVKHVDAARISRGRTAYQANRARLARIEAETGVPEEIMVA 122

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFG 194
           ++G ET++G   G   L+ +LATLA++ RR   F  +    L ++  GV  S  +G+  G
Sbjct: 123 IFGHETNYGSYTGDFDLIRSLATLAWEGRRRTLFEPELLATLKMLDNGVPRSRLVGSWAG 182

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNF 254
             G  QFLP   ++ A D D DGK D+  S  DA+AS A +  + GW +   +       
Sbjct: 183 ATGYPQFLPSVYLRLAKDGDGDGKADIWTSEADALASIANYFVQSGWRRGEPWGVA---V 239

Query: 255 AILKHWNASLNYNKT 269
           ++    N      +T
Sbjct: 240 SVPFGLNRGSLAART 254



 Score = 36.4 bits (82), Expect = 4.5,   Method: Composition-based stats.
 Identities = 8/54 (14%), Positives = 17/54 (31%), Gaps = 4/54 (7%)

Query: 225 NIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
             D + +    L   G            N+  +  +N S  Y  ++  +A  + 
Sbjct: 288 PADTMMAT--LLEPDG--PGKTAYLLTSNYRAILDYNCSNFYALSVGLLADAVK 337


>gi|77464706|ref|YP_354210.1| membrane bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides 2.4.1]
 gi|77389124|gb|ABA80309.1| Membrane bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides 2.4.1]
          Length = 417

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 88/326 (26%), Positives = 128/326 (39%), Gaps = 59/326 (18%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
            ++Q      +A               W    R RA+  G+ P T    F DL Y    +
Sbjct: 23  TVSQRPAARAEAAVTEAERAAQAGLEAWVIQFRPRALAAGIRPATFAAAFRDLRYDADAV 82

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
           ARDR        +  DYLD   S   IA G A    +  LL  ++  YGVP  I++A+WG
Sbjct: 83  ARDRNQAE-FNRTLWDYLDSAVSETRIAGGRAALVQHGALLGRIEARYGVPKEIVVAVWG 141

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEI 196
           +ET +G   G  PL+  LATLA+D RRA+FF EQ   AL ++  G +      G+  G +
Sbjct: 142 METSYGTRRGDHPLVGALATLAHDGRRARFFEEQLIAALKILDNGDVRPEAMTGSWAGAM 201

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGY-------- 247
           G  QF+P + + +A+D   DG+ D+      DA+AS A +LAK GW +   +        
Sbjct: 202 GHTQFMPTSYLDFAVDFTGDGRRDIWSDDPSDALASTAAYLAKSGWRRGEPWGVEVRLPA 261

Query: 248 -----QPGEKNFAILKHW------------------------------------------ 260
                Q G+        W                                          
Sbjct: 262 GFDFAQSGKSLRQPAARWEALGVRRVDGSPLPAGEAALLLPAGAQGAAFLIYPNFRAIAR 321

Query: 261 -NASLNYNKTIAYIAAHIDGVPIGKG 285
            N +  Y   + ++A  + G P   G
Sbjct: 322 YNPADAYVIGVGHLADRLKGAPAIAG 347


>gi|77362418|ref|YP_341992.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76877329|emb|CAI89546.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 338

 Score =  189 bits (480), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 67/246 (27%), Positives = 114/246 (46%), Gaps = 12/246 (4%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           +   +    ++    A TQ         F  +  A +  A+ +G   +     FA   Y 
Sbjct: 5   LAMILCGVCLSTSVMAKTQ-------AEFQTYLDALKQEAIAKGYDSQLIDQAFAGASYK 57

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
           +  ++ D+        + + YL        I +   L   N  +L  + K++GV    ++
Sbjct: 58  EKIVSADKNQPEV-KETLETYLPKRVPQWKIDRARKLYAENQDVLEKVAKDFGVQARFIV 116

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GAT 192
           A+WGLE++FG   G   ++S+L TLA+D RR   + +Q + ALD++K G I+     G+ 
Sbjct: 117 AIWGLESNFGAIQGGHNVISSLVTLAFDGRRETMYKKQLWAALDILKSGHITLDKFKGSW 176

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QF+P +   YA+D + DG+ D+  +  DA AS A +L + GW     +    K
Sbjct: 177 AGAMGQTQFMPTSFNAYAVDYNNDGRKDIWTTKEDAFASIANYLKQEGWNDSLTWGRQVK 236

Query: 253 ---NFA 255
              NF 
Sbjct: 237 LPENFD 242



 Score = 37.5 bits (85), Expect = 2.3,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHI 277
              N+ +  HWN S  +  ++ Y++  I
Sbjct: 306 AYDNYKVFMHWNRSYYFATSVGYLSDRI 333


>gi|171058531|ref|YP_001790880.1| lytic murein transglycosylase [Leptothrix cholodnii SP-6]
 gi|170775976|gb|ACB34115.1| lytic murein transglycosylase [Leptothrix cholodnii SP-6]
          Length = 409

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 78/287 (27%), Positives = 118/287 (41%), Gaps = 17/287 (5%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTA-----------DRFGEWKSAARARAVREGMSPKT 62
           M     A A +   +A  +                    F  W  + R  A   G+   T
Sbjct: 1   MALAGCAAAPSTAPQAPAESSVGTPPTPIQADDTALQQDFSRWILSMRDTARTAGIDEAT 60

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
               F  + YL   +  DR        +  DYLD   S + IA G    +          
Sbjct: 61  LAVAFDGIRYLPRVVESDRSQPE-FTRTVWDYLDRAVSPQRIALGQDKLQQVRPEADAAA 119

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
             YGVP  I++A+WG+E+++G   G  P +  LATL ++ RR  +  +Q   AL +++ G
Sbjct: 120 ARYGVPAAIVVAIWGVESNYGGNFGDIPTIDALATLGFEGRRQTWARDQLLAALKILQNG 179

Query: 183 VISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I    + G+  G +GQ QFLP   +  A+DAD DG+ D+  S  D  AS A FLA+ GW
Sbjct: 180 DIDRAHMIGSWAGAMGQTQFLPSVFLNTAVDADGDGRRDIWGSMADVTASTANFLARAGW 239

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAH----IDGVPIGK 284
                +    +         A     ++ A  AA     +DG P+ +
Sbjct: 240 QAQQPWGAEVRLPPAFDIGRADAALRQSTAQWAAEGVQSVDGAPLPE 286


>gi|289665049|ref|ZP_06486630.1| transglycosylase [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 425

 Score =  189 bits (479), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 78/279 (27%), Positives = 127/279 (45%), Gaps = 9/279 (3%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATT------QFICSDTADRFGEWKSAARARAVRE 56
            +  L +S+ +    + AQA+     A++      Q   S     F +W +  R RA+  
Sbjct: 8   LRLTLGVSVCVAATSVAAQAIAPETTASSVTDAGGQQQDSAPTASFEQWLADFRQRALAA 67

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+   T  + FA +    +    D++          DYLD   +   I +G  L  +   
Sbjct: 68  GIEATTLDNAFAGVTPDPSVQKLDQQQPE-FTSYLWDYLDARVTPSAIQEGQQLLISQHA 126

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
           L   L++ +GV PGIL A+W +E+ +G  +G   ++ +LATLA++ RR  +   Q   AL
Sbjct: 127 LFEKLRQHHGVDPGILTAIWSMESGYGTQIGDFYVIRSLATLAHEGRRTTYGNTQLLAAL 186

Query: 177 DLVKKGVI--SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            +++       S  +G+  G +GQ QF+P     YA+D D D K D+  S  DA+ SAA 
Sbjct: 187 QILQTEKSIARSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKRDVWNSKADALGSAAN 246

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
           +L +  WT    +       A   +  A L   KT+A  
Sbjct: 247 YLKQNNWTSAVPWGQEVHLPAGFDYAQADLTIKKTVAEW 285



 Score = 44.5 bits (103), Expect = 0.019,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 11/29 (37%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  +  +N S  Y   +  +A    G 
Sbjct: 322 DNFRSILRYNNSTAYALAVGLLADGYAGR 350


>gi|86359153|ref|YP_471045.1| membrane-bound lytic murein transglycosylase protein [Rhizobium
           etli CFN 42]
 gi|86283255|gb|ABC92318.1| probable membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CFN 42]
          Length = 407

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 76/323 (23%), Positives = 130/323 (40%), Gaps = 63/323 (19%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL-EYLDTTI 77
           LA A+    +       +    RF +W +     A   G+S  T +  F+ + E   T +
Sbjct: 12  LALALVVAAQVGLAPDNAKADSRFQKWIADFYQTAAESGISKATYQKAFSGVSEPDPTVL 71

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
            +             DY+D   +   +  G  +   ++R L  +++ +GV   IL+A+W 
Sbjct: 72  EKAAYQPE-FTSKIWDYIDSRVNPYTVRIGREMAVKHARTLNAIEQRFGVDKTILLAIWS 130

Query: 138 LETHFGETMGKTP----LLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GA 191
           +E+++G  + K      +   LATLAY D  RAKF  +Q   AL +++ G + +  + G+
Sbjct: 131 MESNYGAILDKDDRLHYVPRALATLAYADPSRAKFAKKQLVAALKILQNGDVPARQMTGS 190

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--- 248
             G +G  QF+P + + YA+DAD +G  D+  S  DA+A++A  L K GW     +    
Sbjct: 191 WAGAMGHTQFIPTSYLLYAVDADGNGHRDIWNSVPDALATSANLLMKNGWDTGKTWGYEV 250

Query: 249 --------------------------PGEKNFA--------------------------I 256
                                     P  K F                            
Sbjct: 251 VVPAASAKQAGRTHTLAQWAELGLKRPNGKAFRDGGTKAVLKMPAGAGGPGFLMTANFFT 310

Query: 257 LKHWNASLNYNKTIAYIAAHIDG 279
           +K++NAS +Y   +  +A  I G
Sbjct: 311 IKNYNASDSYALAVGLLADQIAG 333


>gi|121997021|ref|YP_001001808.1| lytic murein transglycosylase [Halorhodospira halophila SL1]
 gi|121588426|gb|ABM61006.1| lytic murein transglycosylase [Halorhodospira halophila SL1]
          Length = 395

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 83/327 (25%), Positives = 137/327 (41%), Gaps = 70/327 (21%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            ++A  +T P  A          D F +  S+ R     +G      +  FA +E L+  
Sbjct: 9   ILMAVCLTAPALA----------DDFEQCVSSLRDDLKEQGRDAAVVEETFAGVEQLERI 58

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           +  DR+       +F+DYLD   + E + +G  +   +  LL  +  ++GVPP  L+ALW
Sbjct: 59  LELDREQPE-FVQTFRDYLDARLTEERVDRGREMMAEHRELLWQIHDDFGVPPRYLVALW 117

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGE 195
           G+ETH+G   G+ P++  + TLA + RRA+FF  Q    + L++ G +      G+  G 
Sbjct: 118 GMETHYGSYFGEVPIIDAMTTLACEGRRARFFFHQLDATVALLEDGKLERDGLRGSWAGA 177

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP------ 249
           +G  QF+P  + ++A+D D  G+IDL  S  DA+AS A +L  +GW     +        
Sbjct: 178 LGHTQFMPATLREHAVDYDGSGRIDLRDSVADALASGANYLRAMGWQPGLRWGREVRLED 237

Query: 250 -------GEKNFAILKHW------------------------------------------ 260
                  G  +   L  W                                          
Sbjct: 238 DFDFDHLGLDDPRALDEWQQLGVRRADGSDLPQSDIQAALLLPMGRNGPAFLVYENFRRI 297

Query: 261 ---NASLNYNKTIAYIAAHIDGVPIGK 284
              NAS++Y  ++  +A  +DG P  +
Sbjct: 298 MGWNASVSYALSVGLLADRLDGAPPLR 324


>gi|159042572|ref|YP_001531366.1| lytic murein transglycosylase [Dinoroseobacter shibae DFL 12]
 gi|157910332|gb|ABV91765.1| lytic murein transglycosylase [Dinoroseobacter shibae DFL 12]
          Length = 415

 Score =  189 bits (479), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 78/247 (31%), Positives = 115/247 (46%), Gaps = 6/247 (2%)

Query: 7   LLISLLMMVYPMLAQAVTQPKKATTQFICSDT---ADRFGEWKSAARARAVREGMSPKTA 63
           L +++ + V  M       P                 RF  W  A   RA   G+ P T 
Sbjct: 9   LSVAITLPVAAMATPLAQSPHPTARPGAVVQAVALPARFEAWIGAFERRARAAGIRPATF 68

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
           +  FA ++YL   I RDR           +YLD   S   +  G A   A    L  +++
Sbjct: 69  RAAFAGVDYLPDVIRRDRSQAE-FTKQIWEYLDSAVSDARLRNGRAAFAARRDTLRAIER 127

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
            YGV   ++ A+WGLE+ +G   G TP LS +ATLAY+ RRA FF +Q   AL +++ G 
Sbjct: 128 RYGVEAEVVTAIWGLESAYGSYRGATPTLSAMATLAYEGRRAAFFEDQLIAALKILQDGD 187

Query: 184 ISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK-SNIDAIASAAKFLAKLGW 241
            +     G+  G +G  QF+P + + YA+D   DG+ D+      DA+AS A +L   GW
Sbjct: 188 TTPGRMTGSWAGAMGHTQFMPTSYLDYAVDFTGDGRRDIWGEDPTDALASTAAYLEAFGW 247

Query: 242 TKCAGYQ 248
           T+   + 
Sbjct: 248 TRGQPWG 254



 Score = 44.5 bits (103), Expect = 0.020,   Method: Composition-based stats.
 Identities = 6/29 (20%), Positives = 14/29 (48%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF +++ +N +  Y   +  ++  I G 
Sbjct: 315 DNFHVIERYNTADAYVIAVGVLSDRIAGG 343


>gi|209550890|ref|YP_002282807.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536646|gb|ACI56581.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 407

 Score =  188 bits (478), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 78/341 (22%), Positives = 134/341 (39%), Gaps = 70/341 (20%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+      +  L + + + AQ    P  A           RF +W +     A + G+S 
Sbjct: 1   MTQNHKYSLRGLALAFIVAAQVGLVPDNAKA-------DSRFQKWIADFYQTAAQSGISK 53

Query: 61  KTAKHLFADL-EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
            T +  F+ + E   T + +             DY+D   +   +  G  +   ++R L 
Sbjct: 54  ATYQKAFSGVSEPDPTVLEKAAYQPE-FTSKIWDYVDSRVNPYTVKIGREMAVKHARTLA 112

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTP----LLSTLATLAY-DCRRAKFFTEQFFY 174
            +++ +GV   IL+A+W +E+++G  + K      +   LATL Y D  RAKF  +Q   
Sbjct: 113 AIEQRFGVDKTILLAIWSMESNYGAILDKDDRLHYVPRALATLGYADPSRAKFAKKQLIA 172

Query: 175 ALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAA 233
           AL +++ G + +    G+  G +G  QF+P + + YA+DAD +G  D+  S  DA+A++A
Sbjct: 173 ALKILQNGDVPAREMTGSWAGAMGHTQFIPTSYLLYAVDADGNGHRDIWNSVPDALATSA 232

Query: 234 KFLAKLGWTKCAGYQ-----------------------------PGEKNFA--------- 255
             L K GW     +                              P  K F          
Sbjct: 233 NLLMKNGWDTGKTWGYEVVVPAAAAKQIGKTHTLAQWAALGLTRPNGKAFRESGAKAVLK 292

Query: 256 -----------------ILKHWNASLNYNKTIAYIAAHIDG 279
                             +K++NAS +Y   +  +A  I G
Sbjct: 293 MPAGPSGPGFLMTANFFTIKNYNASDSYALAVGLLADQIAG 333


>gi|330445498|ref|ZP_08309150.1| lytic murein transglycosylase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328489689|dbj|GAA03647.1| lytic murein transglycosylase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 323

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 63/236 (26%), Positives = 111/236 (47%), Gaps = 8/236 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  ++A  +     A          + F  + +  +A A  +G+S       F  + + 
Sbjct: 5   LISAVVALGLGISSTAFAAD------EGFNAYINKLKAEARSKGISEPILDSAFDGITFT 58

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  D+       ++   Y+        + Q   L   N   L  + KEYGV P  ++
Sbjct: 59  HRAVKADKNQPEK-KLTLDQYIPRAVPDWKVKQARRLYHENKETLDRIGKEYGVQPRFIV 117

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG+  G   ++  L TLAY+ RR + F +Q   AL ++++G I+     G+ 
Sbjct: 118 ALWGVESNFGKLQGNYHVVEALTTLAYEGRREELFRKQVMAALQILQEGHITIDEMRGSW 177

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            G +GQ QF+P + + +A+D + DGK D+  +  D  ASAA +L K GW     + 
Sbjct: 178 AGAMGQCQFMPTSYLTFAVDGNNDGKADIWNTKADVFASAANYLKKSGWNDKYTWG 233


>gi|149377682|ref|ZP_01895418.1| Membrane-bound lytic murein transglycosylase B [Marinobacter
           algicola DG893]
 gi|149358035|gb|EDM46521.1| Membrane-bound lytic murein transglycosylase B [Marinobacter
           algicola DG893]
          Length = 398

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 86/297 (28%), Positives = 131/297 (44%), Gaps = 59/297 (19%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +      ++A+  G+S +TA  + A  EYL+  I  DR+       +F DYL+   +S
Sbjct: 19  FPQCIEHLESQAIEAGVSSQTAGEVLAGAEYLERVIELDRRQPE-FTTTFADYLNRRVNS 77

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           + +++G  L   +  LL  + ++ GVP   L+A WGLET+FG   GK  + S+LATLA D
Sbjct: 78  DRVSRGRELLDQHEELLDRVTRKTGVPAPYLVAFWGLETNFGAYFGKMSVPSSLATLACD 137

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR++FFTEQ   AL ++ +G I +  + G+  G +G  QF+P   +++A+D D DGK D
Sbjct: 138 ERRSQFFTEQLIAALRIIDEGAIPAEQMEGSWAGAMGHVQFMPTVFLRHAVDGDGDGKRD 197

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPG------------------------------ 250
           L  S  DA+ SA  FL  LGW     +                                 
Sbjct: 198 LWNSLPDAMMSAGHFLQDLGWDGDYRWGREVLLPQGFDYSLADGRRLPLEKWRALGVTDA 257

Query: 251 ---------------------EKNFAILKHWN------ASLNYNKTIAYIAAHIDGV 280
                                   F   K++N       S  Y   + ++A  I G 
Sbjct: 258 FGNNLANEPIEAALVVPAGHRGPAFLAYKNFNVIMGWNRSEFYAIAVGHLADRIAGA 314


>gi|294083923|ref|YP_003550680.1| membrane-bound lytic murein transglycosylase B [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663495|gb|ADE38596.1| Membrane-bound lytic murein transglycosylase B [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 327

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 63/237 (26%), Positives = 111/237 (46%), Gaps = 8/237 (3%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
             +  + +  +     A  Q      +  F +W +  R  A   G+S K       D + 
Sbjct: 4   FFIVGLASICLLFVHPAFAQ------SQSFEQWLAEFRIDAKARGISDKIFDEALGDAKP 57

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
           +   I  DR       ++F +YL  + S             +  +L  + K+YGV    +
Sbjct: 58  IPRVIELDRNQPE-FKMTFDEYLGKVVSKARQRIAAKKMIEHDDILTKVSKKYGVQKRFI 116

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGA 191
           +  WG+ET FG  +G   +  +LATLAYD RR+ +F ++   AL ++++G I++ +  G+
Sbjct: 117 ITFWGVETSFGRYLGSFNVPHSLATLAYDGRRSAYFRKELLNALQILEEGHITAANMKGS 176

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
             G +GQ QF+P + + YA+D   DG+ D+  +  D  AS A +L++ GW     + 
Sbjct: 177 WAGAMGQSQFMPSSFLSYAVDWHGDGQRDIWATTEDVFASTAYYLSQAGWRDDRTWG 233


>gi|315180679|gb|ADT87593.1| lytic murein transglycosylase, hypothetical [Vibrio furnissii NCTC
           11218]
          Length = 323

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 72/281 (25%), Positives = 136/281 (48%), Gaps = 22/281 (7%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L   ++ P  A            F ++    + +A +EG+S +     F D+++ 
Sbjct: 4   LLSVILGLTLSAPVLA--------NDLSFEQYVEGLKQQARQEGISEQILSDAFHDVQFK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  DR       ++  +Y+     +  + Q  AL + +   L  + K YGV P  ++
Sbjct: 56  PRAVVADRNQPEK-KLTLDEYIPRAVPAWKVNQAQALYEKHYDELQRIGKAYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGAT 192
           ALWG+E++FG  MG+  ++  L+T+AY+ RR +FF ++   AL ++++G I++    G+ 
Sbjct: 115 ALWGVESNFGAHMGRYKVIDALSTMAYEGRREEFFRKETMAALQILQQGHINAEDMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QF+P + + +A D D DGK D+  S  D  AS A +L++ GW     +    +
Sbjct: 175 AGAMGQCQFMPSSFLAFAADGDGDGKKDIWGSKEDVFASTANYLSQSGWDDKYTWG---R 231

Query: 253 NFAILKHWNAS--------LNYNKTIAYIA-AHIDGVPIGK 284
              I K ++ +          Y +  + +     DG P+ K
Sbjct: 232 QVKIPKGFDHALEGRQAEKGKYLQEWSKLGITRYDGKPLPK 272



 Score = 39.5 bits (90), Expect = 0.59,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSYYFALAVSHLADRIK 322


>gi|220921182|ref|YP_002496483.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
 gi|219945788|gb|ACL56180.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
          Length = 392

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 70/299 (23%), Positives = 111/299 (37%), Gaps = 55/299 (18%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
            D F  W       A   G+S  T    F ++   D  +    +          DYL G 
Sbjct: 21  QDGFRTWIEGLWPLAQARGVSRATFDAAFREVTAPDPAVLARIRRQGEFGRPIWDYLAGA 80

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S   +A+G A     + +L  ++    VP  +L+A+WG+E+ FG   G    +  LATL
Sbjct: 81  VSPGRVARGKAEAARRADVLAAIEARSSVPAPVLLAVWGMESDFGTGTGTVSTVRALATL 140

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A    R+  F ++   AL++++   +      G+  G +GQ QFLP   ++ A+D D DG
Sbjct: 141 AQAGHRSDLFRDELLAALEILEHHDVGPEGLRGSWAGAMGQTQFLPSVYLRTAVDFDGDG 200

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG--------------------------- 250
           + D+  S  DA+AS A FL + GW     +                              
Sbjct: 201 RRDIWTSAPDALASIASFLRQAGWQPGLPWGVAVRLPDGFDLARYRGSFAEFSARGVRRA 260

Query: 251 --------------------------EKNFAILKHWNASLNYNKTIAYIAAHID-GVPI 282
                                       NF   + +N S  Y   + ++A  I  G P+
Sbjct: 261 DGTALPAQGEASLFLPGGRSGPAFLITDNFEAFRAYNTSDAYALAVGHLADRIAGGAPL 319


>gi|238788493|ref|ZP_04632286.1| Lytic murein transglycosylase [Yersinia frederiksenii ATCC 33641]
 gi|238723406|gb|EEQ15053.1| Lytic murein transglycosylase [Yersinia frederiksenii ATCC 33641]
          Length = 359

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 79/275 (28%), Positives = 127/275 (46%), Gaps = 11/275 (4%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
              + +      AT           F  +    + +A   G+S  T    FA++ ++D  
Sbjct: 37  MATSASTNSSNTATMLSSQGRDPAAFPAYVEQLKTQARVNGISDATLNVAFANIHFVDRV 96

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I  DR  +    V+  DYL  + ++  I QG    +     L  +   YGVP   ++ALW
Sbjct: 97  IQSDRNQLEK-KVTLDDYLAKVLTANRIKQGKENYQRYRPQLSQVTARYGVPERYIVALW 155

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGE 195
           GLE+ FG+  GK  ++S L+TLA++ RR  FFT++   AL ++++G +      G+  G 
Sbjct: 156 GLESSFGKIQGKEDVISALSTLAFEGRREAFFTQELMAALQIIQQGKVEDRQLKGSWAGA 215

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFA 255
           +GQ QF+P + + Y  D D DGKID+  +  D  AS A +L+  GW    G+    +  A
Sbjct: 216 MGQSQFMPSSFLTYGADGDGDGKIDIWNNIDDVFASTANYLSTEGWQPDIGWGQEAQLPA 275

Query: 256 ILKHWNAS-----LNYNKTIAYIAAHIDGVPIGKG 285
               +N +         KT+A     +   PI  G
Sbjct: 276 ---GFNVALAGLKDKQAKTVAQW-QQLGVTPIPVG 306


>gi|119384390|ref|YP_915446.1| lytic murein transglycosylase [Paracoccus denitrificans PD1222]
 gi|119374157|gb|ABL69750.1| lytic murein transglycosylase [Paracoccus denitrificans PD1222]
          Length = 424

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 72/259 (27%), Positives = 112/259 (43%), Gaps = 14/259 (5%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQ-----------FICSDTADRFGEWKSAA 49
           M     +  +L  M   +   A   P     Q                       W    
Sbjct: 1   MRLSLRVSATLTAMALLLGGCAGNYPGTGVPQQSQEIKWGRYQNPPPAKVAGLNSWVQGF 60

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A A  +G+S  T    F D+ Y    I R +        S  +YL+   S +  A G A
Sbjct: 61  KANARSQGISDSTLDFAFRDVTYNPEVIRRSQSQAE-FKKSVWEYLENAVSEKRQADGRA 119

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
                  +L  ++  YGV   ++ A+WG+E+ +GE  G  PL+ +LATL+Y+  R +FF 
Sbjct: 120 ALAQYGGVLSRIEATYGVDKEVVAAVWGMESTYGERRGDLPLIESLATLSYEGYRGEFFR 179

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNID 227
            Q   AL +++ G I    + G+  G +G  QF+P   + +A+D   DG+ D+      D
Sbjct: 180 SQLMGALRILQAGDIDPAHMTGSWAGAMGHTQFIPTTYLSFAVDFTGDGRRDIWSNDPSD 239

Query: 228 AIASAAKFLAKLGWTKCAG 246
           A+ASAA +LAK GW +   
Sbjct: 240 ALASAANYLAKSGWQRGLP 258



 Score = 51.8 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 13/52 (25%)

Query: 230 ASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           AS A FL               +NF  +  +N + +Y   ++++A  + G P
Sbjct: 313 ASGAAFL-------------ITRNFHAILRYNNADSYALAVSHLADRLKGYP 351


>gi|107100620|ref|ZP_01364538.1| hypothetical protein PaerPA_01001646 [Pseudomonas aeruginosa PACS2]
 gi|296390459|ref|ZP_06879934.1| transglycolase [Pseudomonas aeruginosa PAb1]
          Length = 398

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 72/303 (23%), Positives = 119/303 (39%), Gaps = 60/303 (19%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
             A  F    +  + +A  +G+S  + +   + L+   + +               DYL 
Sbjct: 20  PDASSFPSCLAGLQKKAQAQGISADSYERFTSGLQADLSVLDLLDAQPE-FTTPLWDYLA 78

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   GK PLL++L+
Sbjct: 79  GLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIFGKRPLLTSLS 138

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TL+   RR  FF  +F   L L++ G I  +   G+  G  G  QF+P    + A+D D 
Sbjct: 139 TLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPSTYARIAVDFDG 198

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--------------------------- 248
           DG+ DLV S  DA+ S A +L K GW     +                            
Sbjct: 199 DGRRDLVGSVPDALGSTANYLKKAGWRTGQPWGYEVKVPADFPASLAGRGKRQPLSAWVA 258

Query: 249 -----------PGEKNFAIL--------------------KHWNASLNYNKTIAYIAAHI 277
                      PG    A +                      +NA+ +Y   IA ++  +
Sbjct: 259 RGVRRVDGQPLPGGDEKAAILLPTGAQGPAFLVYRNYDAIYSYNAAESYALAIALLSDRL 318

Query: 278 DGV 280
            G 
Sbjct: 319 RGG 321


>gi|109899111|ref|YP_662366.1| lytic murein transglycosylase [Pseudoalteromonas atlantica T6c]
 gi|109701392|gb|ABG41312.1| lytic murein transglycosylase [Pseudoalteromonas atlantica T6c]
          Length = 331

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 65/245 (26%), Positives = 115/245 (46%), Gaps = 4/245 (1%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +S  +    ML      P     +     +   F  +  + +  A+ +G        +F 
Sbjct: 1   MSRFVFSVMMLICGSLMPLFLHGEPQ--KSQAGFELYIQSFKQEALSKGYDETFLDSVFT 58

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
              +    +  D+       ++   YL        + Q + L   +  +L ++ + +GV 
Sbjct: 59  GATFRQRVVKADKNQPER-KITLDTYLATRVPDWKVQQALDLSAKHRAVLEDVAQTFGVQ 117

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
              ++ALWG E++FG+ MGK P++S+LAT+AY+ RR + F +Q + A+D++++G I    
Sbjct: 118 ARFIVALWGNESNFGKIMGKYPVISSLATMAYEGRREEMFKKQLYAAMDILRQGHIKQDE 177

Query: 189 L-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G +GQ QF+P + + YA D D DGK D+  +  D  AS A FL   GW+    +
Sbjct: 178 FLGSWAGAMGQSQFMPTSFLHYAYDFDGDGKKDIWNNPADVFASIANFLKTEGWSDKGTW 237

Query: 248 QPGEK 252
               K
Sbjct: 238 GRQVK 242


>gi|264679926|ref|YP_003279835.1| lytic murein transglycosylase [Comamonas testosteroni CNB-2]
 gi|262210441|gb|ACY34539.1| lytic murein transglycosylase [Comamonas testosteroni CNB-2]
          Length = 444

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 67/229 (29%), Positives = 105/229 (45%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
            A T+             A  F  WK     RA   G+S +T +   A      + +  D
Sbjct: 48  PAKTEQGTDEAAMESPIQASNFAHWKQEFAPRARAAGISERTLRSALAGARLQPSIVKLD 107

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R        +   YLD   S++ I  G    +  +  L    + YGVP  ++ A+WG+E+
Sbjct: 108 RSQPE-FTRTPWQYLDSAVSAQRIRTGKLKMQEYAASLQAASQRYGVPAPVIAAIWGMES 166

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           ++G   G    +  LATLA+D RRA++  ++   AL ++  G I +  +  +  G +G  
Sbjct: 167 NYGSNFGSFSAVDALATLAFDGRRAEWAQKELIAALRIIDNGDIDAAHMISSWAGAMGNT 226

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QFLP   ++YA+DAD DG+ D+  S  D  AS A +LA  GW     + 
Sbjct: 227 QFLPSVFLQYAVDADGDGRRDIWGSMADVAASTANYLASSGWNPGEPWG 275



 Score = 44.5 bits (103), Expect = 0.020,   Method: Composition-based stats.
 Identities = 8/27 (29%), Positives = 15/27 (55%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           NF  +  +N S NY   ++ +A+ + G
Sbjct: 337 NFRAILRYNNSTNYALAVSLLASQLAG 363


>gi|163852472|ref|YP_001640515.1| lytic murein transglycosylase [Methylobacterium extorquens PA1]
 gi|163664077|gb|ABY31444.1| lytic murein transglycosylase [Methylobacterium extorquens PA1]
          Length = 413

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 69/319 (21%), Positives = 121/319 (37%), Gaps = 64/319 (20%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
           P  A  +         F       +  A   G+    A+   + +    + +   +    
Sbjct: 18  PIPARAEAPTDPAPPDFARCLGELKTLAQERGVPRTVAETALSGIAPDPSVVPATQSQAE 77

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
                  +Y++   + E IA G A     S +L  ++  YGV   IL+A WG+E+++G  
Sbjct: 78  -FVKPVWEYIEASVTPERIATGQAKLAQWSEVLGRIEAAYGVDRHILVAFWGVESNYGAA 136

Query: 146 MGK---TPLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQ 200
           +      P++  LATLA  D  R   + ++   AL ++  G   +  + G+  G +G  Q
Sbjct: 137 LEGTGIRPVVPALATLACGDPARPGLWRDELVAALKILADGDADAERMRGSWAGAMGHTQ 196

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL------GW------------- 241
           F+P   +++A+D D DG+ D+  S  DA+AS A FL +       GW             
Sbjct: 197 FMPTAFLRHAVDFDGDGRRDIWHSVPDALASTANFLKQSGWGAGEGWGLEVLLPDGFDYR 256

Query: 242 -------TKCAGYQPG--------------------------------EKNFAILKHWNA 262
                     A +Q                                  E NF ++  +N 
Sbjct: 257 VADETTERPFAEWQRLGLKPANGAFPDGAERRATLLLPTGAKGPAFLLEPNFRVILRYNT 316

Query: 263 SLNYNKTIAYIAAHIDGVP 281
           +L Y  T+A+++  + G P
Sbjct: 317 ALAYALTVAHLSDRLRGAP 335


>gi|194367769|ref|YP_002030379.1| lytic murein transglycosylase [Stenotrophomonas maltophilia R551-3]
 gi|194350573|gb|ACF53696.1| lytic murein transglycosylase [Stenotrophomonas maltophilia R551-3]
          Length = 422

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 66/237 (27%), Positives = 107/237 (45%), Gaps = 3/237 (1%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           +++   LA A+                  F    +  +A A  +G+S +    + A L  
Sbjct: 3   ILITLGLAAALASTPAQLAAPDAGLDPA-FSRCLAGLQATAASQGISAERFNEITAGLTP 61

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
             + +               DYL  L   + +  G A+ + +  LL  +  +YGV P  +
Sbjct: 62  DPSVLGLLDAQPE-FTTPIWDYLAALVDRQRVDDGRAMLQQHRDLLDRVSAQYGVDPTTI 120

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGA 191
           +A+WG+E+ +G   GK PLL +LATL+   RR  FF  +    L L+ +G + +    G+
Sbjct: 121 VAVWGVESDYGRVFGKRPLLQSLATLSCAGRRQAFFRGELLALLKLIDRGDLQAQGLTGS 180

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
             G  G  QF+P    + A+D D DG+ DLV S  DA+AS A +L + GW     + 
Sbjct: 181 WAGAFGHTQFMPSTYARIAVDGDGDGRRDLVGSIPDALASTANYLKRAGWRSGEPWG 237



 Score = 42.2 bits (97), Expect = 0.082,   Method: Composition-based stats.
 Identities = 8/29 (27%), Positives = 16/29 (55%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
           +N+  +  +NA+ +Y   IA +A  + G 
Sbjct: 303 RNYDAIYSYNAAESYALAIATLADQLRGG 331


>gi|116049103|ref|YP_792095.1| transglycolase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115584324|gb|ABJ10339.1| probable transglycolase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 398

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 72/303 (23%), Positives = 119/303 (39%), Gaps = 60/303 (19%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
             A  F    +  + +A  +G+S  + +   + L+   + +               DYL 
Sbjct: 20  PDASSFPSCLAGLQKKAQAQGISADSYERFTSGLQADLSVLDLLDAQPE-FTTPLWDYLA 78

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   GK PLL++L+
Sbjct: 79  GLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIFGKRPLLTSLS 138

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TL+   RR  FF  +F   L L++ G I  +   G+  G  G  QF+P    + A+D D 
Sbjct: 139 TLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPSTYARIAVDFDG 198

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--------------------------- 248
           DG+ DLV S  DA+ S A +L K GW     +                            
Sbjct: 199 DGRRDLVGSVPDALGSTANYLKKAGWRTGQPWGYEVKVPADFPASLGGRGKRQPLSAWVA 258

Query: 249 -----------PGEKNFAIL--------------------KHWNASLNYNKTIAYIAAHI 277
                      PG    A +                      +NA+ +Y   IA ++  +
Sbjct: 259 RGVKRADGQPLPGGDEKAAILLPTGAQGPAFLVYRNYDAIYSYNAAESYALAIALLSDRL 318

Query: 278 DGV 280
            G 
Sbjct: 319 RGG 321


>gi|299529933|ref|ZP_07043361.1| lytic murein transglycosylase [Comamonas testosteroni S44]
 gi|298722105|gb|EFI63034.1| lytic murein transglycosylase [Comamonas testosteroni S44]
          Length = 444

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 66/229 (28%), Positives = 104/229 (45%), Gaps = 2/229 (0%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
            A  +             A  F  WK     RA   G+S +T +   A      + +  D
Sbjct: 48  PAKAEQGTEEAAMESPIQASNFAHWKQEFAPRARAAGISERTLRSALAGARLQPSIVKLD 107

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R        +   YLD   S++ I  G    +  +  L    + YGVP  ++ A+WG+E+
Sbjct: 108 RSQPE-FTRTPWQYLDSAVSAQRIRTGKLKMQEYAASLQAASQRYGVPAPVIAAIWGMES 166

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           ++G   G    +  LATLA+D RRA++  ++   AL ++  G I +  +  +  G +G  
Sbjct: 167 NYGSNFGSFSAVDALATLAFDGRRAEWAQKELIAALRIIDNGDIDAAHMISSWAGAMGNT 226

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           QFLP   ++YA+DAD DG+ D+  S  D  AS A +LA  GW     + 
Sbjct: 227 QFLPSVFLQYAVDADGDGRRDIWGSMADVAASTANYLASSGWNPGEPWG 275



 Score = 44.9 bits (104), Expect = 0.014,   Method: Composition-based stats.
 Identities = 8/27 (29%), Positives = 14/27 (51%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           NF  +  +N S NY   +  +A+ + G
Sbjct: 337 NFRAILRYNNSTNYALAVGLLASQLAG 363


>gi|148978267|ref|ZP_01814785.1| lytic murein transglycosylase, putative [Vibrionales bacterium
           SWAT-3]
 gi|145962568|gb|EDK27845.1| lytic murein transglycosylase, putative [Vibrionales bacterium
           SWAT-3]
          Length = 332

 Score =  188 bits (477), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 113/245 (46%), Gaps = 9/245 (3%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
                S+L +   +L  ++T       +         F ++    + +   EG+S     
Sbjct: 2   SKFSKSILAVSALLLGNSLTIGSVQAQELS-------FEQYVEKLKQQGREEGISEAIID 54

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  + +    +  D+       ++  +Y+        + Q  +L K + + L  +  E
Sbjct: 55  EAFDGVTFKPRAVKADKNQPEK-KLTLDEYIPRAVPDWKVKQARSLYKKHYKALKRIGDE 113

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGV P  ++ALWG+E++FG+  G   ++  L T+AY+ RR  FF  +   AL ++ +G I
Sbjct: 114 YGVQPRFIVALWGVESNFGKFTGNYSVIDALTTMAYEGRREAFFRSEAMAALTILDQGHI 173

Query: 185 SS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +     G+  G +GQ QF+P + + +A D + DGK D+  +  D  ASAA +L++ GW  
Sbjct: 174 TPKEMKGSWAGAMGQPQFMPSSFLAFAADGNGDGKKDIWGTEEDVFASAANYLSQSGWDD 233

Query: 244 CAGYQ 248
              + 
Sbjct: 234 KYTWG 238


>gi|254524357|ref|ZP_05136412.1| epimerase [Stenotrophomonas sp. SKA14]
 gi|219721948|gb|EED40473.1| epimerase [Stenotrophomonas sp. SKA14]
          Length = 421

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 71/268 (26%), Positives = 114/268 (42%), Gaps = 8/268 (2%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           M +   L  A       T     +     F    +  +A A  +G+  +    + A L  
Sbjct: 1   MPILTTLGLAAALVSAPTPAAADASVDPAFSRCLANLQATAASQGIRAERFTEITAGLTP 60

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
             + +               DYL  L   + +  G A+ + +  LL  +  +YGV P  +
Sbjct: 61  DPSVLGLLDAQPE-FTTPIWDYLAALVDRQRVDDGRAMLQQHRDLLDRVSAQYGVDPATI 119

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGA 191
           +A+WG+E+ +G   GK PLL +LATL+   RR  FF  +    L L+ +G + +    G+
Sbjct: 120 VAVWGVESDYGRVFGKRPLLQSLATLSCAGRRQAFFRGELLALLTLIDRGDLQAQGLTGS 179

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             G  G  QF+P    + A+D D DG+ DLV S  DA+AS A +L + GW     +    
Sbjct: 180 WAGAFGHTQFMPSTYARIAVDGDGDGRRDLVGSIPDALASTANYLKRAGWRSGEPWGME- 238

Query: 252 KNFAILKHWNASLN---YNKTIAYIAAH 276
               +   +NAS       + +A   A 
Sbjct: 239 --VRVPAGFNASQAGRTQRRALAEWRAQ 264



 Score = 42.5 bits (98), Expect = 0.077,   Method: Composition-based stats.
 Identities = 8/29 (27%), Positives = 16/29 (55%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
           +N+  +  +NA+ +Y   IA +A  + G 
Sbjct: 302 RNYDAIYSYNAAESYALAIATLADQLRGG 330


>gi|261210604|ref|ZP_05924897.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. RC341]
 gi|260840389|gb|EEX66960.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. RC341]
          Length = 325

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 69/280 (24%), Positives = 132/280 (47%), Gaps = 22/280 (7%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L   ++ P  A            F ++  + + +  +EG+S +  +  F ++EY 
Sbjct: 4   LLSIVLGLTLSAPVLANEV--------SFEQYVESLKQQGRQEGISDRVLEAAFRNVEYK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  D+       ++  +Y+        + Q  AL + +   L  + ++YGV P  ++
Sbjct: 56  PRAVVADKNQPEK-KLTLDEYIPRAVPEWKVKQAQALYEKHYDELQRIGQQYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGAT 192
           ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G I+     G+ 
Sbjct: 115 ALWGVESNFGALTGNFSVIDALSTLAYEGRREEFFRKETMAALQILEQGHIAPEAMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ GW     +    +
Sbjct: 175 AGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGWDDKYTWG---R 231

Query: 253 NFAILKHWNA-----SLNYNKTIAYIAA----HIDGVPIG 283
              I K +N           KT+   +       DG P+ 
Sbjct: 232 QVKIPKGFNHDLEGRQPEKGKTLQEWSKLGVTRYDGKPLP 271



 Score = 39.8 bits (91), Expect = 0.40,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 297 YNNYNVLMKWNRSYYFALAVSHLADRIK 324


>gi|188584460|ref|YP_001927905.1| lytic murein transglycosylase [Methylobacterium populi BJ001]
 gi|179347958|gb|ACB83370.1| lytic murein transglycosylase [Methylobacterium populi BJ001]
          Length = 398

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 76/272 (27%), Positives = 123/272 (45%), Gaps = 8/272 (2%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           A       T   I       F    +  +A+A   G+S +T +   A++ Y D  I   +
Sbjct: 8   ASLIGLALTGSLITGSARADFQSCLAGIQAQAASAGVSAQTFRAATANIAYDDKVIELSQ 67

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
                      DY+  L   E +  G A  + +++ L N +  YGV    + A+WG+E++
Sbjct: 68  AQPE-FKTPIWDYMSALVDDERVEDGRAAMRQHAQALANAEARYGVDRYTIAAVWGVESN 126

Query: 142 FGETMGKTPLLSTLATLAYDC-RRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQF 199
           FG+ +GK PL+ +LATLA    RR +FF  +    L ++++G I +    G+  G  GQ 
Sbjct: 127 FGKNLGKMPLVQSLATLACSGHRRREFFRTELIATLKIIERGDIEASRLTGSWAGAFGQT 186

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH 259
           QF+P    + A+D D DG+ D+V S  DA+AS A FL    W+    +    +       
Sbjct: 187 QFMPTTYQRLAVDGDGDGRRDVVDSVADAVASTANFLRVAKWSNGHPWGYEVRLPRGFNA 246

Query: 260 WNASLNYNKTIAYIA----AHIDGVPI-GKGY 286
             A       + + A      +DG P+ G+G 
Sbjct: 247 GAAGRKNKHAVGHWASLGVTRVDGKPLTGEGP 278



 Score = 46.4 bits (108), Expect = 0.005,   Method: Composition-based stats.
 Identities = 10/31 (32%), Positives = 17/31 (54%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
            KNF  +  +NA+ +Y   IA ++  + G P
Sbjct: 295 TKNFDAIYSYNAAESYGLAIAVLSDRLRGRP 325


>gi|54298921|ref|YP_125290.1| hypothetical protein lpp2988 [Legionella pneumophila str. Paris]
 gi|148361252|ref|YP_001252459.1| lytic murein transglycosylase [Legionella pneumophila str. Corby]
 gi|296108591|ref|YP_003620292.1| lytic murein transglycosylase [Legionella pneumophila 2300/99
           Alcoy]
 gi|53752706|emb|CAH14141.1| hypothetical protein lpp2988 [Legionella pneumophila str. Paris]
 gi|148283025|gb|ABQ57113.1| lytic murein transglycosylase [Legionella pneumophila str. Corby]
 gi|295650493|gb|ADG26340.1| lytic murein transglycosylase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 320

 Score =  188 bits (477), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 77/296 (26%), Positives = 122/296 (41%), Gaps = 57/296 (19%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           +  + +W +  R  A+++G+ P      FA +      I    +      ++F  Y +  
Sbjct: 21  SQSWNQWVAGVREEALQQGIPPSLFDEAFAGIHEPSRKIKGFLRSQPEHRLTFMKYRNTR 80

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           + +  I  G    K N  +L  + ++YGV P  +++ WG+ET +G  MG  P+++ LATL
Sbjct: 81  ADNYRIVIGRKEYKRNKEILEEIAQQYGVNPCFIVSFWGMETSYGSYMGNFPVINALATL 140

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R  FF ++ F AL ++K G +S +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 141 AYDSNRKDFFRKELFLALHILKGGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 200

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP---------------------------- 249
           + D+ KS  D  AS A ++ + GW     +                              
Sbjct: 201 RKDIWKSKPDVFASIANYMKQNGWQAGEPWAIQVKLPAKFDMKLEGKGIVKPVSEWNALG 260

Query: 250 ----------------------GEKNFAI------LKHWNASLNYNKTIAYIAAHI 277
                                 G   F        +  +N S+ Y   I Y+A  I
Sbjct: 261 VRTESGEPLPYQNLQASIVQPYGGPTFLAFPNYKMILRYNNSIYYAGAIGYMADKI 316


>gi|306843207|ref|ZP_07475819.1| lytic murein transglycosylase [Brucella sp. BO2]
 gi|306286597|gb|EFM58172.1| lytic murein transglycosylase [Brucella sp. BO2]
          Length = 410

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 80/347 (23%), Positives = 122/347 (35%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L ++L     +                        +    FG+W       A 
Sbjct: 1   MKIIASVLAAVLFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTKEAR 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 61  EAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISDARLKKGQENLVKY 118

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 119 ADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 178

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A +
Sbjct: 179 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGR 238

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 239 MLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 298

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 299 LLPLGRKGPAFLSYPNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 345


>gi|254473060|ref|ZP_05086458.1| lytic murein transglycosylase [Pseudovibrio sp. JE062]
 gi|211957781|gb|EEA92983.1| lytic murein transglycosylase [Pseudovibrio sp. JE062]
          Length = 405

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 66/264 (25%), Positives = 113/264 (42%), Gaps = 23/264 (8%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M F    L ++L   + + + +                   F +W +  +  AV +G+SP
Sbjct: 1   MRFSS--LPAVLCAGFLLFSSSYGFA-----------QGSDFQKWIAGFKRTAVAQGVSP 47

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +    +F  +                   +   YLD   S + +  G  +    +  L  
Sbjct: 48  QLYDRVFKGMTPDPRIKKSAENQPE-FTRAIWQYLDSAVSQDRVLHGRRMVDEWAGWLDK 106

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGK----TPLLSTLATLAYDC-RRAKFFTEQFFYA 175
           ++ +YGV   +++A+WG+E+ +G  +            LATLAY+  RR K+  +Q   A
Sbjct: 107 IESKYGVNRHVVLAIWGMESSYGRILDNKAIVRSTPRALATLAYNGGRRGKYARKQLVAA 166

Query: 176 LDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L +++ G +S   + G+  G +G  QF+P     YA+D   DGK D+  S  DA+AS A 
Sbjct: 167 LKILQNGDVSPQQMQGSWAGAMGHTQFIPTTYQAYAVDITGDGKRDIWNSIPDALASTAA 226

Query: 235 FLAKLGWTKCAGYQPG---EKNFA 255
           +L K+GW     +       KNF 
Sbjct: 227 YLNKMGWQSGQTWGYEVTLPKNFN 250



 Score = 46.0 bits (107), Expect = 0.006,   Method: Composition-based stats.
 Identities = 8/29 (27%), Positives = 16/29 (55%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            KNF ++K +N S  Y   + +++  + G
Sbjct: 301 LKNFYVIKRYNNSNAYALGVGHLSDRLLG 329


>gi|307611802|emb|CBX01515.1| hypothetical protein LPW_32021 [Legionella pneumophila 130b]
          Length = 320

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 77/296 (26%), Positives = 122/296 (41%), Gaps = 57/296 (19%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           +  + +W +  R  A+++G+ P      FA +      I    +      ++F  Y +  
Sbjct: 21  SQSWNQWVAGVREEALQQGIPPSLFDEAFAGIHEPSRKIKGFLRSQPEHRLTFMKYRNTR 80

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           + +  I  G    K N  +L  + ++YGV P  +++ WG+ET +G  MG  P+++ LATL
Sbjct: 81  ADNYRIVIGRKEYKRNKEILEEIAQQYGVNPCFIVSFWGMETSYGSYMGNFPVINALATL 140

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R  FF ++ F AL ++K G +S +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 141 AYDSNRKDFFRKELFLALHILKGGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 200

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP---------------------------- 249
           + D+ KS  D  AS A ++ + GW     +                              
Sbjct: 201 RKDIWKSKPDVFASIANYMKQNGWQAGEPWAIQVKLPAKFDMKLEGKSIVKPVSEWNALG 260

Query: 250 ----------------------GEKNFAI------LKHWNASLNYNKTIAYIAAHI 277
                                 G   F        +  +N S+ Y   I Y+A  I
Sbjct: 261 VRTESGEPLPYQNLQASIVQPYGGPTFLAFPNYKMILRYNNSIYYAGAIGYMADKI 316


>gi|240139809|ref|YP_002964286.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
 gi|240009783|gb|ACS41009.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
          Length = 413

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 70/319 (21%), Positives = 122/319 (38%), Gaps = 64/319 (20%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
           P  A  +         F       +  A   G+S   A+   + +    + +   +    
Sbjct: 18  PIPARAEAPTDPAPPDFVRCLGELKTLAEERGVSRTVAETALSGVAPDPSVVPATQSQAE 77

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
                  +Y++   + E IA G A     S +L  ++  YGV   IL+A WG+E+++G  
Sbjct: 78  -FVKPVWEYIEASVTPERIATGQAKLAQWSEVLGRIEAAYGVDRHILVAFWGVESNYGAA 136

Query: 146 MGK---TPLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQ 200
           +      P++  LATLA  D  R   + ++   AL ++  G   +  + G+  G +G  Q
Sbjct: 137 LEGAGIRPVVPALATLACGDPARPGLWRDELVAALKILADGDADAERMRGSWAGAMGHTQ 196

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL------GW------------- 241
           F+P   +++A+D D DG+ D+  S  DA+AS A FL +       GW             
Sbjct: 197 FMPTAFLRHAVDFDGDGRRDIWHSVPDALASTANFLKQSGWRAGEGWGLEVLLPDGFDYR 256

Query: 242 -------TKCAGYQPG--------------------------------EKNFAILKHWNA 262
                     A +Q                                  E NF ++  +N 
Sbjct: 257 VADETTERPFAEWQRLGLKPANGAFPDGAERRAALLLPTGAKGPAFLLEPNFRVILRYNT 316

Query: 263 SLNYNKTIAYIAAHIDGVP 281
           +L Y  T+A+++  + G P
Sbjct: 317 ALAYALTVAHLSDRLRGAP 335


>gi|15596368|ref|NP_249862.1| transglycolase [Pseudomonas aeruginosa PAO1]
 gi|254234305|ref|ZP_04927628.1| hypothetical protein PACG_00144 [Pseudomonas aeruginosa C3719]
 gi|9947095|gb|AAG04560.1|AE004547_6 probable transglycolase [Pseudomonas aeruginosa PAO1]
 gi|126166236|gb|EAZ51747.1| hypothetical protein PACG_00144 [Pseudomonas aeruginosa C3719]
          Length = 398

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/303 (23%), Positives = 119/303 (39%), Gaps = 60/303 (19%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
             A  F    +  + +A  +G+S  + +   + L+   + +               DYL 
Sbjct: 20  PDASSFPSCLAGLQKKAQAQGISADSYERFTSGLQADLSVLDLLDAQPE-FTTPLWDYLA 78

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   GK PLL++L+
Sbjct: 79  GLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIFGKRPLLTSLS 138

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TL+   RR  FF  +F   L L++ G I  +   G+  G  G  QF+P    + A+D D 
Sbjct: 139 TLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPSTYARIAVDFDG 198

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--------------------------- 248
           DG+ DLV S  DA+ S A +L K GW     +                            
Sbjct: 199 DGRRDLVGSVPDALGSTANYLKKAGWRTGQPWGYEVKVPADFPASLAGRGKRQPLSAWVA 258

Query: 249 -----------PGEKNFAIL--------------------KHWNASLNYNKTIAYIAAHI 277
                      PG    A +                      +NA+ +Y   IA ++  +
Sbjct: 259 RGVRRVDGQPLPGGDEKAAILLPAGAQGPAFLVYRNYDAIYSYNAAESYALAIALLSDRL 318

Query: 278 DGV 280
            G 
Sbjct: 319 RGG 321


>gi|52843112|ref|YP_096911.1| lytic murein transglycosylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52630223|gb|AAU28964.1| lytic murein transglycosylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 325

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 77/296 (26%), Positives = 122/296 (41%), Gaps = 57/296 (19%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           +  + +W +  R  A+++G+ P      FA +      I    +      ++F  Y +  
Sbjct: 26  SQSWNQWVAGVREEALQQGIPPSLFDEAFAGIHEPSRKIKGFLRSQPEHRLTFMKYRNTR 85

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           + +  I  G    K N  +L  + ++YGV P  +++ WG+ET +G  MG  P+++ LATL
Sbjct: 86  ADNYRIVIGRKEYKKNKEILEEIAQQYGVNPCFIVSFWGMETSYGSYMGNFPVINALATL 145

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R  FF ++ F AL ++K G +S +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 146 AYDSNRKDFFRKELFLALHILKGGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 205

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP---------------------------- 249
           + D+ KS  D  AS A ++ + GW     +                              
Sbjct: 206 RKDIWKSKPDVFASIANYMKQNGWQAGEPWAIQVKLPAKFDMKLEGKGIVKPVSEWNALG 265

Query: 250 ----------------------GEKNFAI------LKHWNASLNYNKTIAYIAAHI 277
                                 G   F        +  +N S+ Y   I Y+A  I
Sbjct: 266 VRTESGEPLPYQNLQASIVQPYGGPTFLAFPNYKMILRYNNSIYYAGAIGYMADKI 321


>gi|254239539|ref|ZP_04932861.1| hypothetical protein PA2G_00155 [Pseudomonas aeruginosa 2192]
 gi|126192917|gb|EAZ56980.1| hypothetical protein PA2G_00155 [Pseudomonas aeruginosa 2192]
          Length = 398

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/303 (23%), Positives = 119/303 (39%), Gaps = 60/303 (19%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
             A  F    +  + +A  +G+S  + +   + L+   + +               DYL 
Sbjct: 20  PDASSFPSCLAGLQKKAQAQGISADSYERFTSGLQADLSVLDLLGAQPE-FTTPLWDYLA 78

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   GK PLL++L+
Sbjct: 79  GLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIFGKRPLLTSLS 138

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TL+   RR  FF  +F   L L++ G I  +   G+  G  G  QF+P    + A+D D 
Sbjct: 139 TLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPSTYARIAVDFDG 198

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--------------------------- 248
           DG+ DLV S  DA+ S A +L K GW     +                            
Sbjct: 199 DGRRDLVGSVPDALGSTANYLKKAGWRTGQPWGYEVKVPADFPASLAGRGKRQPLSAWVA 258

Query: 249 -----------PGEKNFAIL--------------------KHWNASLNYNKTIAYIAAHI 277
                      PG    A +                      +NA+ +Y   IA ++  +
Sbjct: 259 RGVRRVDGQPLPGGDEKAAILLPAGAQGPAFLVYRNYDAIYSYNAAESYALAIALLSDRL 318

Query: 278 DGV 280
            G 
Sbjct: 319 RGG 321


>gi|323494739|ref|ZP_08099840.1| putative lytic murein transglycosylase [Vibrio brasiliensis LMG
           20546]
 gi|323310999|gb|EGA64162.1| putative lytic murein transglycosylase [Vibrio brasiliensis LMG
           20546]
          Length = 323

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 65/260 (25%), Positives = 115/260 (44%), Gaps = 26/260 (10%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
            F E+    +  A + G+S    +  F ++ +    +  D+       ++  +Y+     
Sbjct: 23  SFEEYVEGLKDEARQNGISELVIEQAFDNVTHKPRAVKADKNQPEK-KLTLDEYIPRAVP 81

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + Q  +L + +   L  +   YGV P  ++ALWG+E++FG+  G   ++  L+T+AY
Sbjct: 82  DWKVKQAKSLYQKHYADLKEIGDAYGVQPRFIVALWGVESNFGKFTGNYRVIDALSTMAY 141

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           D RR  FF ++   AL ++++G I+     G+  G +GQ QF+P + + +A D   DGK 
Sbjct: 142 DGRREDFFRKETMAALQILEQGHIAVEDFKGSWAGAMGQCQFMPSSFLAFAADGSGDGKK 201

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNF---------------AILKHWNASL 264
           D+  S  D  ASAA +L++ GW     +    K                   L+ WN   
Sbjct: 202 DIWNSEADVFASAANYLSQSGWDDSYTWGRQVKLPQGFDTSIQGRSEEKGKYLQEWNKLG 261

Query: 265 NYNKTIAYIAAHIDGVPIGK 284
                        DG P+ +
Sbjct: 262 V---------TRYDGRPLPQ 272



 Score = 39.5 bits (90), Expect = 0.63,   Method: Composition-based stats.
 Identities = 7/27 (25%), Positives = 14/27 (51%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHI 277
             N+ +L  WN S  +   ++++A  I
Sbjct: 295 YNNYNVLMKWNRSYYFALAVSHLADRI 321


>gi|315123527|ref|YP_004065533.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas sp. SM9913]
 gi|315017287|gb|ADT70624.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas sp. SM9913]
          Length = 338

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 65/236 (27%), Positives = 113/236 (47%), Gaps = 9/236 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           +   +    ++    A TQ         F ++ +  +  A+ +G   +  +  FA   Y 
Sbjct: 5   LAVVLCGVCLSSSVMAKTQ-------AEFQQYLTNLKQEAIAKGYDTQLIEQAFATASYK 57

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
           +  I+ D+        + + YL        I +   L K N  +L  + K++GV    ++
Sbjct: 58  EKVISADKNQPEV-KETLETYLPKRVPQWKIDRARKLYKENQEVLEKVAKDFGVQARFIV 116

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GAT 192
           A+WGLE++FG   G   ++S+L TLA+D RR   +  Q + ALD++K G I+     G+ 
Sbjct: 117 AIWGLESNFGAIQGGHNVISSLVTLAFDGRREALYKRQLWAALDILKSGHITLDKFKGSW 176

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            G +GQ QF+P +   YA+D + DG+ D+  +  DA AS A +L + GW     + 
Sbjct: 177 AGAMGQTQFMPTSFNAYAVDYNNDGRKDIWTTKEDAFASIANYLKQEGWNDNLTWG 232



 Score = 38.3 bits (87), Expect = 1.2,   Method: Composition-based stats.
 Identities = 7/29 (24%), Positives = 14/29 (48%)

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHID 278
              N+ +  HWN S  +  ++ Y++  I 
Sbjct: 306 AYDNYKVFMHWNRSYYFATSVGYLSDRIA 334


>gi|313106144|ref|ZP_07792398.1| putative transglycosylase [Pseudomonas aeruginosa 39016]
 gi|310878900|gb|EFQ37494.1| putative transglycosylase [Pseudomonas aeruginosa 39016]
          Length = 398

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/303 (23%), Positives = 119/303 (39%), Gaps = 60/303 (19%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
             A  F    +  + +A  +G+S  + +   + L+   + +               DYL 
Sbjct: 20  PDASSFPSCLAGLQKKAQAQGISADSYERFTSGLQADLSVLDLLDAQPE-FTTPLWDYLA 78

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   GK PLL++L+
Sbjct: 79  GLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIFGKRPLLTSLS 138

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TL+   RR  FF  +F   L L++ G I  +   G+  G  G  QF+P    + A+D D 
Sbjct: 139 TLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPSTYARIAVDFDG 198

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--------------------------- 248
           DG+ DLV S  DA+ S A +L K GW     +                            
Sbjct: 199 DGRRDLVGSVPDALGSTANYLKKAGWRTGQPWGYEVKVPADFPASLAGRGKRQPLSAWVA 258

Query: 249 -----------PGEKNFAIL--------------------KHWNASLNYNKTIAYIAAHI 277
                      PG    A +                      +NA+ +Y   IA ++  +
Sbjct: 259 RGVKRADGQPLPGGDEKAAILLPTGAQGPAFLVYRNYDAIYSYNAAESYALAIALLSDRL 318

Query: 278 DGV 280
            G 
Sbjct: 319 RGG 321


>gi|218892865|ref|YP_002441734.1| putative transglycolase [Pseudomonas aeruginosa LESB58]
 gi|218773093|emb|CAW28905.1| probable transglycolase [Pseudomonas aeruginosa LESB58]
          Length = 398

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/303 (23%), Positives = 119/303 (39%), Gaps = 60/303 (19%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
             A  F    +  + +A  +G+S  + +   + L+   + +               DYL 
Sbjct: 20  PDASSFPSCLAGLQKKAQAQGISADSYERFTSGLQADLSVLDLLDAQPE-FTTPLWDYLA 78

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   GK PLL++L+
Sbjct: 79  GLVDEQRVSDGKAMLAQHDKLLDQVAVRYGVDKYTVVAVWGVESDYGRIFGKRPLLTSLS 138

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TL+   RR  FF  +F   L L++ G I  +   G+  G  G  QF+P    + A+D D 
Sbjct: 139 TLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPSTYARIAVDFDG 198

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--------------------------- 248
           DG+ DLV S  DA+ S A +L K GW     +                            
Sbjct: 199 DGRRDLVGSVPDALGSTANYLKKAGWRTGQPWGYEVKVPADFPASLAGRGKRQPLSAWVA 258

Query: 249 -----------PGEKNFAIL--------------------KHWNASLNYNKTIAYIAAHI 277
                      PG    A +                      +NA+ +Y   IA ++  +
Sbjct: 259 RGVRRVDGQPLPGGDEKAAILLPAGAQGPAFLVYRNYDAIYSYNAAESYALAIALLSDRL 318

Query: 278 DGV 280
            G 
Sbjct: 319 RGG 321


>gi|146338732|ref|YP_001203780.1| putative lytic murein transglycosylase [Bradyrhizobium sp. ORS278]
 gi|146191538|emb|CAL75543.1| putative lytic murein transglycosylase [Bradyrhizobium sp. ORS278]
          Length = 254

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 93/256 (36%), Positives = 136/256 (53%), Gaps = 10/256 (3%)

Query: 25  QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
                     C  +   F  WK      A  +G+             Y   TIA DR   
Sbjct: 3   AAFSGAQAAQCGTSPAGFEAWKRDFSEEARAKGIGGTAL-SALMQTNYASATIAADRGQR 61

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
           +   +S   +L    ++ I+A+G  LK++ + +  ++++ YGVPPG L+A+WG+E+ FG 
Sbjct: 62  S-FQLSLDQFLAKRGAAAIVARGRQLKQSQAAMFASIEQRYGVPPGPLIAIWGMESGFGS 120

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPV 204
             G   +LS++ATLAYDCRR +FFTEQ + AL L+ +GV+S    G+  GE+GQ QF+P 
Sbjct: 121 QRGNQHMLSSIATLAYDCRRPEFFTEQLYAALKLIDRGVLSGATRGSMHGEVGQTQFMPK 180

Query: 205 NVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASL 264
           N++ Y +          +    +A+AS A FL   GW   AGYQPGE NFA ++ WNA+ 
Sbjct: 181 NILAYGVGN--------LDVAANALASTANFLRANGWKAGAGYQPGEPNFAAIEAWNAAG 232

Query: 265 NYNKTIAYIAAHIDGV 280
            Y K IA +   IDG 
Sbjct: 233 VYQKAIALMGRQIDGG 248


>gi|119897628|ref|YP_932841.1| peptidoglycan-binding protein [Azoarcus sp. BH72]
 gi|119670041|emb|CAL93954.1| conserved hypothetical peptidoglycan-binding protein [Azoarcus sp.
           BH72]
          Length = 404

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 83/332 (25%), Positives = 132/332 (39%), Gaps = 63/332 (18%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
           +P+ A     P   +     +          +  RA A   G+S  T   L A L+   T
Sbjct: 10  FPVSALLAVAPFALSLAAPAAAQDL---ACLAQLRAPAQAYGVSAATFDRLTAGLQADPT 66

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            +               DY+  L   E IA G A+ +  S +L  ++ EYGV    ++A+
Sbjct: 67  VLPLLDAQPE-FVTPIWDYMAALVDDERIADGRAMLEQWSAVLARVEAEYGVDAATVVAV 125

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFG 194
           WG+E+++G   G   LL +LATLA + RR  FF ++ F  + +V+ G ++     G+  G
Sbjct: 126 WGVESNYGRNFGSRALLPSLATLACNGRRQSFFRQELFATMKIVEDGHVAPERLNGSWAG 185

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY------- 247
             G  QF+P   ++ A+D D DG+ DLV S  DA+AS A FL + GW +   +       
Sbjct: 186 AFGHTQFMPSTYLRLAVDFDGDGRRDLVDSIADALASTANFLRQAGWQRGLAWGYEVGLP 245

Query: 248 ------QPGEKN--------------------------------------------FAIL 257
                   G KN                                            F  +
Sbjct: 246 AGFDSSGAGRKNKRGIAEWAGRGVRRADGGALAQAGNAALLLPAGASGPAFLVTRNFDAI 305

Query: 258 KHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
             +NA+ +Y   IA+++  + G  P    + T
Sbjct: 306 YSYNAAESYALAIAHLSDRLRGAGPFATPWPT 337


>gi|15889403|ref|NP_355084.1| lytic murein transglycosylase [Agrobacterium tumefaciens str. C58]
 gi|15157257|gb|AAK87869.1| lytic murein transglycosylase [Agrobacterium tumefaciens str. C58]
          Length = 408

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 80/340 (23%), Positives = 130/340 (38%), Gaps = 60/340 (17%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICS-DTADRFGEWKSAARARAVREGMSP 60
           +F+   ++    +       A+  P  A+             G +    +A AV +G+  
Sbjct: 3   TFRSRSIVFAAALSLLSAGSALATPPVASPDDPKQVACGGDLGAFLEGVKAEAVAKGVPA 62

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
              +   A  +     ++RDR        +F ++     S   +  G    +  S     
Sbjct: 63  AAIEKALAGAQIDPKVLSRDRAQG-VFRQTFLEFSQRTVSQARLDIGRKKLQELSSTFAR 121

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
            + E+GVP G++ A W +ET FG   G     + L TL++DCRR + F  Q    +++V+
Sbjct: 122 AENEFGVPAGVIAAFWAMETDFGAVQGDFNTRNALVTLSHDCRRPELFRPQLLALIEMVQ 181

Query: 181 KGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G +      GA  GEIGQ Q LP +++ + +D D +G I++  S  DAI +AAKF+  L
Sbjct: 182 HGDLDPATNTGAWAGEIGQVQMLPKDIIAFGVDGDGNGHINVKDSAPDAILTAAKFIQHL 241

Query: 240 GWTKCAGY---------------------------------QPGEKNFAIL--------- 257
           G+ K   +                                 + G KNFA L         
Sbjct: 242 GFKKGEPWMQEVSVPENLPWEKSGLGGSLTAGDWFALGVTPRDGNKNFASLPAALIMPQG 301

Query: 258 ---------------KHWNASLNYNKTIAYIAAHIDGVPI 282
                            WN S  Y  + AY A  + G P+
Sbjct: 302 RKGPTFITYPNFNIYLEWNQSFIYTTSAAYFANRLMGAPV 341


>gi|255320738|ref|ZP_05361914.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           radioresistens SK82]
 gi|262380641|ref|ZP_06073794.1| lytic murein transglycosylase B [Acinetobacter radioresistens
           SH164]
 gi|255302208|gb|EET81449.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           radioresistens SK82]
 gi|262297589|gb|EEY85505.1| lytic murein transglycosylase B [Acinetobacter radioresistens
           SH164]
          Length = 427

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 75/315 (23%), Positives = 123/315 (39%), Gaps = 65/315 (20%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
             + F       R++A+  G++  T       L    + I +             DYL G
Sbjct: 45  PQNNFQACLGNLRSQAISAGVNGSTYDRYTQSLTPDYSVIDKLNYQPE-FSTPIWDYLSG 103

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
           L   E +  G      ++ +L  ++  YGVP   ++A+WG+E++FG+  G  PLL  L T
Sbjct: 104 LVDEERVQAGRTKLAQHAEVLKRVEAAYGVPAETVVAVWGVESNFGDISGSYPLLQALGT 163

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADED 216
           L+ + RR  +F  +FF A+ ++++G +      G+  G  G  QF+P    + A+D D D
Sbjct: 164 LSCEGRRQSYFRGEFFAAMRILQRGDLREEQLKGSWAGAFGHTQFMPSTYEELAVDFDGD 223

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGY-------------QPGEKNFAI------- 256
           G+ DLV S IDA+AS A FL K GW     +               G +N          
Sbjct: 224 GRRDLVSSTIDALASTANFLKKRGWQTGMPWGFEVKLPSGFSAQGEGRRNKKALNSWVNR 283

Query: 257 ------------------------------------------LKHWNASLNYNKTIAYIA 274
                                                     +  +NA+ +Y   IA+++
Sbjct: 284 GLTRTDGTALVQGNLSGSTPAGLMMPAGENGPAFLVFKNFDAIYSYNAAESYGLAIAHLS 343

Query: 275 AHIDG-VPIGKGYDT 288
             + G  P    + T
Sbjct: 344 DRLQGQGPFLTAWPT 358


>gi|160897467|ref|YP_001563049.1| lytic murein transglycosylase [Delftia acidovorans SPH-1]
 gi|160363051|gb|ABX34664.1| lytic murein transglycosylase [Delftia acidovorans SPH-1]
          Length = 457

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 75/235 (31%), Positives = 111/235 (47%), Gaps = 3/235 (1%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTAD-RFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
            P    A  QP+ AT            F  WK     +A+  G+S KT +          
Sbjct: 62  APTAPVAPVQPEPATAPDAAQQAEATSFEAWKRDFARKALDAGISEKTVRSALEPARLQR 121

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
             +  DR        +   YLD   S++ IAQG A  +  +  L +  + YGVP  ++ A
Sbjct: 122 RAVQLDRSQPE-FTRTPWQYLDSAVSAQRIAQGRAKLREAAAPLQSASQRYGVPAEVIAA 180

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATF 193
           +WG+E++FG   G  P +  LATLA+D RRA +  ++   AL ++  G I +  + G+  
Sbjct: 181 IWGMESNFGGNFGNFPTVDALATLAFDGRRAAWAQKELLAALRIIDNGDIDAAHMIGSWA 240

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           G +G  QFLP   + YA+DAD DG+ D+  S  D  AS A +LA  GW     + 
Sbjct: 241 GAMGHTQFLPSVFLAYAVDADGDGRRDIWGSLPDVTASTANYLAHSGWKTGEPWG 295



 Score = 44.1 bits (102), Expect = 0.022,   Method: Composition-based stats.
 Identities = 8/30 (26%), Positives = 15/30 (50%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
            NF  +  +N S+NY   +  ++  + G P
Sbjct: 356 ANFRTILRYNNSVNYALGVGLLSQQLAGGP 385


>gi|254496664|ref|ZP_05109527.1| lytic murein transglycosylase [Legionella drancourtii LLAP12]
 gi|254354092|gb|EET12764.1| lytic murein transglycosylase [Legionella drancourtii LLAP12]
          Length = 355

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 80/299 (26%), Positives = 123/299 (41%), Gaps = 57/299 (19%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           +     + +W +  R  A+R+G+SP+     FA +      I    +      ++F  Y 
Sbjct: 51  AFAQQNWNQWVADVRTEALRQGISPEIFDSAFAGIHEPSHQIKGLLRSQPEHRLTFSKYR 110

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
                +  IA G    K N  +L ++ K+YGV P  +++ WG+ET +G  MG  P++  L
Sbjct: 111 STRVDNYRIAIGRKEFKKNRAVLEDVAKKYGVNPCFIVSFWGMETSYGTYMGNFPVIKAL 170

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLAYD  R  FF ++ F AL ++ +G +S +   G   G  GQ QFLP + VKYA+D D
Sbjct: 171 ATLAYDSNRKDFFRKELFIALRILNEGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYD 230

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG---EKNF----------AILKHW- 260
            DG  D+ +S  D  AS A ++ + GW     +       KNF            +  W 
Sbjct: 231 GDGHRDIWRSKPDVFASIANYMKQNGWQTGEPWAIQVKLPKNFDMAMEGKTIVKPVSEWG 290

Query: 261 ------------------------------------------NASLNYNKTIAYIAAHI 277
                                                     N S+ Y   + Y+A  I
Sbjct: 291 SLGVRTEDGQALPYQNLQASIVQPLGGPTFMTFPNYKMILHYNNSIYYAGAVGYLADKI 349


>gi|260768982|ref|ZP_05877916.1| membrane-bound lytic murein transglycosylase B [Vibrio furnissii
           CIP 102972]
 gi|260617012|gb|EEX42197.1| membrane-bound lytic murein transglycosylase B [Vibrio furnissii
           CIP 102972]
          Length = 323

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/281 (25%), Positives = 136/281 (48%), Gaps = 22/281 (7%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++  +L   ++ P  A            F ++    + +A +EG+S +     F D+++ 
Sbjct: 4   LLSVILGFTLSAPVLA--------NDLSFEQYVEGLKQQARQEGISEQILSDAFHDVQFK 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  DR       ++  +Y+     +  + Q  AL + +   L  + K YGV P  ++
Sbjct: 56  PRAVVADRNQPEK-KLTLDEYIPRAVPAWKVNQAQALYEKHYDELQRIGKAYGVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGAT 192
           ALWG+E++FG  MG+  ++  L+T+AY+ RR +FF ++   AL ++++G I++    G+ 
Sbjct: 115 ALWGVESNFGAHMGRYKVIDALSTMAYEGRREEFFRKETMAALQILQQGHINAEDMKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G +GQ QF+P + + +A D D DGK D+  S  D  AS A +L++ GW     +    +
Sbjct: 175 AGAMGQCQFMPSSFLAFAADGDGDGKKDIWGSKEDVFASTANYLSQSGWDDKYTWG---R 231

Query: 253 NFAILKHWNAS--------LNYNKTIAYIA-AHIDGVPIGK 284
              I K ++ +          Y +  + +     DG P+ K
Sbjct: 232 QVKIPKGFDHALEGRQAEKGKYLQEWSKLGITRYDGQPLPK 272



 Score = 39.5 bits (90), Expect = 0.62,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 295 YNNYNVLMKWNRSYYFALAVSHLADRIK 322


>gi|118590195|ref|ZP_01547598.1| putative transglycosylase transmembrane protein [Stappia aggregata
           IAM 12614]
 gi|118437167|gb|EAV43805.1| putative transglycosylase transmembrane protein [Stappia aggregata
           IAM 12614]
          Length = 416

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 82/334 (24%), Positives = 130/334 (38%), Gaps = 58/334 (17%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
           + + S L     + A A+     AT           F ++ +  +  A+ +G+S   A  
Sbjct: 17  FFMTSRLRFTPKLAATALAGFWLATAPAQAQQCGGDFRQFLAGVKQEALAKGLSANAADQ 76

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
             A  +     ++RDR       ++F D+   + S   +  G A  K  + +  + + EY
Sbjct: 77  TLAGAQVDRKVLSRDRAQG-VFKMTFLDFSQRVISGYRMKNGAANMKKYANVFQHTESEY 135

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GVP  ++ A W LET FG   G    ++ LATLA+DCRR + F  Q   A+++V+ G + 
Sbjct: 136 GVPAPVITAFWALETDFGAVQGDFNTVNALATLAHDCRRPELFRPQLIAAIEMVQHGDLD 195

Query: 186 SHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
                GA  GEIG  Q LP +++K+  D D DG + L +S  DAI +A  F+  LGW + 
Sbjct: 196 PRTTTGAWAGEIGMVQMLPEDIIKFGRDGDGDGHVKLKESAADAILTAGAFIQHLGWRRG 255

Query: 245 AGYQPG--------------------------------------------------EKNF 254
             +                                                        F
Sbjct: 256 EPWLQEVKVTQNLNWAESGLDKTKTGAQWAALGVQPRWGQIAGNLPASLLLPQGRKGPAF 315

Query: 255 AILKHW------NASLNYNKTIAYIAAHIDGVPI 282
               ++      N S  Y  T AY A  + G P+
Sbjct: 316 LAYPNYNIYLEWNQSFVYTTTAAYFATRLAGAPV 349


>gi|163856176|ref|YP_001630474.1| putative peptidoglycan-binding protein [Bordetella petrii DSM
           12804]
 gi|163259904|emb|CAP42205.1| putative peptidoglycan-binding protein [Bordetella petrii]
          Length = 421

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 74/304 (24%), Positives = 122/304 (40%), Gaps = 61/304 (20%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
             +  R +A  +G+S  T       L    + IA              DYL  L   E I
Sbjct: 40  CLAQLRGQAASQGVSASTFNTYTQGLAPDMSVIASLDAQPE-FKTPIWDYLAALVDDERI 98

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           A G    +     L   + ++GV P  ++A+WG+E++FG+ +G  PLL++L+TL+   RR
Sbjct: 99  ADGRQALQQWQPELARAQAQFGVDPATVVAVWGVESNFGKKLGGRPLLTSLSTLSCFGRR 158

Query: 165 AKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             +F  +FF  L ++++  +      G+  G  GQ QF+P   ++ A+D D DG+ DLV 
Sbjct: 159 QSYFRGEFFATLKIIEQEHVRPERLNGSWAGAFGQTQFMPSTYLRLAVDFDGDGRRDLVD 218

Query: 224 SNIDAIASAAKFLAKLGWTKCAGYQ-------------PGEKNFAI-------------- 256
           S  DA+AS A FL + GW     +               G +N                 
Sbjct: 219 SVPDALASTANFLKRAGWQSGLPWGFEVALPAGLDIRIAGRRNKRPMSAWAAQGVKRVDG 278

Query: 257 -------------------------------LKHWNASLNYNKTIAYIAAHIDGV-PIGK 284
                                          +  +NA+ +Y   IA+++  + G  P  +
Sbjct: 279 QPLPAGDTPAGLLLPAGPQGPAFLVTRNFDAVYSYNAAESYALAIAHLSDRLRGAGPFVR 338

Query: 285 GYDT 288
            + T
Sbjct: 339 AWPT 342


>gi|226329917|ref|ZP_03805435.1| hypothetical protein PROPEN_03830 [Proteus penneri ATCC 35198]
 gi|225200712|gb|EEG83066.1| hypothetical protein PROPEN_03830 [Proteus penneri ATCC 35198]
          Length = 376

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/226 (31%), Positives = 119/226 (52%), Gaps = 3/226 (1%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
                     + T+ +F  +  A + +A + G  P+T    F++  +++  I  DR    
Sbjct: 53  ASLEQAFPKETRTSAQFPAYVDALKLKAAQLGYKPETIDFAFSEAHFIERVIKSDRNQPE 112

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
              ++   YL  + ++  ++QG  L + +   L  + K+YGVP   ++ALWGLE+ FG+ 
Sbjct: 113 K-RITLDVYLPRIVTNGRLSQGAKLYQEHQDTLEQISKKYGVPANYIVALWGLESGFGKV 171

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS--HALGATFGEIGQFQFLP 203
            GK  ++S LATLA++ RR   FT Q   AL+++++G I       G+  G +GQ QF+P
Sbjct: 172 QGKEDVVSALATLAFEGRREALFTRQLMAALEIIEEGHIPQGQRLKGSWAGAMGQTQFMP 231

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
            + + YA D + DGKID+  +  DA ASAA +LA  GW     +  
Sbjct: 232 SSFLTYAADGNGDGKIDIWNTQEDAFASAANYLATEGWESGLPWGE 277


>gi|126463546|ref|YP_001044660.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105210|gb|ABN77888.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17029]
          Length = 419

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 86/305 (28%), Positives = 123/305 (40%), Gaps = 59/305 (19%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
                 W    R RA+  G+ P T    F DL Y    +ARDR        +  DYLD  
Sbjct: 46  QAGLEAWVIQFRPRALAAGIRPTTFAAAFRDLRYDADAVARDRNQAE-FNRTLWDYLDSA 104

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S   IA G A    +  LL  ++  YGVP  I++A+WG+ET +G   G  PL+  LATL
Sbjct: 105 VSETRIAGGRAALVQHGALLGRIEARYGVPKEIVVAVWGMETSYGTRRGDHPLVGALATL 164

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A+D RRA+FF EQ   AL ++  G +      G+  G +G  QF+P + + +A+D   DG
Sbjct: 165 AHDGRRARFFEEQLIAALKILDNGDVRPEAMTGSWAGAMGHTQFMPTSYLDFAVDFTGDG 224

Query: 218 KIDLV-KSNIDAIASAAKFLAKLGWTKCAGY-------------QPGEKNFAILKHW--- 260
           + D+      DA+AS A +LAK GW +   +             Q G+        W   
Sbjct: 225 RRDIWSDDPSDALASTAAYLAKSGWRRGEPWGVEVRLPAGFDFAQSGKSLRQPAARWEAL 284

Query: 261 ----------------------------------------NASLNYNKTIAYIAAHIDGV 280
                                                   N +  Y   + ++A  + G 
Sbjct: 285 GVRRVDGSPLPAGEAALLLPAGAQGAAFLIYPNFRAIARYNPADAYVIGVGHLADRLKGA 344

Query: 281 PIGKG 285
           P   G
Sbjct: 345 PAIAG 349


>gi|212711896|ref|ZP_03320024.1| hypothetical protein PROVALCAL_02971 [Providencia alcalifaciens DSM
           30120]
 gi|212685418|gb|EEB44946.1| hypothetical protein PROVALCAL_02971 [Providencia alcalifaciens DSM
           30120]
          Length = 367

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 66/225 (29%), Positives = 111/225 (49%), Gaps = 3/225 (1%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
                  I      +F  +    +  A+ +G+   T    FA++ +L+  +  D+     
Sbjct: 50  ALDKAFPIEQREPSQFPAYVELLKQHAIAQGIKQSTIDRGFANIYFLERVVKADKGQPEK 109

Query: 87  P-PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
              V+   YL  +     I  G+     N  +L  + ++YGVPP  +++LWGLE+ FG +
Sbjct: 110 RATVTLASYLKNVLPQSRINMGVEKYYENQVVLNAVSQKYGVPPQYIVSLWGLESGFGRS 169

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL--GATFGEIGQFQFLP 203
            GK  ++S LATL+++ RR   F++Q   AL+++ KG I       G+  G +GQ QF+P
Sbjct: 170 QGKEDVISALATLSFEGRREALFSKQLLAALEIMDKGYIPEDQQLKGSWAGAMGQSQFMP 229

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            + + YA D D DGK+D+  +  D  AS A +L+  GW     + 
Sbjct: 230 TSYLSYAADGDGDGKMDIWNNKADVFASIANYLSTEGWQSALPWG 274


>gi|256263591|ref|ZP_05466123.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|263093640|gb|EEZ17645.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
          Length = 410

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 80/347 (23%), Positives = 121/347 (34%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L + L     +                        +    FG+W       A 
Sbjct: 1   MKIIASVLAAALFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTREAR 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 61  EAGVGEKGITE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISEARLKKGQENLVKY 118

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 119 ADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 178

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A +
Sbjct: 179 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGR 238

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 239 MLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 298

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 299 LLPLGRKGPAFLSYLNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 345


>gi|152989315|ref|YP_001349562.1| transglycolase [Pseudomonas aeruginosa PA7]
 gi|150964473|gb|ABR86498.1| probable transglycolase [Pseudomonas aeruginosa PA7]
          Length = 398

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 72/303 (23%), Positives = 118/303 (38%), Gaps = 60/303 (19%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
             A  F    +  + +A  +G+S  +     + L+   + +               DYL 
Sbjct: 20  PDASTFPSCLAGLQKKAQAQGISADSYARFTSGLQADLSVLELLDAQPE-FTTPLWDYLA 78

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   GK PLL++L+
Sbjct: 79  GLVDEQRVSDGKAMLAQHDKLLDQVVARYGVDKYTVVAVWGVESDYGRIFGKRPLLTSLS 138

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TL+   RR  FF  +F   L L++ G I  +   G+  G  G  QF+P    + A+D D 
Sbjct: 139 TLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPSTYARIAVDFDG 198

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ--------------------------- 248
           DG+ DLV S  DA+ S A +L K GW     +                            
Sbjct: 199 DGRRDLVGSVPDALGSTANYLKKAGWRTGQPWGYEVKVPADFPAGLAGRGKRQPLSAWVA 258

Query: 249 -----------PGEKNFAIL--------------------KHWNASLNYNKTIAYIAAHI 277
                      PG    A +                      +NA+ +Y   IA ++  +
Sbjct: 259 RGVKRVDGQPLPGGDEKAAILLPTGAQGPAFLVYRNYDAIYSYNAAESYALAIALLSDRL 318

Query: 278 DGV 280
            G 
Sbjct: 319 RGG 321


>gi|226952806|ref|ZP_03823270.1| membrane-bound lytic murein transglycosylase [Acinetobacter sp.
           ATCC 27244]
 gi|226836427|gb|EEH68810.1| membrane-bound lytic murein transglycosylase [Acinetobacter sp.
           ATCC 27244]
          Length = 432

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 78/306 (25%), Positives = 130/306 (42%), Gaps = 32/306 (10%)

Query: 2   SFKKYLLISLLMMVYPMLA--------QAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
            F  +L  +LL + Y   A         + T    A +          F    +  R++A
Sbjct: 3   RFPLFLGTALLTLSYNAHAELIINGAKVSTTTTTPAVSNTSTFSPTRDFQSCIAGLRSQA 62

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+S  +      +L    + I R             DYL GL  +E +  G      
Sbjct: 63  IASGVSAASFDRYTQNLSADYSVIDRLNYQPE-FSTPIWDYLSGLVDNERVQAGQQKLAQ 121

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           +  +L  +++ YGVP   ++A+WG+E+++G+  G+ PLL  L TL+ + RR  +F  +FF
Sbjct: 122 HRDVLRRVEQAYGVPAETVVAVWGVESNYGDISGRYPLLQALGTLSCEGRRQSYFRGEFF 181

Query: 174 YALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             + ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS 
Sbjct: 182 ATMRILQRGDVTQDQLYGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSIPDALAST 241

Query: 233 AKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           A FL + GW     +                 +N   L +W         IA      DG
Sbjct: 242 ANFLKRAGWQTGMPWGFEVKIPQGMSISGESRRNKKSLNNW---------IAQGVTRADG 292

Query: 280 VPIGKG 285
             + +G
Sbjct: 293 TALIQG 298



 Score = 47.2 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 20/47 (42%), Gaps = 1/47 (2%)

Query: 243 KCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
                    +NF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 314 ANGPLFLVFRNFDAIYSYNAAESYGLAIAHLSDRLRGGTPFLTAWPT 360


>gi|84394408|ref|ZP_00993126.1| lytic murein transglycosylase, putative [Vibrio splendidus 12B01]
 gi|84374977|gb|EAP91906.1| lytic murein transglycosylase, putative [Vibrio splendidus 12B01]
          Length = 332

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 111/245 (45%), Gaps = 9/245 (3%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
                ++L +   +L  ++T       +         F ++    + +   EG+S     
Sbjct: 2   SKFSKTILAVSALLLGNSLTIGSVQAEELS-------FEQYVEKLKQQGREEGISEAIID 54

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  + +    +  D+       ++  +Y+        + Q  +L K +   L  +  E
Sbjct: 55  EAFDGVTFKPRAVKADKNQPEK-KLTLDEYIPRAVPDWKVKQARSLYKKHYTALKRIGDE 113

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGV P  ++ALWG+E++FG+  G   ++  L T+AY+ RR  FF  +   AL ++ +G I
Sbjct: 114 YGVQPRFIVALWGVESNFGKFTGNYSVIDALTTMAYEGRREAFFRSEAMAALKILDQGHI 173

Query: 185 SS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +     G+  G +GQ QF+P + + YA D   DGK D+  +  D  ASAA +L++ GW  
Sbjct: 174 APKEMKGSWAGAMGQPQFMPSSFLAYAADGSGDGKKDIWGTEEDVFASAANYLSQSGWDD 233

Query: 244 CAGYQ 248
              + 
Sbjct: 234 KYTWG 238


>gi|62290341|ref|YP_222134.1| transglycolase [Brucella abortus bv. 1 str. 9-941]
 gi|82700264|ref|YP_414838.1| peptidoglycan binding domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|189024572|ref|YP_001935340.1| peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|254689640|ref|ZP_05152894.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 6
           str. 870]
 gi|254730671|ref|ZP_05189249.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 4
           str. 292]
 gi|256045076|ref|ZP_05447977.1| Putative peptidoglycan binding domain 1 [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256114005|ref|ZP_05454782.1| Putative peptidoglycan binding domain 1 [Brucella melitensis bv. 3
           str. Ether]
 gi|260546881|ref|ZP_05822620.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260565325|ref|ZP_05835809.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|260884183|ref|ZP_05895797.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|265991505|ref|ZP_06104062.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995343|ref|ZP_06107900.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|297248727|ref|ZP_06932445.1| peptidoglycan binding domain-containing protein [Brucella abortus
           bv. 5 str. B3196]
 gi|62196473|gb|AAX74773.1| hypothetical transglycolase [Brucella abortus bv. 1 str. 9-941]
 gi|82616365|emb|CAJ11422.1| Putative peptidoglycan binding domain 1 [Brucella melitensis biovar
           Abortus 2308]
 gi|189020144|gb|ACD72866.1| Putative peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|260095931|gb|EEW79808.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260151393|gb|EEW86487.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|260873711|gb|EEX80780.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|262766456|gb|EEZ12245.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002289|gb|EEZ14864.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|297175896|gb|EFH35243.1| peptidoglycan binding domain-containing protein [Brucella abortus
           bv. 5 str. B3196]
 gi|326409471|gb|ADZ66536.1| Putative peptidoglycan binding domain 1 [Brucella melitensis M28]
 gi|326539178|gb|ADZ87393.1| lytic murein transglycosylase [Brucella melitensis M5-90]
          Length = 410

 Score =  187 bits (475), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 80/347 (23%), Positives = 121/347 (34%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L + L     +                        +    FG+W       A 
Sbjct: 1   MKIIASVLAAALFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTREAR 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 61  EAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISEARLKKGQENLVKY 118

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 119 ADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 178

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A +
Sbjct: 179 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGR 238

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 239 MLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 298

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 299 LLPLGRKGPAFLSYLNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 345


>gi|222833254|gb|EEE71731.1| predicted protein [Populus trichocarpa]
          Length = 398

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/235 (31%), Positives = 111/235 (47%), Gaps = 3/235 (1%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTAD-RFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
            P    A  QP+ AT            F  WK     +A+  G+S KT +          
Sbjct: 3   APTAPVAPVQPEPATAPDAAQQAEATSFEAWKRDFARKALDAGISEKTVRSALEPARLQR 62

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
             +  DR        +   YLD   S++ IAQG A  +  +  L +  + YGVP  ++ A
Sbjct: 63  RAVQLDRSQPE-FTRTPWQYLDSAVSAQRIAQGRAKLREAAAPLQSASQRYGVPAEVIAA 121

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATF 193
           +WG+E++FG   G  P +  LATLA+D RRA +  ++   AL ++  G I +  + G+  
Sbjct: 122 IWGMESNFGGNFGNFPTVDALATLAFDGRRAAWAQKELLAALRIIDNGDIDAAHMIGSWA 181

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           G +G  QFLP   + YA+DAD DG+ D+  S  D  AS A +LA  GW     + 
Sbjct: 182 GAMGHTQFLPSVFLAYAVDADGDGRRDIWGSLPDVTASTANYLAHSGWKTGEPWG 236



 Score = 44.1 bits (102), Expect = 0.023,   Method: Composition-based stats.
 Identities = 8/30 (26%), Positives = 15/30 (50%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
            NF  +  +N S+NY   +  ++  + G P
Sbjct: 297 ANFRTILRYNNSVNYALGVGLLSQQLAGGP 326


>gi|86146077|ref|ZP_01064403.1| lytic murein transglycosylase, putative [Vibrio sp. MED222]
 gi|85836024|gb|EAQ54156.1| lytic murein transglycosylase, putative [Vibrio sp. MED222]
          Length = 332

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 61/245 (24%), Positives = 112/245 (45%), Gaps = 9/245 (3%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
                ++L +   +L  ++T       +         F ++    + +   EG+S     
Sbjct: 2   SKFSKTILAVSALLLGNSLTIGSVQAEELS-------FEQYVEKLKQQGRAEGISETIID 54

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  + +    +  D+       ++  +Y+        + Q  +L K +   L  +  E
Sbjct: 55  QAFDGVTFKPRAVKADKNQPEK-KLTLDEYIPRAVPDWKVKQARSLYKKHYSALKRIGDE 113

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGV P  ++ALWG+E++FG+  G   ++  L T+AY+ RR  FF  +   AL ++ +G I
Sbjct: 114 YGVQPRFIVALWGVESNFGKFTGNYSVIDALTTMAYEGRREAFFRSEAMAALKILDQGHI 173

Query: 185 SS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +     G+  G +GQ QF+P + + YA D + DGK D+  +  D  ASAA +L++ GW  
Sbjct: 174 APQEMKGSWAGAMGQPQFMPSSFLAYAADGNGDGKKDIWGTEEDVFASAANYLSQSGWDD 233

Query: 244 CAGYQ 248
              + 
Sbjct: 234 KYTWG 238


>gi|260772437|ref|ZP_05881353.1| membrane-bound lytic murein transglycosylase B [Vibrio
           metschnikovii CIP 69.14]
 gi|260611576|gb|EEX36779.1| membrane-bound lytic murein transglycosylase B [Vibrio
           metschnikovii CIP 69.14]
          Length = 302

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 116/219 (52%), Gaps = 5/219 (2%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
            F ++    + +A +EG+S +     FA++EY    +  DR       ++  +Y+     
Sbjct: 2   SFEQYLEGLKQQARQEGISEQILAEAFANVEYRPRAVTADRNQPER-RLTLDEYIPRAVP 60

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + Q  AL + +   L  + K+YGV P  ++ALWG+E++FG   G  P++  L+T+AY
Sbjct: 61  DWKVKQAQALYEKHYDELQRIGKQYGVQPRFIVALWGVESNFGSFTGNFPVIDALSTMAY 120

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           D RR +FF ++   AL ++++G I+   + G+  G +GQ QF+P + + +A D D DGK 
Sbjct: 121 DGRREEFFRKETMAALQILQQGHITVDEMKGSWAGAMGQCQFMPSSFLAFAADGDGDGKK 180

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK---NFA 255
           D+  +  D  AS A +L+K GW     +    K   NF 
Sbjct: 181 DIWGTKADVFASTANYLSKSGWDDRYTWGRQVKIPANFD 219



 Score = 38.7 bits (88), Expect = 1.00,   Method: Composition-based stats.
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             N+ +L  WN S  +   ++++A  I 
Sbjct: 274 YNNYNVLMKWNRSHYFAVAVSHLADRIK 301


>gi|254710487|ref|ZP_05172298.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           B2/94]
 gi|256369864|ref|YP_003107375.1| lytic murein transglycosylase [Brucella microti CCM 4915]
 gi|260169117|ref|ZP_05755928.1| lytic murein transglycosylase [Brucella sp. F5/99]
 gi|261325511|ref|ZP_05964708.1| lytic Murein transglycosylase [Brucella neotomae 5K33]
 gi|261758626|ref|ZP_06002335.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|265989092|ref|ZP_06101649.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|294852773|ref|ZP_06793446.1| peptidoglycan binding domain-containing protein [Brucella sp. NVSL
           07-0026]
 gi|256000027|gb|ACU48426.1| lytic murein transglycosylase [Brucella microti CCM 4915]
 gi|261301491|gb|EEY04988.1| lytic Murein transglycosylase [Brucella neotomae 5K33]
 gi|261738610|gb|EEY26606.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|264661289|gb|EEZ31550.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|294821362|gb|EFG38361.1| peptidoglycan binding domain-containing protein [Brucella sp. NVSL
           07-0026]
          Length = 410

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/347 (23%), Positives = 121/347 (34%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L + L     +                        +    FG+W       A 
Sbjct: 1   MKIIASVLAAALFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTREAR 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 61  EAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISEARLKKGQENLVKY 118

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 119 ADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 178

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A +
Sbjct: 179 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGR 238

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 239 MLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 298

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 299 LLPLGRKGPAFLSYPNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 345


>gi|54295756|ref|YP_128171.1| hypothetical protein lpl2846 [Legionella pneumophila str. Lens]
 gi|53755588|emb|CAH17090.1| hypothetical protein lpl2846 [Legionella pneumophila str. Lens]
          Length = 320

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 77/296 (26%), Positives = 122/296 (41%), Gaps = 57/296 (19%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           +  + +W +  R  A+++G+ P      FA +      I    +      ++F  Y +  
Sbjct: 21  SQSWNQWVAGVREEALQQGIPPGLFDEAFAGIHEPSRKIKGFLRSQPEHRLTFMKYRNTR 80

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           + +  I  G    K N  +L  + ++YGV P  +++ WG+ET +G  MG  P+++ LATL
Sbjct: 81  ADNYRIVIGRKEYKRNKEILEEIAQQYGVNPCFIVSFWGMETSYGSYMGNFPVINALATL 140

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R  FF ++ F AL ++K G +S +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 141 AYDSNRKDFFRKELFLALHILKGGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 200

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP---------------------------- 249
           + D+ KS  D  AS A ++ + GW     +                              
Sbjct: 201 RKDIWKSKPDVFASIANYMKQNGWQAGEPWAIQVKLPAKFDMKLEGKSIVKPVSEWNALG 260

Query: 250 ----------------------GEKNFAI------LKHWNASLNYNKTIAYIAAHI 277
                                 G   F        +  +N S+ Y   I Y+A  I
Sbjct: 261 VRTESGEPLPYQNLQASIVQPYGGPTFLAFPNYKMILRYNNSIYYAGAIGYMADKI 316


>gi|319406116|emb|CBI79746.1| peptidoglycan-binding protein [Bartonella sp. AR 15-3]
          Length = 418

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 69/345 (20%), Positives = 127/345 (36%), Gaps = 64/345 (18%)

Query: 1   MSFKKYLLISL----LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVRE 56
           M   K+  +      +  V+ ++                +    RF  W +  +  A+  
Sbjct: 1   MKITKFNTLFSSGKNINRVFLLIGLVSIFTILPIAFSSLTYADSRFQHWINEFKKTALAN 60

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
            +SP T    F  +  +D  +               +Y D     + I +G    K   +
Sbjct: 61  NISPSTFDIAFKTINTIDREVLEKAAYQPEFVDMPWEYFDNRIHDDAIIEGKQQAKKWQQ 120

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGK----TPLLSTLATLAY-DCRRAKFFTEQ 171
            L  ++K +GV   +L+A+W +E+++G+ +         + +LATLAY D +R K+   Q
Sbjct: 121 WLQKIEKRFGVNRNLLLAIWSMESNYGKILTNKGVMRDTIRSLATLAYADQKRQKYARTQ 180

Query: 172 FFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
              A+ +++ G I     +G+  G +G  QF+P + + YAID D +G+ D+  S  D++A
Sbjct: 181 LIAAMKILQSGEIHRSQLVGSWAGALGHTQFIPSSYLIYAIDMDGNGRSDIWNSIPDSLA 240

Query: 231 SAAKFLAKLGWTKCAGY------------------------------------------- 247
           +AA  L + GW     +                                           
Sbjct: 241 TAANLLHRNGWQSNLTWGIEVKLPNNKKLPENWLSFKQWKELGVQHAHKKPFPSLSEQAI 300

Query: 248 -----QPGEKNFAI------LKHWNASLNYNKTIAYIAAHIDGVP 281
                 P    F +      +K +N +  Y   +  +A  I G P
Sbjct: 301 LKFPDGPKGPAFLVTKNFFVIKRYNNADRYAFAVGLLADRIAGHP 345


>gi|114327734|ref|YP_744891.1| membrane-bound lytic murein transglycosylase B [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315908|gb|ABI61968.1| membrane-bound lytic murein transglycosylase B [Granulibacter
           bethesdensis CGDNIH1]
          Length = 331

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 74/332 (22%), Positives = 123/332 (37%), Gaps = 62/332 (18%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
              +     +     A  +               A  F  + +  +A   R G+S     
Sbjct: 1   MMCIPRRSFLSALPAAACLGAAGVVF--PSNQAEAQDFRGFIAGVKAEGRRAGISDTILA 58

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
                L      I  DRK      ++++ Y     S + IA G      N++LL+ ++  
Sbjct: 59  QALNTLSPNTRVIELDRKQPE-FTMTWERYRSTRLSEKRIAAGREQAARNAQLLMQVENA 117

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGV  G+++ +WGLET++G   G   ++   ATLA++ RRA FF  +   AL ++  G I
Sbjct: 118 YGVDRGVILGIWGLETNYGAFQGGFNVIEATATLAWEGRRASFFRAELMAALKILNHGDI 177

Query: 185 S-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +     G+  G +GQ QF+P +  +YA+D D DG+ ++  S  D +AS A +L K GW +
Sbjct: 178 TMPRMQGSYAGAMGQPQFMPTSFNRYAVDFDGDGRRNIWDSVPDVLASIANYLLKSGWHQ 237

Query: 244 CA----------------------------------------------------GYQPG- 250
                                                                    PG 
Sbjct: 238 GQPWGTQAIAPATIDPSVAGRENRLSLAEWARLGVTLGNGQRLPASPLPASLILPDGPGG 297

Query: 251 -----EKNFAILKHWNASLNYNKTIAYIAAHI 277
                  NF +++ +N S  Y   +  I   +
Sbjct: 298 EAFLAYPNFNVIRRYNPSDFYAIAVGMIGDMV 329


>gi|325918692|ref|ZP_08180790.1| lytic murein transglycosylase [Xanthomonas vesicatoria ATCC 35937]
 gi|325535084|gb|EGD06982.1| lytic murein transglycosylase [Xanthomonas vesicatoria ATCC 35937]
          Length = 423

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 78/327 (23%), Positives = 123/327 (37%), Gaps = 64/327 (19%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
            +  +    + P  A  Q   +  +  F +W    R RA+  G+   T    FA +    
Sbjct: 25  AFAQVTAPSSAPPDAAEQNPAATES--FEQWLVDFRQRALAAGIETTTLDTAFAGVTADP 82

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
           +  A D++          +YLD   +   I QG  L  +   L   L+++YGV P IL A
Sbjct: 83  SVHALDQQQPE-FTRYLWEYLDDRVTPSSIQQGQQLLVSKRTLFEQLQRQYGVDPRILTA 141

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD--LVKKGVISSHALGAT 192
           +W +E+ +G  +G   ++ +LATLA+  RR ++   Q   AL     +KGV  S  +G+ 
Sbjct: 142 IWSMESQYGAQIGDRYVIRSLATLAHSGRRTRYGNTQLLAALQILQTEKGVDRSQLVGSW 201

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------------ 240
            G +GQ QF+P     YA+DAD D   D+  S+ D++ SAA +L K              
Sbjct: 202 AGAMGQTQFIPSTYRDYAVDADGDHTRDVWHSSADSLGSAANYLNKSNWNSRLPWGQEVR 261

Query: 241 --------------------WTK------CAGYQPGE---------------------KN 253
                               W +           P                        N
Sbjct: 262 LAADFDYAQADMTIKKTVADWQRQGVLCAGKPIAPALAQEQASVLLPTGYRGPAFLVFDN 321

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDGV 280
           F  +  +N S  Y   +  +A    G 
Sbjct: 322 FRSILRYNNSTAYALAVGLLADGYAGG 348


>gi|294648728|ref|ZP_06726188.1| lytic murein transglycosylase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292825403|gb|EFF84146.1| lytic murein transglycosylase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 432

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 72/286 (25%), Positives = 123/286 (43%), Gaps = 24/286 (8%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++      + T    A +          F    +  R++A+  G+S  +      +L   
Sbjct: 23  LIINGAKVSTTTTTPAVSNTSTFSPTRDFQSCIAGLRSQAIASGVSAASFDRYTQNLSAD 82

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
            + I R             DYL GL  +E +  G      +  +L  +++ YGVP   ++
Sbjct: 83  YSVIDRLNYQPE-FSTPIWDYLSGLVDNERVQAGQQKLAQHRDVLRRVEQAYGVPAETVV 141

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGAT 192
           A+WG+E+++G+  G+ PLL  L TL+ + RR  +F  +FF  + ++++G ++     G+ 
Sbjct: 142 AVWGVESNYGDISGRYPLLQALGTLSCEGRRQSYFRGEFFATMRILQRGDVTQDQLYGSW 201

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY----- 247
            G  G  QF+P    + A+D D DG+ DLV S  DA+AS A FL + GW     +     
Sbjct: 202 AGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSIPDALASTANFLKRAGWQTGMPWGFEVK 261

Query: 248 --------QPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
                       +N   L +W         IA      DG  + +G
Sbjct: 262 IPQGMSISGESRRNKKSLNNW---------IAQGVTRADGTALIQG 298



 Score = 47.2 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 20/47 (42%), Gaps = 1/47 (2%)

Query: 243 KCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
                    +NF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 314 ANGPLFLVFRNFDAIYSYNAAESYGLAIAHLSDRLRGGTPFLTAWPT 360


>gi|225852929|ref|YP_002733162.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|225641294|gb|ACO01208.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
          Length = 413

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/347 (23%), Positives = 121/347 (34%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L + L     +                        +    FG+W       A 
Sbjct: 4   MKIIASVLAAALFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTREAR 63

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 64  EAGVGEKGITE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISEARLKKGQENLVKY 121

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 122 ADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 181

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A +
Sbjct: 182 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGR 241

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 242 MLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 301

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 302 LLPLGRKGPAFLSYLNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 348


>gi|218708885|ref|YP_002416506.1| putative lytic murein transglycosylase [Vibrio splendidus LGP32]
 gi|218321904|emb|CAV17894.1| putative lytic murein transglycosylase [Vibrio splendidus LGP32]
          Length = 332

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 61/236 (25%), Positives = 108/236 (45%), Gaps = 2/236 (0%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
               +LA +      + T          F ++    + +   EG+S       F  + + 
Sbjct: 4   FSKTILAVSALLLVNSLTIGSVQAEELSFEQYVEKLKQQGRAEGISETIIDQAFDGVTFK 63

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
              +  D+       ++  +Y+        + Q  +L K +   L  +  EYGV P  ++
Sbjct: 64  PRAVKADKNQPEK-KLTLDEYIPRAVPDWKVKQARSLYKKHYSALKRIGDEYGVQPRFIV 122

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGAT 192
           ALWG+E++FG+  G   ++  L T+AY+ RR  FF  +   AL ++ +G I+     G+ 
Sbjct: 123 ALWGVESNFGKFTGNYSVIDALTTMAYEGRREAFFRSEAMAALKILDQGHIAPQEMKGSW 182

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            G +GQ QF+P + + YA D + DGK D+  +  D  ASAA +L++ GW     + 
Sbjct: 183 AGAMGQPQFMPSSFLAYAADGNGDGKKDIWGTEEDVFASAANYLSQSGWDDKYTWG 238


>gi|45441726|ref|NP_993265.1| putative lipoprotein [Yersinia pestis biovar Microtus str. 91001]
 gi|108807459|ref|YP_651375.1| putative lipoprotein [Yersinia pestis Antiqua]
 gi|108811720|ref|YP_647487.1| lipoprotein [Yersinia pestis Nepal516]
 gi|145598338|ref|YP_001162414.1| lipoprotein [Yersinia pestis Pestoides F]
 gi|149365990|ref|ZP_01888025.1| putative lipoprotein [Yersinia pestis CA88-4125]
 gi|166211197|ref|ZP_02237232.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167468173|ref|ZP_02332877.1| lytic murein transglycosylase [Yersinia pestis FV-1]
 gi|218929188|ref|YP_002347063.1| putative lipoprotein [Yersinia pestis CO92]
 gi|229894797|ref|ZP_04509977.1| putative lipoprotein [Yersinia pestis Pestoides A]
 gi|229897502|ref|ZP_04512658.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229898146|ref|ZP_04513295.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229902008|ref|ZP_04517129.1| putative lipoprotein [Yersinia pestis Nepal516]
 gi|45436588|gb|AAS62142.1| putative lipoprotein [Yersinia pestis biovar Microtus str. 91001]
 gi|108775368|gb|ABG17887.1| lipoprotein [Yersinia pestis Nepal516]
 gi|108779372|gb|ABG13430.1| putative lipoprotein [Yersinia pestis Antiqua]
 gi|115347799|emb|CAL20716.1| putative lipoprotein [Yersinia pestis CO92]
 gi|145210034|gb|ABP39441.1| lipoprotein [Yersinia pestis Pestoides F]
 gi|149292403|gb|EDM42477.1| putative lipoprotein [Yersinia pestis CA88-4125]
 gi|166208377|gb|EDR52857.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|229680904|gb|EEO76999.1| putative lipoprotein [Yersinia pestis Nepal516]
 gi|229688862|gb|EEO80929.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229693839|gb|EEO83888.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229702270|gb|EEO90289.1| putative lipoprotein [Yersinia pestis Pestoides A]
 gi|262365838|gb|ACY62395.1| putative lipoprotein [Yersinia pestis D182038]
          Length = 361

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 73/235 (31%), Positives = 119/235 (50%), Gaps = 2/235 (0%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            ML    T     T          +F  +    +A+A  +G + +T    FA++ ++D  
Sbjct: 39  SMLTPGATASSTPTMLSQQGRDPSQFPAYVEQLKAQARAKGYTTETLDTAFANIHFVDRV 98

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I  DR  +    ++  DYL  +   + I QG AL +     L  +  +YGVP   ++ALW
Sbjct: 99  IKSDRNQLEK-KITLDDYLTRVLPRKRIEQGRALYQRYQPQLSQVNAQYGVPGRYIVALW 157

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGE 195
           G+E+ FG+  GK  ++S L+TLA++ RR  FFT++   AL+++ +G +      G+  G 
Sbjct: 158 GMESAFGQIQGKEDVISALSTLAFEGRREAFFTKELMAALEIIHQGKVDDPQLRGSWAGA 217

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           +GQ QF+P + + Y  D D DGKID+  +  D  AS A +L+  GW    G+   
Sbjct: 218 MGQSQFMPSSFLTYGADGDSDGKIDIWNNIDDVFASTANYLSTQGWKSEQGWGQE 272


>gi|145299137|ref|YP_001141978.1| membrane-bound lytic murein transglycosylase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851909|gb|ABO90230.1| membrane-bound lytic murein transglycosylase [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 319

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 72/213 (33%), Positives = 112/213 (52%), Gaps = 2/213 (0%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
             +  F  +    +  A+  G+  +T    FAD+  ++  I  D+       V+   Y+ 
Sbjct: 19  QASPDFERYVIGLKQEALAAGIKAETVAAAFADIRVIEPAIKHDKNQPE-FKVTLDTYIP 77

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
                  + Q  AL + +  LL  +  EY V P  ++ALWG+ET+FG+  GK PL+S+LA
Sbjct: 78  RAVPQWKVNQARALYRQHLPLLTKIGAEYDVQPRFIVALWGVETNFGKLTGKFPLISSLA 137

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TLA+D RR  FF  Q F AL ++++G ++     G+  G +GQ QF+P + +KYA+D D 
Sbjct: 138 TLAWDGRREAFFKGQLFDALHIIEQGHVTPAAFKGSWAGAMGQVQFMPSSFLKYAVDQDG 197

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           DGK DL  +  D   SAA +L + GW     + 
Sbjct: 198 DGKKDLWGNLADVFGSAANYLHQNGWHGDETWG 230


>gi|322832725|ref|YP_004212752.1| lytic murein transglycosylase [Rahnella sp. Y9602]
 gi|321167926|gb|ADW73625.1| lytic murein transglycosylase [Rahnella sp. Y9602]
          Length = 391

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 82/267 (30%), Positives = 128/267 (47%), Gaps = 16/267 (5%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
              T+          F  +    +A+A+ +G+  +T    FA++ ++D  I  DR  +  
Sbjct: 47  SGKTSLAEQGRDPAEFPAYVEQLKAQALSQGIRQQTIDSTFANIHFVDRVINSDRNQLEK 106

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
             ++  DYL  +     I QG    ++N   L    + YGV P  ++ALW +E+ FG+  
Sbjct: 107 -KITLDDYLTRVLPEWKIKQGQEQLQSNLPALTKASERYGVQPQYIVALWAMESSFGKIQ 165

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           GK  + S LATLA++ RR  FFT++F  AL +V  G  +S  + G+  G +GQ QF+P +
Sbjct: 166 GKEDVFSALATLAFEGRREAFFTKEFMSALKIVDSGKATSDMMKGSWAGAMGQSQFMPSS 225

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK---NFA-ILKHW- 260
            + Y  D + DGKID+  +  D  AS A +LAK GW    G+    K   NF   L    
Sbjct: 226 YLTYGADGNGDGKIDIWANTDDVFASTANYLAKEGWKGDQGWGQEVKLPANFDGALSGLK 285

Query: 261 NA-----SLNYNKTIAYIAAHIDGVPI 282
           N      S    + +      +DG P+
Sbjct: 286 NNQMHPASYWQQRGV----TQVDGNPL 308


>gi|237815846|ref|ZP_04594843.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
 gi|237789144|gb|EEP63355.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
          Length = 413

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/347 (23%), Positives = 121/347 (34%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L + L     +                        +    FG+W       A 
Sbjct: 4   MKIIASVLAAALFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTREAR 63

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 64  EAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISEARLKKGQENLVKY 121

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 122 ADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 181

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A +
Sbjct: 182 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGR 241

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 242 MLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 301

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 302 LLPLGRKGPAFLSYLNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 348


>gi|22126116|ref|NP_669539.1| transglycosylase [Yersinia pestis KIM 10]
 gi|162420009|ref|YP_001606819.1| lytic murein transglycosylase [Yersinia pestis Angola]
 gi|165928356|ref|ZP_02224188.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939357|ref|ZP_02227905.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009157|ref|ZP_02230055.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167401500|ref|ZP_02306997.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420281|ref|ZP_02312034.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|21959075|gb|AAM85790.1|AE013826_2 putative transglycosylase [Yersinia pestis KIM 10]
 gi|162352824|gb|ABX86772.1| lytic murein transglycosylase [Yersinia pestis Angola]
 gi|165912698|gb|EDR31327.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165919639|gb|EDR36972.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991712|gb|EDR44013.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166961976|gb|EDR57997.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049196|gb|EDR60604.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
          Length = 362

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 73/235 (31%), Positives = 119/235 (50%), Gaps = 2/235 (0%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            ML    T     T          +F  +    +A+A  +G + +T    FA++ ++D  
Sbjct: 40  SMLTPGATASSTPTMLSQQGRDPSQFPAYVEQLKAQARAKGYTTETLDTAFANIHFVDRV 99

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I  DR  +    ++  DYL  +   + I QG AL +     L  +  +YGVP   ++ALW
Sbjct: 100 IKSDRNQLEK-KITLDDYLTRVLPRKRIEQGRALYQRYQPQLSQVNAQYGVPGRYIVALW 158

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGE 195
           G+E+ FG+  GK  ++S L+TLA++ RR  FFT++   AL+++ +G +      G+  G 
Sbjct: 159 GMESAFGQIQGKEDVISALSTLAFEGRREAFFTKELMAALEIIHQGKVDDPQLRGSWAGA 218

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           +GQ QF+P + + Y  D D DGKID+  +  D  AS A +L+  GW    G+   
Sbjct: 219 MGQSQFMPSSFLTYGADGDSDGKIDIWNNIDDVFASTANYLSTQGWKSEQGWGQE 273


>gi|17986844|ref|NP_539478.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 1 str. 16M]
 gi|17982480|gb|AAL51742.1| membrane-bound lytic murein transglycosylase b [Brucella melitensis
           bv. 1 str. 16M]
          Length = 398

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 78/321 (24%), Positives = 116/321 (36%), Gaps = 59/321 (18%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
            A              +    FG+W       A   G+  K               + RD
Sbjct: 15  PAPAAATDNAVNMPKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRD 73

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           RK  T   ++F ++   L S   + +G       + +   ++  YGVP  +L A WGLET
Sbjct: 74  RKQ-TVFNLTFTEFSKRLISEARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLET 132

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQ 200
            +G   G    L+ L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q
Sbjct: 133 DYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQ 192

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNF 254
            LP + ++  +D D DGK+DL  S  DA+ +A + L++LGW +   +             
Sbjct: 193 LLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGRMLSELGWKRGQPWLEEVRLTKDLPWE 252

Query: 255 AILK---------------------------------------------------HWNAS 263
             ++                                                    WN S
Sbjct: 253 EAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASLLLPLGRKGPAFLSYLNFDIFVEWNKS 312

Query: 264 LNYNKTIAYIAAHIDGVPIGK 284
           + Y  T AY A  + G P   
Sbjct: 313 IVYATTAAYFATRLAGAPAFD 333


>gi|225627895|ref|ZP_03785931.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
 gi|225617058|gb|EEH14104.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
          Length = 413

 Score =  186 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/347 (23%), Positives = 121/347 (34%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L + L     +                        +    FG+W       A 
Sbjct: 4   MKIIASVLAAALFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTREAR 63

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 64  EAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISEARLKKGQENLVKY 121

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 122 ADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 181

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A +
Sbjct: 182 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGR 241

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 242 MLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 301

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 302 LLPLGRKGPAFLSYPNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 348


>gi|212635103|ref|YP_002311628.1| membrane-bound lytic murein transglycosylase [Shewanella
           piezotolerans WP3]
 gi|212556587|gb|ACJ29041.1| Membrane-bound lytic murein transglycosylase [Shewanella
           piezotolerans WP3]
          Length = 333

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 71/243 (29%), Positives = 121/243 (49%), Gaps = 2/243 (0%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           LL      L   +     A      S +   F E+ +  +  AV +G+  +T   +F  +
Sbjct: 2   LLSKQALTLTCGLVLSFNAIASDATSASKGSFSEYVTQLKLEAVEQGVKEQTINDVFPKI 61

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
           +     +A D+    +  ++ + YL  +     + +   L K +   L  + + YGV P 
Sbjct: 62  KMFKKAVASDKAQPET-KLTLETYLPRVVPDWKVEKARNLFKTHQVELERIGELYGVQPR 120

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHAL 189
            ++ALWG+E++FG+  G  P+LS  A+LAY+ RR  FF ++FF AL + ++   +     
Sbjct: 121 FIVALWGVESNFGKLTGSYPVLSVTASLAYEGRREDFFKKEFFAALKIAEEQQFTFEEMK 180

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
           G+  G +GQ QF+P + + YA D D DGK D+  ++ DA ASAA +L + GW +   +  
Sbjct: 181 GSWAGAMGQTQFMPTSFLAYAQDGDGDGKKDIWNNSSDAFASAAYYLQQAGWKESETWGR 240

Query: 250 GEK 252
             K
Sbjct: 241 QVK 243


>gi|306844345|ref|ZP_07476937.1| lytic murein transglycosylase [Brucella sp. BO1]
 gi|306275417|gb|EFM57158.1| lytic murein transglycosylase [Brucella sp. BO1]
          Length = 410

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 79/347 (22%), Positives = 121/347 (34%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L + L     +                        +    FG+W       A 
Sbjct: 1   MKIIASVLAAALFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTKEAR 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 61  EAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISEARLKKGQENLVKY 118

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 119 ADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 178

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D + DGK+DL  S  DA+ +A +
Sbjct: 179 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGNGDGKVDLKNSVPDAMMTAGR 238

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 239 MLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 298

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 299 LLPLGRKGPAFLSYPNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 345


>gi|254694130|ref|ZP_05155958.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 3
           str. Tulya]
          Length = 410

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 80/347 (23%), Positives = 121/347 (34%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L + L     +                        +    FG+W       A 
Sbjct: 1   MKIIASVLAAALFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTREAR 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 61  EAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISEARLKKGQENLVKY 118

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 119 ADVFKKVEDAYGVPCPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 178

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A +
Sbjct: 179 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGR 238

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 239 MLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 298

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 299 LLPLGRKGPAFLSYLNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 345


>gi|190893390|ref|YP_001979932.1| membrane-bound lytic murein transglycosylase [Rhizobium etli CIAT
           652]
 gi|190698669|gb|ACE92754.1| probable membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CIAT 652]
 gi|327189616|gb|EGE56766.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CNPAF512]
          Length = 407

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 73/309 (23%), Positives = 124/309 (40%), Gaps = 63/309 (20%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL-EYLDTTIARDRKMVTSPPVSF 91
              +    RF +W       A + G+S  T +  F+ + E   T + +            
Sbjct: 26  PDNAKADSRFQKWIGDFYQTAAQSGISKATYQKAFSGVSEPDPTVLEKAAYQPE-FTSKI 84

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP- 150
            DY+D   +   +  G  +   ++R L  +++ +GV   IL+A+W +E+++G  + K   
Sbjct: 85  WDYIDSRVNPYTVKIGREMAAKHARTLNAIEQRFGVDKTILLAIWSMESNYGAILDKDDR 144

Query: 151 ---LLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVN 205
              +   LATLAY D  RAKF  +Q   AL +++ G + +    G+  G +G  QF+P +
Sbjct: 145 LHYVPRALATLAYADPSRAKFAKKQLVAALKILQNGDVPAREMTGSWAGAMGHTQFIPTS 204

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ----------------- 248
            + YA+DAD +G  D+  S  DA+A++A  L K GW     +                  
Sbjct: 205 YLLYAVDADGNGHRDIWNSVPDALATSANLLMKNGWDTGKTWGYEVVVPAAAAKQVGKTH 264

Query: 249 -----------------------------PGEKN---------FAILKHWNASLNYNKTI 270
                                        P   N         F  +K++NAS +Y   +
Sbjct: 265 TLAQWAELGLKRPNGKAFREGGTKAMLKMPAGPNGPGFLMTANFFTIKNYNASDSYALAV 324

Query: 271 AYIAAHIDG 279
             +A  I G
Sbjct: 325 GLLADQIAG 333


>gi|162147579|ref|YP_001602040.1| membrane-bound lytic murein transglycosylase B [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542212|ref|YP_002274441.1| lytic murein transglycosylase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786156|emb|CAP55738.1| putative membrane-bound lytic murein transglycosylase B precursor
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209529889|gb|ACI49826.1| lytic murein transglycosylase [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 330

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 72/321 (22%), Positives = 119/321 (37%), Gaps = 60/321 (18%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
            ++      A      A +    S  A  +  + +  RA AV  G+S        A    
Sbjct: 7   FLMSASATCAAGGIGMAASARADSAPAASYAAFLAGVRAEAVSHGLSAAIVDRALALEAP 66

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
               +  D+       +++  Y   + + + +A G     A   LL  + + +GV P  L
Sbjct: 67  NARVLQLDQHQPE-FTLTWAQYRQRVLTPKKVADGRVAAGARRALLAEVGRHFGVDPQPL 125

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGA 191
           M +WGLE+ +G   G   +   LATLAYD RRA FF  +   AL ++  G ++     G+
Sbjct: 126 MGIWGLESAYGTRTGTFQIPDALATLAYDGRRASFFRGELMNALRILDHGDVTPDSMTGS 185

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA------ 245
             G +GQ QF+P   ++YA+D    G+ D+  S  D  AS A +LA+ GW+         
Sbjct: 186 YAGAMGQPQFMPSAYLRYAVDYTGSGRRDIWTSEPDVFASIANYLARCGWSAGEPWGQEI 245

Query: 246 ----------------------------------------------GYQPG------EKN 253
                                                            PG       +N
Sbjct: 246 SVPTRLAQADLGRGRVRTLADWMAQGVRRLDGRRFSRPDISGAVIRPDGPGGEAFMVYRN 305

Query: 254 FAILKHWNASLNYNKTIAYIA 274
           F++++ +N S  Y   +  + 
Sbjct: 306 FSVIRRYNPSDFYALAVGLLG 326


>gi|51596389|ref|YP_070580.1| lipoprotein [Yersinia pseudotuberculosis IP 32953]
 gi|186895432|ref|YP_001872544.1| lytic murein transglycosylase [Yersinia pseudotuberculosis PB1/+]
 gi|51589671|emb|CAH21301.1| putative lipoprotein [Yersinia pseudotuberculosis IP 32953]
 gi|186698458|gb|ACC89087.1| lytic murein transglycosylase [Yersinia pseudotuberculosis PB1/+]
          Length = 361

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 73/235 (31%), Positives = 119/235 (50%), Gaps = 2/235 (0%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            ML    T     T          +F  +    +A+A  +G + +T    FA++ ++D  
Sbjct: 39  SMLTPGATASSTPTMLSQQGRDPSQFPAYVEQLKAQARAKGYTTETLDTAFANIHFVDRV 98

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I  DR  +    ++  DYL  +   + I QG AL +     L  +  +YGVP   ++ALW
Sbjct: 99  IKSDRNQLEK-KITLDDYLTRVLPRKRIEQGRALYQRYQPQLSQVNAQYGVPGRYIVALW 157

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGE 195
           G+E+ FG+  GK  ++S L+TLA++ RR  FFT++   AL+++ +G +      G+  G 
Sbjct: 158 GMESAFGQIQGKEDVISALSTLAFEGRREAFFTKELMAALEIIHQGKVDDPQLRGSWAGA 217

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           +GQ QF+P + + Y  D D DGKID+  +  D  AS A +L+  GW    G+   
Sbjct: 218 MGQSQFMPSSFLTYGADGDSDGKIDIWNNIDDVFASTANYLSTQGWKSEQGWGQE 272


>gi|269103051|ref|ZP_06155748.1| membrane-bound lytic murein transglycosylase B [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162949|gb|EEZ41445.1| membrane-bound lytic murein transglycosylase B [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 323

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 113/247 (45%), Gaps = 15/247 (6%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
            KK L+ +L+     M +                     F ++    +A A  +G+S + 
Sbjct: 1   MKKRLVSALVAFGLGMSSSVFAA-------------DAGFDKYVEGLKAEAREKGISEQI 47

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
               F  +E+    +  D+       ++   Y+        + Q   L + +   L  + 
Sbjct: 48  INEAFTGIEFKHRAVKADKNQPEK-KLTLDQYIPRAVPQWKVKQANRLYREHYTDLQRIG 106

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           K++GV P  ++ALWG+E++FG+  GK  ++  LAT+AY+ RR  FF  Q   AL ++ +G
Sbjct: 107 KQFGVQPRFIVALWGVESNFGKFTGKYNVVEALATMAYEGRREAFFRGQVMDALQILNEG 166

Query: 183 VISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I      G+  G +GQ QF+P + + +A D + DGK D+  +  D  ASAA +L K GW
Sbjct: 167 HIKPSEMKGSWAGAMGQPQFMPSSYLTFAADGNNDGKSDIWNTTEDVFASAANYLHKSGW 226

Query: 242 TKCAGYQ 248
                + 
Sbjct: 227 NDEYTWG 233



 Score = 36.4 bits (82), Expect = 5.0,   Method: Composition-based stats.
 Identities = 8/37 (21%), Positives = 15/37 (40%), Gaps = 1/37 (2%)

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
                Y    +N+  L  WN S  +   ++++A  I 
Sbjct: 288 QHGRAYLI-YENYQTLLKWNRSHYFALAVSHLADQIQ 323


>gi|110634376|ref|YP_674584.1| lytic murein transglycosylase [Mesorhizobium sp. BNC1]
 gi|110285360|gb|ABG63419.1| lytic murein transglycosylase [Chelativorans sp. BNC1]
          Length = 394

 Score =  186 bits (472), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 77/252 (30%), Positives = 119/252 (47%), Gaps = 15/252 (5%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M  K  LL ++L +  P +A A                   F  W++   A A  +G+ P
Sbjct: 1   MQVKYGLLGAVLALSLPSMAAA-------------QQCGGDFAAWRAGVEAEAQSQGVGP 47

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
                           + RDR        +F+++ + + S + + +G A     + +   
Sbjct: 48  AGLD-ALQRARIDQRVLDRDRSQG-VFTQTFREFANRMISRDRMQRGAANLTKYASVFQR 105

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
            + EYGVP  ++ A W LET FG   G    L+ LATL++DCRR + F  +F   L LV 
Sbjct: 106 AESEYGVPGPVIAAFWALETDFGAVQGDFNTLNALATLSHDCRRPELFRPEFVAFLKLVD 165

Query: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           +G++++   GA  GEIGQ Q LP + ++  +D D DG++DL  S  DAI +AA  LAKLG
Sbjct: 166 RGLVTTDTTGAWAGEIGQLQVLPSDYLEKGVDGDGDGRVDLKGSAADAILTAANKLAKLG 225

Query: 241 WTKCAGYQPGEK 252
           W     +    +
Sbjct: 226 WKAGQPWLDEVR 237


>gi|153947335|ref|YP_001400981.1| lytic murein transglycosylase [Yersinia pseudotuberculosis IP
           31758]
 gi|152958830|gb|ABS46291.1| lytic murein transglycosylase [Yersinia pseudotuberculosis IP
           31758]
          Length = 362

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 73/235 (31%), Positives = 119/235 (50%), Gaps = 2/235 (0%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            ML    T     T          +F  +    +A+A  +G + +T    FA++ ++D  
Sbjct: 40  SMLTPGATASSTPTMLSQQGRDPSQFPAYVEQLKAQARAKGYTTETLDTAFANIHFVDRV 99

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I  DR  +    ++  DYL  +   + I QG AL +     L  +  +YGVP   ++ALW
Sbjct: 100 IKSDRNQLEK-KITLDDYLTRVLPRKRIEQGRALYQRYQPQLSQVNAQYGVPGRYIVALW 158

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGE 195
           G+E+ FG+  GK  ++S L+TLA++ RR  FFT++   AL+++ +G +      G+  G 
Sbjct: 159 GMESAFGQIQGKEDVISALSTLAFEGRREAFFTKELMAALEIIHQGKVDDPQLRGSWAGA 218

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           +GQ QF+P + + Y  D D DGKID+  +  D  AS A +L+  GW    G+   
Sbjct: 219 MGQSQFMPSSFLTYGADGDSDGKIDIWNNIDDVFASTANYLSTQGWKSEQGWGQE 273


>gi|319899254|ref|YP_004159347.1| peptidoglycan-binding protein [Bartonella clarridgeiae 73]
 gi|319403218|emb|CBI76777.1| peptidoglycan-binding protein [Bartonella clarridgeiae 73]
          Length = 420

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 67/349 (19%), Positives = 127/349 (36%), Gaps = 72/349 (20%)

Query: 1   MSFKKYLLISLL-------MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
           M   ++  +           ++  +L+  V+ P   ++     +    F  W +  +  A
Sbjct: 1   MKITEFSTLFFSEKTKNRRSLLIGLLSIFVSLPIVFSSLTYADN---GFQHWINEFKKIA 57

Query: 54  VREGMSPKTAKHLFADL-EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           +   +S  T    F  +    +  + R             +Y D     + I +G    K
Sbjct: 58  LANNISSSTFDIAFKTINTIDEEVLKRAAYQPE-FVDMPWEYFDNRVHDDAIVEGKQQAK 116

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKF 167
              + L  ++K +GV    L+A+W +E+++G+ +    ++     +LATLAY D +R K+
Sbjct: 117 KWEQWLPKIEKRFGVNRNFLLAIWSMESNYGKVLTNKDVMRDTIRSLATLAYADPKRKKY 176

Query: 168 FTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
              Q   A+ +++ G I     +G+  G +G  QF+P + + YAID D  G+ D+  S  
Sbjct: 177 AHAQLIAAMKILQSGEIHRSQLVGSWAGALGHTQFIPSSYLIYAIDMDGSGRSDIWNSIP 236

Query: 227 DAIASAAKFLAKLGWTKCAGYQPG--EKNFA----------------------------- 255
           D++A+AA  L   GW     +       N                               
Sbjct: 237 DSLATAANLLHMNGWQSNLTWGIEVKLPNNKKLPENWLSFEEWKELGVQHVYGKPFPSLS 296

Query: 256 -----------------------ILKHWNASLNYNKTIAYIAAHIDGVP 281
                                  ++K +N +  Y   +  +A  I G P
Sbjct: 297 EQAILKFPDGPKGPAFLVTKNFFVIKRYNNADRYAFAVGLLADRIAGHP 345


>gi|296533259|ref|ZP_06895873.1| membrane-bound lytic murein transglycosylase B [Roseomonas
           cervicalis ATCC 49957]
 gi|296266412|gb|EFH12423.1| membrane-bound lytic murein transglycosylase B [Roseomonas
           cervicalis ATCC 49957]
          Length = 313

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 63/216 (29%), Positives = 104/216 (48%), Gaps = 2/216 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
               F  + +  R  A R G+S           +     +  DR+      +S++ Y D 
Sbjct: 16  DEAAFQRFLAGVRQEAARNGVSNAILARSLDRAKPQPRVLELDRRQPEG-VLSWEQYRDR 74

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
           + S   I  G      N  LL  ++  Y V P +++A+WG+ET++G   G   ++  LAT
Sbjct: 75  IVSQTRIQNGRRAYAENRALLQAIEARYNVSPRVIVAIWGMETNYGSNTGGFNVVDALAT 134

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADED 216
           LA++ RRA FF  +   AL +++   I+     G+  G +GQ QF+P +  + A+D D D
Sbjct: 135 LAWEGRRASFFRAELMAALRILEGQHIAPERMQGSWAGAMGQPQFMPTSFERLAVDFDGD 194

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
           G  D+  +  DA+AS A +LA+ GW    G+    +
Sbjct: 195 GHRDIWDNRGDALASIANYLARSGWQAGQGWAIEAR 230


>gi|221133642|ref|ZP_03559947.1| lytic murein transglycosylase [Glaciecola sp. HTCC2999]
          Length = 398

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 86/329 (26%), Positives = 126/329 (38%), Gaps = 67/329 (20%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L+    +++ +      +  Q         F E  SA   +A   G+S  T        +
Sbjct: 3   LLPSLFIISASFGMTLPSYAQI-------NFSECISALTTQAKSNGISQVTIDKTLKKAK 55

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
             +  +  DR        +F DY     +   I +G      +   L  L  +YG+P   
Sbjct: 56  QREQVVKLDRNQPE-FLATFADYYSKRVNDWRINKGREKFNEHREFLQALTDQYGIPGQY 114

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-G 190
           LM+ WGLET++G   GK P +  LATLA + RR  FFT +    LD+V+   +    + G
Sbjct: 115 LMSFWGLETNYGGYKGKIPTIDALATLACEPRRKTFFTNELMTMLDIVQNQSLDVDTMKG 174

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL----GWTKCAG 246
           +  G +G  QF+P    +YAID D DG IDL  S  DA+ASAA FL KL    G+     
Sbjct: 175 SWAGAMGHTQFMPTTYAQYAIDGDGDGNIDLFNSERDALASAANFLHKLGWEPGYRWGRE 234

Query: 247 ----------------------YQP--------------------------------GEK 252
                                 ++                                   K
Sbjct: 235 VTLPRDFDYSLADRKIKKPLSFWREQGVKTVYGHALSDIDYPASVIVPSGYNGPIFLAYK 294

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           NF I+  WNAS +Y   +  +A  I+  P
Sbjct: 295 NFHIIMRWNASQSYAIAVGKLAEQINNAP 323


>gi|146284084|ref|YP_001174237.1| membrane-bound lytic murein transglycosylase, putative [Pseudomonas
           stutzeri A1501]
 gi|145572289|gb|ABP81395.1| membrane-bound lytic murein transglycosylase, putative [Pseudomonas
           stutzeri A1501]
          Length = 446

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 80/318 (25%), Positives = 124/318 (38%), Gaps = 57/318 (17%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
             A +  +   A        T   F +W+   RA A+  G+S  T    FA ++     I
Sbjct: 54  AAAPSGQRSDNAVVDAPAEATHLSFSQWREQFRAEALAAGISSTTFDRAFAGVQPDPAVI 113

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
             DR            YL+   S + +  G  L   ++  L  ++  YGV    L+A+WG
Sbjct: 114 EADRSQPE-FTRPVWQYLESAISPQRVRSGQRLLNEHAATLDRIEARYGVDRETLVAVWG 172

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEI 196
           LE+ FG+ MG   ++ +LATLA++ RR  F   Q   AL++++ G +S   + G+  G +
Sbjct: 173 LESSFGQIMGDKSVIRSLATLAHEGRRPAFAKSQLIAALEILQHGDVSPQQMRGSWAGAM 232

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT-------------- 242
           GQ QF+P     +A+D D DGK D+  S+ DA+ASAA +L   GW               
Sbjct: 233 GQTQFIPTTYNTHAVDFDGDGKRDIWNSSADALASAAHYLQASGWKQGQPWGFEVRLPSG 292

Query: 243 ----------------------KCAGYQPGE-------------------KNFAILKHWN 261
                                 +       E                    NF  +  +N
Sbjct: 293 FDYALADNEIRKPLAEWRRLGLRGLPGGRDEANASLLLPAGHRGPAFLIMDNFRAILRYN 352

Query: 262 ASLNYNKTIAYIAAHIDG 279
            S  Y   I  ++    G
Sbjct: 353 NSSAYALAIGLLSESFQG 370


>gi|251789510|ref|YP_003004231.1| lytic murein transglycosylase [Dickeya zeae Ech1591]
 gi|247538131|gb|ACT06752.1| lytic murein transglycosylase [Dickeya zeae Ech1591]
          Length = 435

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 66/287 (22%), Positives = 122/287 (42%), Gaps = 20/287 (6%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKA----------------TTQFICSDTADRFGEWKSA 48
               +++L++V  +L+    +                     T        + F +WK+ 
Sbjct: 11  MMAKVTVLLLVTGVLSSCAHKHAPPGECRDIDGLLKSHGVTDTPTGLPTPDESFEQWKAK 70

Query: 49  ARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGI 108
            R  A+ +G++  T    FADL   +  +A  +K        +  Y++   + + IAQG 
Sbjct: 71  VRQEALSKGITADTFDKAFADLTPDNDVVAATQKQPEVITPVWT-YIEQRVTPDNIAQGK 129

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
            L K  +++   +++ Y V P +L A   +E+H+G   G   ++ +LATL Y   R  F 
Sbjct: 130 TLLKQYAKVAARIEQRYQVEPSLLFAFLAIESHYGANTGDKAVVRSLATLDYYNYRRAFN 189

Query: 169 TEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
            +    AL +++ G        G+  G +G  QF+P + ++YA+D D D + D+  S  D
Sbjct: 190 RQNLIAALRMIQNGDARPEQIKGSWAGAMGMPQFIPTSYLQYAVDFDGDRRPDIWTSFPD 249

Query: 228 AIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLN-YNKTIAYI 273
            +AS A ++ +  W     +            + AS     KT+A  
Sbjct: 250 TLASVANYMQQAKWKAGVPWGFEVT-LPAGFDYAASGLDSQKTVADW 295


>gi|170024353|ref|YP_001720858.1| lytic murein transglycosylase [Yersinia pseudotuberculosis YPIII]
 gi|169750887|gb|ACA68405.1| lytic murein transglycosylase [Yersinia pseudotuberculosis YPIII]
          Length = 361

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 72/235 (30%), Positives = 119/235 (50%), Gaps = 2/235 (0%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
            ML    T     T          +F  +    +A+A  +G + +T    FA++ ++D  
Sbjct: 39  SMLTPGATASSTPTMLSQQGRDPSQFPAYVEQLKAQARAKGYTTETLDTAFANIHFVDRV 98

Query: 77  IARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           I  DR  +    ++  DYL  +   + I QG AL +     L  +  +YGVP   ++ALW
Sbjct: 99  IKSDRNQLEK-KITLDDYLTRVLPRKRIEQGRALYQRYQPQLSQVNAQYGVPGRYIVALW 157

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGE 195
           G+E+ FG+  GK  ++S L+TLA++ RR  FFT++   AL+++ +G +      G+  G 
Sbjct: 158 GMESAFGQIQGKEDVISALSTLAFEGRREAFFTKELMAALEIIHQGKVDDPQLRGSWAGA 217

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           +GQ QF+P + + Y  D D DGK+D+  +  D  AS A +L+  GW    G+   
Sbjct: 218 MGQSQFMPSSFLTYGADGDSDGKVDIWNNIDDVFASTANYLSTQGWKSEQGWGQE 272


>gi|222149735|ref|YP_002550692.1| lytic murein transglycosylase [Agrobacterium vitis S4]
 gi|221736717|gb|ACM37680.1| lytic murein transglycosylase [Agrobacterium vitis S4]
          Length = 405

 Score =  186 bits (471), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 76/320 (23%), Positives = 126/320 (39%), Gaps = 63/320 (19%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARD 80
           A+     A+   + +     F +W       A   G+S +T    FA ++      + + 
Sbjct: 12  ALAFSLMASLAPLHAHADAGFQKWIRDFYPAAAAAGISAQTYNRAFAGIKDPDPDVLRKA 71

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
                       DYLD   +   +  G  +   + R L +L+K +GV   IL+A+W +E+
Sbjct: 72  AYQPE-FKSEIWDYLDSRVNPYTVKIGREMLAKHGRTLASLEKYFGVDRHILLAIWSMES 130

Query: 141 HFGETMGKTP----LLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFG 194
           ++G  + K      +   LATL Y D +R  F  +Q   AL +++ G +S     G+  G
Sbjct: 131 NYGAVLAKDDRLHYVPQALATLGYADPKRGGFARKQLIAALKILQNGDVSPKEMTGSWAG 190

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ------ 248
            +G  QF+P + + YA+DAD +G  D+  S  DA+A++A  LAK GW     +       
Sbjct: 191 AMGHTQFIPTSYLLYAVDADGNGHKDIWNSIPDALATSANLLAKNGWDSGRTWGYETVVP 250

Query: 249 -------------------------------PGEK------------------NFAILKH 259
                                          PGE+                  NF  +K 
Sbjct: 251 AGAGKYAGKTLTMAQWQKLGFTRPGGKAFRNPGERAQLKLLAGANGPGFLMTSNFFTIKK 310

Query: 260 WNASLNYNKTIAYIAAHIDG 279
           +NA+  Y   +  +A  I G
Sbjct: 311 YNAADTYALAVGLLADEIAG 330


>gi|295688037|ref|YP_003591730.1| lytic murein transglycosylase [Caulobacter segnis ATCC 21756]
 gi|295429940|gb|ADG09112.1| lytic murein transglycosylase [Caulobacter segnis ATCC 21756]
          Length = 435

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 72/318 (22%), Positives = 119/318 (37%), Gaps = 62/318 (19%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
                 A  Q         F  W +  R RA+  G+SP+      + +      I+ D +
Sbjct: 42  TPSTTPAIPQTQVDAETQAFDAWLADFRPRAIAAGVSPQVFDRELSGVTPNPRVISLDSR 101

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                      Y+ G+ S + IA G A ++     L  ++  YGVP  IL+A+W +E+ F
Sbjct: 102 QPE-FSKPVGAYIAGVISDDRIAIGRAKREQL-AFLPQIEARYGVPRDILLAVWAMESAF 159

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQF 201
           G+  G   ++ ++A+LA D RR  +   +   AL +++ G  +     G+  G +GQ QF
Sbjct: 160 GKLQGDFDVVRSMASLAADGRRRAWAEGELIAALKIIESGEDTREQLKGSWAGAMGQTQF 219

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK------------------ 243
           LP +    A+D D DG+ D+  S+ D++ASAA  L K GW                    
Sbjct: 220 LPSSYRATAVDFDGDGRRDIWGSDADSLASAANLLVKGGWKPGVGWAKEVILPAGFDYSL 279

Query: 244 --------------------CAGYQPGE---------------------KNFAILKHWNA 262
                                  +   +                      N   ++ +N 
Sbjct: 280 AEGPREIPAWWEEKGVRRADGLPWTAADAAQPAGLILPAGAAGPAFLALPNHFAIRTYNN 339

Query: 263 SLNYNKTIAYIAAHIDGV 280
           S +Y   I  +A    G 
Sbjct: 340 STSYALGIGLLADRFGGG 357


>gi|294625605|ref|ZP_06704229.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292600080|gb|EFF44193.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 709

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 82/344 (23%), Positives = 133/344 (38%), Gaps = 81/344 (23%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+  +  L  +L +  P++A A                   F    +  + +A  +G+  
Sbjct: 1   MTLHRRALPFVLGL-LPLVACADPA----------------FDRCLTGLQTQAAAKGVDA 43

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            + +   A L    + +               DYL  L  S+ +  G A+   +  LL  
Sbjct: 44  ASFQRFTAGLAPDPSVLPLLDAQPE-FTTPIWDYLASLVDSQRVTDGQAMLVTHRELLSR 102

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           L  + GV P  ++A+WG+E+ +G   GK PLL +LATL+   RR  FF  +F   L L++
Sbjct: 103 LSDQTGVDPATIVAVWGVESDYGRVTGKRPLLVSLATLSCAGRRQPFFRGEFLALLSLLQ 162

Query: 181 KGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G +S+    G+  G  GQ QF+P    + A+D D DG+ DLV S  DA+AS A +L K 
Sbjct: 163 QGDLSADGLTGSWAGAFGQTQFMPSIYARIAVDGDGDGRRDLVTSIPDALASTANYLVKA 222

Query: 240 G------W--------------------TKCAGYQPGE---------------------- 251
           G      W                         +Q                         
Sbjct: 223 GWERARPWGMEVTLPRGFDASKAGRTGRQPLQAWQSAGLLGTDGKPLAPTGLAAETPAAL 282

Query: 252 --------------KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
                         +N+  +  +NA+ +Y  +IA +A  + G P
Sbjct: 283 LLPAGATGPALLVFRNYDAIYAYNAAESYALSIALLADRLRGGP 326


>gi|254697782|ref|ZP_05159610.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 2
           str. 86/8/59]
 gi|256257890|ref|ZP_05463426.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 9
           str. C68]
          Length = 372

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 77/308 (25%), Positives = 115/308 (37%), Gaps = 59/308 (19%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
              +    FG+W       A   G+  K               + RDRK  T   ++F +
Sbjct: 2   PKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTE 59

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           +   L S   + +G       + +   ++  YGVP  +L A WGLET +G   G    L+
Sbjct: 60  FSKRLISEARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLN 119

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
            L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D 
Sbjct: 120 ALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDG 179

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNFAILK--------- 258
           D DGK+DL  S  DA+ +A + L++LGW +   +               ++         
Sbjct: 180 DGDGKVDLKNSVPDAMMTAGRMLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWW 239

Query: 259 ------------------------------------------HWNASLNYNKTIAYIAAH 276
                                                      WN S+ Y  T AY A  
Sbjct: 240 AEHGVTGLNGPLGPDDGDASLLLPLGRKGPAFLSYLNFDIFVEWNKSIVYATTAAYFATR 299

Query: 277 IDGVPIGK 284
           + G P   
Sbjct: 300 LAGAPAFD 307


>gi|241206300|ref|YP_002977396.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860190|gb|ACS57857.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 407

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 79/341 (23%), Positives = 134/341 (39%), Gaps = 70/341 (20%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+      +  L +   + AQ    P  A           RF +W +     A + G+S 
Sbjct: 1   MTQNHKNSLRGLALALIVAAQVALVPDNAKA-------DSRFQKWIADFYQTAAQSGISK 53

Query: 61  KTAKHLFADL-EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
            T +  F+ + E   T + +             DY+D   +   +  G  +   ++R L 
Sbjct: 54  ATYQKAFSGVSEPDPTVLEKAAYQPE-FTSKIWDYVDSRVNPYTVKIGREMAAKHARTLA 112

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTP----LLSTLATLAY-DCRRAKFFTEQFFY 174
            +++ +GV   IL+A+W +E+++G  + K      +   LATLAY D  RAKF  +Q   
Sbjct: 113 AIEQRFGVDKTILLAIWSMESNYGAVLDKDDRLHYVPRALATLAYADPSRAKFAKKQLVA 172

Query: 175 ALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAA 233
           AL +++ G + +    G+  G +G  QF+P + + YA+DAD +G  D+  S  DA+A++A
Sbjct: 173 ALKILQNGDVPARKMTGSWAGAMGHTQFIPTSYLLYAVDADGNGHRDIWNSIPDALATSA 232

Query: 234 KFLAKLGWTKCAGYQ-----------------------------PGEKNFA--------- 255
             L K GW     +                              P  K F          
Sbjct: 233 NLLMKNGWDTGKTWGYEVVVPAAAAKQAGKTHTLAQWAALGLTRPNGKAFRESATKAMLK 292

Query: 256 -----------------ILKHWNASLNYNKTIAYIAAHIDG 279
                             +K++NAS +Y   +  +A  I G
Sbjct: 293 MPAGAGGPGFLMTANFFTIKNYNASDSYALAVGLLADQIAG 333


>gi|148559504|ref|YP_001259339.1| putative peptidoglycan-binding protein [Brucella ovis ATCC 25840]
 gi|148370761|gb|ABQ60740.1| putative peptidoglycan-binding protein [Brucella ovis ATCC 25840]
          Length = 372

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 76/308 (24%), Positives = 114/308 (37%), Gaps = 59/308 (19%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
              +    FG+W       A   G+  K               + RDRK  T   ++F +
Sbjct: 2   PKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTE 59

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           +   L S   + +G       + +   ++  YGVP  +L A W LET +G   G    L+
Sbjct: 60  FSKRLISEARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWRLETDYGAIQGDFDTLN 119

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
            L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D 
Sbjct: 120 ALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDG 179

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNFAILK--------- 258
           D DGK+DL  S  DA+ +A + L++LGW +   +               ++         
Sbjct: 180 DGDGKVDLKNSVPDAMMTAGRMLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWW 239

Query: 259 ------------------------------------------HWNASLNYNKTIAYIAAH 276
                                                      WN S+ Y  T AY A  
Sbjct: 240 AEHGVTGLNGPLGPDDGDASLLLPLGRKGPAFLSYPNFDIFVEWNKSIVYATTAAYFATR 299

Query: 277 IDGVPIGK 284
           + G P   
Sbjct: 300 LAGAPAFD 307


>gi|170747392|ref|YP_001753652.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
 gi|170653914|gb|ACB22969.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
          Length = 404

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 77/279 (27%), Positives = 123/279 (44%), Gaps = 14/279 (5%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
              +LA     P  +            F    +  +++A   G+S +T +   + + Y D
Sbjct: 13  ALGLLAGIAVLPLASLPAR------ADFDSCLAGIQSQAAAAGVSAQTFRSATSGISYDD 66

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
             I   +           DY+  L   E +  G A  + N+  L   +  YGV    + A
Sbjct: 67  KVIELSQAQPE-FKTPIWDYMAALVDDERVEDGRAAMRQNAAALAQAESRYGVDRYTIAA 125

Query: 135 LWGLETHFGETMGKTPLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHA-LGAT 192
           +WG+E++FG+ +GK PL+ +LATLA  + RR  FF  +    L ++++G I+     G+ 
Sbjct: 126 VWGVESNFGKNLGKMPLVQSLATLACSNNRRRDFFRGELIATLRIIERGDIAPERLTGSW 185

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G  GQ QF+P    + A+D D DG+ D+V S  DA+AS A FL    W     +    K
Sbjct: 186 AGAFGQTQFMPTTYHRLAVDGDGDGRRDVVDSTADAVASTANFLHVAKWQHGQVWGYEVK 245

Query: 253 NFAILKHWNASLNYNKTIAYIA----AHIDGVPI-GKGY 286
                    A     K +A+ A      +DG P+ G+G 
Sbjct: 246 LPRGFNVAAAGRKNKKPVAHWASLGVTRVDGRPLSGEGP 284


>gi|159042720|ref|YP_001531514.1| lytic murein transglycosylase [Dinoroseobacter shibae DFL 12]
 gi|157910480|gb|ABV91913.1| lytic murein transglycosylase [Dinoroseobacter shibae DFL 12]
          Length = 389

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 77/311 (24%), Positives = 113/311 (36%), Gaps = 58/311 (18%)

Query: 31  TQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
              + +     F ++ +  +  A  +G +  T    F        T+  DR       + 
Sbjct: 15  AGPVAAQCGGSFSDFVAGLKTEAQAKGHAKATVDAFFRTAAQDPRTLRADRAQG-VFKMP 73

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
           F ++   + S   +  G         +    +  +GVP G+L+ALW LET +G   G   
Sbjct: 74  FTEFARRVISQNRMDNGRRNADRFDAVFDAAETRFGVPRGVLLALWALETDYGAVQGDFN 133

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKY 209
            L++L TLA+DCRR + F  Q F AL+L + G        GA  GEIG  Q LP +++  
Sbjct: 134 TLNSLVTLAHDCRRPELFRPQIFAALELYEAGDFDPARTTGAWAGEIGMVQMLPEDILTK 193

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG----------------------- 246
            ID D DG + L  S  DA+ S A  L+ LGW K                          
Sbjct: 194 GIDGDGDGHVYLKTSAPDALLSGANMLSGLGWRKGEPWLQEVSVPADLDWAETGLNSRKS 253

Query: 247 ------------YQP---------------------GEKNFAILKHWNASLNYNKTIAYI 273
                       +                          NF +   WN S  Y  T AY 
Sbjct: 254 GRDWARLGVTPRWGEIAGGLEAALILPQGRKGPAFLAYPNFDVFFEWNQSFVYVTTAAYF 313

Query: 274 AAHIDGVPIGK 284
           A  + G P+  
Sbjct: 314 ATRLSGAPVFD 324


>gi|327482401|gb|AEA85711.1| membrane-bound lytic murein transglycosylase, putative [Pseudomonas
           stutzeri DSM 4166]
          Length = 444

 Score =  185 bits (470), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 72/232 (31%), Positives = 113/232 (48%), Gaps = 2/232 (0%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
             A +  +   A        T   F +W+   RA A+  G+S  T    FA ++     I
Sbjct: 52  AAAPSGQRSDNAVVDAPAEATHLSFSQWREQFRAEALAAGISAATFDRAFAGVQPDPAVI 111

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
             DR            YL+   S + +  G  L   ++  L  ++  YGV    L+A+WG
Sbjct: 112 EADRSQPE-FTRPVWQYLESAISPQRVRSGQRLLNEHAATLDRIEARYGVDRETLVAVWG 170

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEI 196
           LE+ FG+ MG   ++ +LATLA++ RR  F   Q   AL++++ G +S   + G+  G +
Sbjct: 171 LESSFGQIMGDKSVIRSLATLAHEGRRPAFAKSQLIAALEILQHGDVSPQQMRGSWAGAM 230

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           GQ QF+P     +A+D D DGK D+  S+ DA+ASAA +L   GW +   + 
Sbjct: 231 GQTQFIPTTYNTHAVDFDGDGKRDIWNSSADALASAAHYLQASGWKQGQPWG 282


>gi|319762822|ref|YP_004126759.1| lytic murein transglycosylase [Alicycliphilus denitrificans BC]
 gi|317117383|gb|ADU99871.1| lytic murein transglycosylase [Alicycliphilus denitrificans BC]
          Length = 442

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 68/215 (31%), Positives = 109/215 (50%), Gaps = 2/215 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
            +DT   F  W  A    A+  G+  +T   + A  ++    +  DR        +   Y
Sbjct: 66  TADTIAGFHAWLEAFAREALAAGIHTQTVDAMLARAQWQPRVVELDRAQPE-FTRTPWAY 124

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           LD   S + +AQG   ++ ++  L   ++ YGVP  I+ A+WG+E+++G   G    +  
Sbjct: 125 LDSAVSPQRVAQGREQRRLHAAALEAAEQRYGVPASIITAIWGMESNYGRNFGSFSTIDA 184

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDA 213
           LATLAYD RR  +   +   AL +V +G +++ A +G+  G +G  QFLP   +++A+DA
Sbjct: 185 LATLAYDGRRRDWARGELLAALRIVDQGDMAADALVGSWAGAMGHTQFLPSVFLRFAVDA 244

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           D DG+ D+  S  D  AS A FLA  GW     + 
Sbjct: 245 DGDGRRDIWGSVPDVAASTANFLAHSGWKSGQPWG 279



 Score = 50.6 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  L  +N S+NY   +  +A  IDG 
Sbjct: 340 PNFRALLRYNNSVNYALAVGLLARRIDGG 368


>gi|254708118|ref|ZP_05169946.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           M163/99/10]
 gi|256031981|ref|ZP_05445595.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           M292/94/1]
 gi|256061502|ref|ZP_05451646.1| Putative peptidoglycan binding domain 1 [Brucella neotomae 5K33]
          Length = 372

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 77/308 (25%), Positives = 115/308 (37%), Gaps = 59/308 (19%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
              +    FG+W       A   G+  K               + RDRK  T   ++F +
Sbjct: 2   PKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTE 59

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           +   L S   + +G       + +   ++  YGVP  +L A WGLET +G   G    L+
Sbjct: 60  FSKRLISEARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLN 119

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
            L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D 
Sbjct: 120 ALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDG 179

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNFAILK--------- 258
           D DGK+DL  S  DA+ +A + L++LGW +   +               ++         
Sbjct: 180 DGDGKVDLKNSVPDAMMTAGRMLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWW 239

Query: 259 ------------------------------------------HWNASLNYNKTIAYIAAH 276
                                                      WN S+ Y  T AY A  
Sbjct: 240 AEHGVTGLNGPLGPDDGDASLLLPLGRKGPAFLSYPNFDIFVEWNKSIVYATTAAYFATR 299

Query: 277 IDGVPIGK 284
           + G P   
Sbjct: 300 LAGAPAFD 307


>gi|254714480|ref|ZP_05176291.1| Putative peptidoglycan binding domain 1 [Brucella ceti M644/93/1]
 gi|254717378|ref|ZP_05179189.1| Putative peptidoglycan binding domain 1 [Brucella ceti M13/05/1]
          Length = 372

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 77/308 (25%), Positives = 115/308 (37%), Gaps = 59/308 (19%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
              +    FG+W       A   G+  K               + RDRK  T   ++F +
Sbjct: 2   PKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTE 59

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           +   L S   + +G       + +   ++  YGVP  +L A WGLET +G   G    L+
Sbjct: 60  FSKRLISEARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLN 119

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
            L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D 
Sbjct: 120 ALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDG 179

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNFAILK--------- 258
           D DGK+DL  S  DA+ +A + L++LGW +   +               ++         
Sbjct: 180 DGDGKVDLKNSVPDAMMTAGRMLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWW 239

Query: 259 ------------------------------------------HWNASLNYNKTIAYIAAH 276
                                                      WN S+ Y  T AY A  
Sbjct: 240 AEHGVTGLNGPLGPDDGDASLLLPLGRKRPAFLSYPNFDIFVEWNKSIVYATTAAYFATR 299

Query: 277 IDGVPIGK 284
           + G P   
Sbjct: 300 LAGAPAFD 307


>gi|268589704|ref|ZP_06123925.1| type III effector HopAJ2 [Providencia rettgeri DSM 1131]
 gi|291314934|gb|EFE55387.1| type III effector HopAJ2 [Providencia rettgeri DSM 1131]
          Length = 362

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 66/233 (28%), Positives = 113/233 (48%), Gaps = 3/233 (1%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA 78
            A A           I      +F  +    +  A+ +G+ P T +  FA++ +++  + 
Sbjct: 37  AAIAQEVVALDKAFPIEQREPSQFPAYVELLKEHAITQGIKPDTIERAFANVHFIERVVK 96

Query: 79  RDRKMVTSP-PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
            D+        ++   YL  +     I  G      N  +L  +  +YG+PP  +++LWG
Sbjct: 97  ADKGQPEKRATITLASYLKNVLPQSRINAGYDKYLENKSILDAISDKYGIPPQFIVSLWG 156

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL--GATFGE 195
           LE+ FG + GK  ++S LATL+++ RR   F++Q   AL+++ KG I       G+  G 
Sbjct: 157 LESGFGRSQGKEDVVSALATLSFEGRREALFSKQLLAALEIMDKGYIPEDQQLKGSWAGA 216

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           +GQ QF+P + + YA D D DGK+D+  +  D  AS A +L+  GW     + 
Sbjct: 217 MGQSQFMPTSYLSYAADGDGDGKMDIWNNKSDVFASIANYLSTEGWQAPLPWG 269


>gi|192293240|ref|YP_001993845.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
 gi|192286989|gb|ACF03370.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
          Length = 442

 Score =  185 bits (469), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 92/339 (27%), Positives = 135/339 (39%), Gaps = 62/339 (18%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICS-DTADRFGEWKSAARARAVREGMSPK 61
            K     S L ++ P LA A+     A  Q   S      F ++ +  + +AV  G+S  
Sbjct: 1   MKLLTRPSKLPLIAPFLALALVAVSPALAQRGASCHGGQSFPQFLAGLKQKAVAAGVSQG 60

Query: 62  TAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
                   L Y    + RDR         F  +   ++S     +G  L K  ++     
Sbjct: 61  AIAEASPYLVYDQGIVNRDRGQR-VFGQIFTVFAGRMASEGRRVKGQQLIKQYAQAFARA 119

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +KEYGVPP ++ A W LE+ FG   G  P L +L +LAYDCRR++ F ++   AL ++ +
Sbjct: 120 EKEYGVPPAVIAAFWALESDFGAVQGNLPTLRSLVSLAYDCRRSEMFQDETIAALKIIDR 179

Query: 182 GVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLA-KL 239
           G ++    +G+  GE+GQ QFLP +   YA+D D DG  DL+ S  D I S A ++A  L
Sbjct: 180 GDLTPGEMIGSWAGELGQTQFLPRHYFDYAVDYDGDGHRDLLHSAPDVIGSTANYIATGL 239

Query: 240 GWTKC------------AGYQPG------------------------------------- 250
            W +               +                                        
Sbjct: 240 KWRRGEPWLQEVRVPENLPWDQADLTVKHPRSQWAQWGVTTADGRPLSNDALPASLLLPM 299

Query: 251 ---------EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                      NFA    WN SL Y+ T AY+A  I G 
Sbjct: 300 GRHGPAFLAYANFAAYTEWNNSLIYSTTAAYLATRIAGA 338


>gi|260574123|ref|ZP_05842128.1| lytic murein transglycosylase [Rhodobacter sp. SW2]
 gi|259023589|gb|EEW26880.1| lytic murein transglycosylase [Rhodobacter sp. SW2]
          Length = 417

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 72/240 (30%), Positives = 107/240 (44%), Gaps = 4/240 (1%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           +L      LAQA               T      W +  R RA+  G+S  T    F  +
Sbjct: 19  VLAFFAAPLAQAQEGKGGVELAETAG-TDAGLQAWIAGFRPRALAMGISEATFDQAFRGV 77

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
            +    I RDR        +   YLD  +S + +  G    +A+  LL  ++  YGV   
Sbjct: 78  AFNAQVIDRDRHQAE-FTKTIWAYLDIATSDDRVNAGRKALQAHGPLLQRIEDTYGVDKH 136

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHAL 189
           IL+A+WGLET +G   G   L+  LA+LAYD RR  FF  +   AL +V+ G       +
Sbjct: 137 ILLAVWGLETSYGAVRGNYGLIEALASLAYDGRRRSFFETELLAALKIVQSGDARLEEMI 196

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ 248
            +  G  G  QF+P + + +A+D + DG+ D+      DA+AS A +L   GW     + 
Sbjct: 197 CSWAGATGHTQFMPSSYLAHAVDFNGDGRRDIWGDDPADALASTAAYLRHFGWQAGQHWG 256



 Score = 49.9 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 8/32 (25%), Positives = 16/32 (50%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVPIGK 284
           NF  ++ +N +  Y   + ++A  I G P  +
Sbjct: 318 NFTAIEAYNPADAYVIGVGHLADRIAGGPPIQ 349


>gi|37679243|ref|NP_933852.1| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           YJ016]
 gi|320157013|ref|YP_004189392.1| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           MO6-24/O]
 gi|326423660|ref|NP_759141.2| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           CMCP6]
 gi|37197986|dbj|BAC93823.1| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           YJ016]
 gi|319932325|gb|ADV87189.1| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           MO6-24/O]
 gi|319999012|gb|AAO08668.2| Membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           CMCP6]
          Length = 323

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 67/310 (21%), Positives = 120/310 (38%), Gaps = 64/310 (20%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
                  + F ++    +A+A  EG+S +T +  F D+++    +  DR        +  
Sbjct: 15  SSAWANTESFEQYLERLKAQAAEEGISAQTIEQAFRDVQFKPRAVKADRNQPEK-KQTLD 73

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           +YL        + Q   L   +   L  +   YGV    ++ALWG+E++FG+  G  P++
Sbjct: 74  EYLPRAVPDWKVKQAKDLYAKHYAELSQIADRYGVQARFIVALWGVESNFGKFTGNFPVV 133

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
             L+T+AY+ RR  FF  +   AL ++ +G I   +  G+  G +GQ QF+P + + YA 
Sbjct: 134 DALSTMAYEGRREAFFRAETMAALKILDQGHIEFENFKGSWAGAMGQCQFMPSSFLAYAA 193

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ----------------------- 248
           D + DGK D+  +  D  AS A +L++ GW     +                        
Sbjct: 194 DGNGDGKKDIWNTKADVFASTASYLSQSGWDDKYTWGRQVRVPKGFDLELEGREEAKGKY 253

Query: 249 ------------------------------PGEKNFAILKHWNA---------SLNYNKT 269
                                         P ++N      +N          S  +   
Sbjct: 254 LQEWKKLGITSINGRPLPKLNEDIKAWLVMPDDENGRAYLVYNNYNVLMKWNRSHYFALA 313

Query: 270 IAYIAAHIDG 279
           ++++A  I  
Sbjct: 314 VSHLADRIKN 323


>gi|170740072|ref|YP_001768727.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
 gi|168194346|gb|ACA16293.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
          Length = 391

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 73/295 (24%), Positives = 115/295 (38%), Gaps = 54/295 (18%)

Query: 40  DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLS 99
           D F  +    R  A   G++ +T    F ++   D  +    +          +YL G  
Sbjct: 22  DGFRGFIEGLRPLATARGVARETFDAAFREVTAPDPAVLARLRRQGEFSRPVWEYLAGSV 81

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S+  +A+G A     + LL  L+  YGVP  +L+A+WG+E+ FG   G  P +  LATLA
Sbjct: 82  STARVARGRAEAARRAELLAGLEARYGVPGPVLLAVWGMESDFGTGTGSVPTVRALATLA 141

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
               R   F ++   ALD+++   +      G+  G +GQ QFLP   ++ A+D D DG+
Sbjct: 142 QAGHRGDLFRDELLAALDILQHHDVGPEGLKGSWAGAMGQTQFLPSVYLRAAVDFDGDGR 201

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK-------------------------- 252
            D+  S  DA+AS A FL + GW     +    +                          
Sbjct: 202 RDIWNSAPDALASIANFLRQAGWQPGLPWGLEVRLPAGFDLSRHRGSLAEFAARGVARAD 261

Query: 253 ---------------------------NFAILKHWNASLNYNKTIAYIAAHIDGV 280
                                      NF   + +N S  Y   + ++A  I G 
Sbjct: 262 GAALPAAGEASLFLPGGLGGPAFLITVNFEAFRAYNTSDAYALAVGHLADRIAGG 316


>gi|254464355|ref|ZP_05077766.1| putative transglycolase [Rhodobacterales bacterium Y4I]
 gi|206685263|gb|EDZ45745.1| putative transglycolase [Rhodobacterales bacterium Y4I]
          Length = 389

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 80/324 (24%), Positives = 119/324 (36%), Gaps = 64/324 (19%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
           + P        P  A  Q         F  +    +  AV+ G    T    F       
Sbjct: 3   LLPFALAVSLLPAAAAAQ-----CGGGFQNFVKLLKDEAVQAGYGVTTVNAFFDGTRQNR 57

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
             +  DR         F D+   L S + + +G+ + K +      ++  YG+  G+L+A
Sbjct: 58  RVLEADRAQG-VFQKPFIDFSRRLISQDRLRRGLQMSKKHDSTFQRIESTYGISRGVLLA 116

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATF 193
            W LET +G   G       L TLA+DCRR + F  Q F AL++ ++G        GA  
Sbjct: 117 FWALETDYGGYQGDFNTRDALVTLAHDCRRPELFRPQVFAALEMYRQGNFDPKRTTGAWA 176

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC--------- 244
           GEIG  Q LP +++++ +DAD DGK+ L  S  DA+ S A+ L+ LGW            
Sbjct: 177 GEIGMVQMLPSDILEHGVDADGDGKVSLKTSAADALMSGARMLSHLGWQPGQPWLQEVTI 236

Query: 245 -----------------AGYQP-------------------------------GEKNFAI 256
                            A ++                                   NF +
Sbjct: 237 PEGMDLSLTGTARKKTVADWRALGVAARDGSLPEPSMRASLLLPQGHKGPAFLAYPNFDV 296

Query: 257 LKHWNASLNYNKTIAYIAAHIDGV 280
              WN S  Y  T AY A  ++G 
Sbjct: 297 YFEWNQSFTYALTAAYFANRLEGA 320


>gi|86137246|ref|ZP_01055824.1| hypothetical protein MED193_16267 [Roseobacter sp. MED193]
 gi|85826570|gb|EAQ46767.1| hypothetical protein MED193_16267 [Roseobacter sp. MED193]
          Length = 389

 Score =  185 bits (468), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 79/326 (24%), Positives = 115/326 (35%), Gaps = 64/326 (19%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
           + P+   A+  P  A  Q         F  +  + +  A+  G    T    F       
Sbjct: 3   LLPLAFAALMMPATAFAQ-----CGGSFSGFVKSLKQEALTAGYDRTTVNGFFKGARQDP 57

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
             +  DR         F ++   L S   I +G ++ +        ++  YG+  G+L+A
Sbjct: 58  KVLRADRAQG-VFQKPFIEFSRRLISQSRINRGRSMAEKYDSTFRRIETTYGIDRGVLLA 116

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATF 193
            W  ET +G   G       L TLA+DCRR + F  Q F AL+L K+G        GA  
Sbjct: 117 FWAFETDYGSFQGDFNTRDALITLAHDCRRPELFRPQIFAALELYKRGNFDPARTTGAWA 176

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG------- 246
           GEIG  Q LP +++   +DAD DG + L  S  DA+ S  K L+ LGW            
Sbjct: 177 GEIGMVQMLPQDILDNGVDADGDGHVSLKTSAPDALMSGGKMLSHLGWQAGQPWLQEVTI 236

Query: 247 -------------------YQP-------------------------------GEKNFAI 256
                              +Q                                   NF +
Sbjct: 237 PAGLDLSKSGTNTKLSVKDWQALGLRAKEGRLASGNLKASLLLPQGHKGPAFLAYPNFDV 296

Query: 257 LKHWNASLNYNKTIAYIAAHIDGVPI 282
              WN S  Y  T AY A  ++G  +
Sbjct: 297 YFEWNQSFTYVLTAAYFANRLEGASV 322


>gi|95930147|ref|ZP_01312886.1| Lytic murein transglycosylase [Desulfuromonas acetoxidans DSM 684]
 gi|95133841|gb|EAT15501.1| Lytic murein transglycosylase [Desulfuromonas acetoxidans DSM 684]
          Length = 340

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 66/216 (30%), Positives = 110/216 (50%), Gaps = 3/216 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL-EYLDTTIARDRKMVTSPPVSFKD 93
            +  +++F EW +  R  A+  G+S  T  +  + + +     I  DR        + + 
Sbjct: 35  AATASNQFTEWLAVLRQDAIAAGISATTVDNALSGIRQPKKKVIHHDRNQPE-KKATLQR 93

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y+ G  +   I  G  + +     L  +++ YGVP   L+ALWG+ETH+G   G   ++ 
Sbjct: 94  YMAGKINGTRIEHGRTMLERYPTWLTRVEQRYGVPRRYLIALWGIETHYGAYSGNFSVIQ 153

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
            LATLAYD RR  +F ++   AL ++ +G +S +   G+  G +GQ QF+P +   YAID
Sbjct: 154 ALATLAYDSRRGDYFRKELLKALQILDEGHVSLARMKGSWAGAMGQCQFMPSSFYHYAID 213

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            ++DG+ID+  +  D  AS A +L K  W     + 
Sbjct: 214 GNKDGRIDIWATIPDIFASMANYLEKAHWQTGQTWG 249


>gi|260755169|ref|ZP_05867517.1| lytic Murein transglycosylase [Brucella abortus bv. 6 str. 870]
 gi|260758388|ref|ZP_05870736.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260762214|ref|ZP_05874557.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260668706|gb|EEX55646.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260672646|gb|EEX59467.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675277|gb|EEX62098.1| lytic Murein transglycosylase [Brucella abortus bv. 6 str. 870]
          Length = 399

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 77/312 (24%), Positives = 115/312 (36%), Gaps = 59/312 (18%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                  +    FG+W       A   G+  K               + RDRK  T   +
Sbjct: 25  AVNMPKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNL 82

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F ++   L S   + +G       + +   ++  YGVP  +L A WGLET +G   G  
Sbjct: 83  TFTEFSKRLISEARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDF 142

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
             L+ L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++ 
Sbjct: 143 DTLNALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLER 202

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNFAILK----- 258
            +D D DGK+DL  S  DA+ +A + L++LGW +   +               ++     
Sbjct: 203 GVDGDGDGKVDLKNSVPDAMMTAGRMLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKP 262

Query: 259 ----------------------------------------------HWNASLNYNKTIAY 272
                                                          WN S+ Y  T AY
Sbjct: 263 HSWWAEHGVTGLNGPLGPDDGDASLLLPLGRKGPAFLSYLNFDIFVEWNKSIVYATTAAY 322

Query: 273 IAAHIDGVPIGK 284
            A  + G P   
Sbjct: 323 FATRLAGAPAFD 334


>gi|183599030|ref|ZP_02960523.1| hypothetical protein PROSTU_02475 [Providencia stuartii ATCC 25827]
 gi|188021246|gb|EDU59286.1| hypothetical protein PROSTU_02475 [Providencia stuartii ATCC 25827]
          Length = 360

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 73/262 (27%), Positives = 122/262 (46%), Gaps = 21/262 (8%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQ------------------FICSDTADRFGEWKSAA 49
           L+  L+    + + +  QP   T Q                   +      +F  +    
Sbjct: 6   LLFTLISGLFLASCSAKQPILVTPQAEQDAMIAKEVIALNKAFPLEEREPSQFPAYVELL 65

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSP-PVSFKDYLDGLSSSEIIAQGI 108
           +  A+ +G+ P T +  FA + +++  +  D+        V+ + YL  +  +  I  G 
Sbjct: 66  KEHALAQGIQPATIERGFAHIHFIERVVKADKGQPEKRATVTLESYLKNVLPASRINAGA 125

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
                N  LL  +   YGVPP  ++ALWGLE+ FG + GK  ++S LATL+++ RR   F
Sbjct: 126 EKYWENESLLNAISHRYGVPPQYIVALWGLESGFGRSQGKEDVISALATLSFEGRREALF 185

Query: 169 TEQFFYALDLVKKGVISSHAL--GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           ++Q   AL+++ KG I       G+  G +GQ QF+P + + YA D D DGK+D+  +  
Sbjct: 186 SKQLLAALEIMDKGYIPEEQQLKGSWAGAMGQSQFMPTSYLSYAADGDGDGKMDIWNNKA 245

Query: 227 DAIASAAKFLAKLGWTKCAGYQ 248
           D  AS A +L+  GW     + 
Sbjct: 246 DVFASIANYLSTEGWQSALPWG 267


>gi|166710102|ref|ZP_02241309.1| transglycolase; epimerase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 720

 Score =  185 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 76/303 (25%), Positives = 123/303 (40%), Gaps = 64/303 (21%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F    +  + +A  +G+ P   +   A L    + +               DYL  L  S
Sbjct: 25  FDRCLAGLQTQAAAKGVDPAGFQRFTAGLVPDPSVLPLLDAQPE-FTTPIWDYLASLVDS 83

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           + +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL +LATL+  
Sbjct: 84  QRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGVESDYGRVTGKRPLLVSLATLSCA 143

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF ++F   L L+++G +++    G+  G  GQ QF+P    + A+D D DG+ D
Sbjct: 144 GRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFGQTQFMPSTYTRIAVDGDGDGRRD 203

Query: 221 LVKSNIDAIASAAKFLAKLG------W--------------------TKCAGYQPGE--- 251
           LV S  DA+AS A +L K G      W                         +Q      
Sbjct: 204 LVASIPDALASTANYLVKAGWERARPWGMEVTLPRGFDASKAGRTRRQPLQAWQTAGLLG 263

Query: 252 ---------------------------------KNFAILKHWNASLNYNKTIAYIAAHID 278
                                            +N+  +  +NA+ +Y  +IA +A  + 
Sbjct: 264 TDGKPLAPIGLPAETPAALLLPAGATGPAFLVFRNYDAIYAYNAAESYALSIALLADRLR 323

Query: 279 GVP 281
           G P
Sbjct: 324 GGP 326


>gi|332992450|gb|AEF02505.1| putative transglycosylase [Alteromonas sp. SN2]
          Length = 329

 Score =  185 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 79/281 (28%), Positives = 132/281 (46%), Gaps = 14/281 (4%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K+L  SLLM+   + +    Q +  T +         F E+ +A +A A ++G       
Sbjct: 3   KWLKASLLMVAGVLASIGFAQAEDKTAK--------GFAEYVTALKAEAQQKGFDESLLN 54

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F+D+ +  T I  D+       ++   YL        + Q + +   +  LL  + K+
Sbjct: 55  DAFSDISFRPTVIKSDKNQPEK-KITLDSYLASRVPDWKVQQAVEMYNKHKPLLEEIGKK 113

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           + V P  ++ALWG E++FG   G   +LS LA+LAY+ RR K F +  F AL ++ +G  
Sbjct: 114 FQVQPRFIVALWGNESNFGRIQGNYSVLSALASLAYEGRREKLFKDNLFAALTILDEGHT 173

Query: 185 SSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           S  A  G+  G +GQ QF+P++ + YA+D D DG+ D+ ++  D  AS A +L+  GW  
Sbjct: 174 SVDALKGSWAGAMGQSQFMPISFLNYAVDYDGDGRKDIWQTEADVFASIANYLSSEGWDY 233

Query: 244 CAGYQPGEKNFAILKHWNASLNYNKTIAYI----AAHIDGV 280
              +         +K +  S +  K +A          DG 
Sbjct: 234 NGTWGRQVSLTQPIKEFGLSKSLYKPLADWQQAGVRRFDGS 274


>gi|119470943|ref|ZP_01613527.1| putative periplasmic lytic murein transglycosylase [Alteromonadales
           bacterium TW-7]
 gi|119445965|gb|EAW27245.1| putative periplasmic lytic murein transglycosylase [Alteromonadales
           bacterium TW-7]
          Length = 338

 Score =  185 bits (468), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 66/236 (27%), Positives = 109/236 (46%), Gaps = 9/236 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           +   +    ++    A TQ         F ++    +  A+ +G         FA   Y 
Sbjct: 5   LAVVLCGLCLSSSVVAKTQ-------AEFKDYLVNLKEEAIAKGYETSLIDSAFATATYK 57

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
           +  ++ D+        + + YL        I +   L   N  +L  + KE+GV    ++
Sbjct: 58  EKVVSADKNQPEV-KETLETYLPKRVPQWKIDRARKLYAENKDILEQVAKEFGVQARFIV 116

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GAT 192
           ALWGLE++FG   G   ++S+L TLA+D RR   +  Q + ALD++K G I+     G+ 
Sbjct: 117 ALWGLESNFGTIQGGHNVISSLVTLAFDGRREALYKRQLWAALDILKSGHITLDKFKGSW 176

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            G +GQ QF+P +   YAID + DG+ D+  +  DA AS A +L + GW     + 
Sbjct: 177 AGAMGQTQFMPTSFNAYAIDYNNDGRKDIWTTKEDAFASIANYLKQEGWNDSLTWG 232



 Score = 38.7 bits (88), Expect = 0.95,   Method: Composition-based stats.
 Identities = 8/28 (28%), Positives = 15/28 (53%)

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHI 277
              N+ +L HWN S  +  ++ Y++  I
Sbjct: 306 AYDNYKVLMHWNRSYYFATSVGYLSDRI 333


>gi|84621918|ref|YP_449290.1| transglycolase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|122879006|ref|YP_198927.6| transglycolase; epimerase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|188579109|ref|YP_001916038.1| transglycolase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84365858|dbj|BAE67016.1| transglycolase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188523561|gb|ACD61506.1| transglycolase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 720

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 75/303 (24%), Positives = 123/303 (40%), Gaps = 64/303 (21%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F    +  + +A  +G+ P   +   A L    + +               DYL  L  +
Sbjct: 25  FDRCLAGLQTQAAAKGVDPAGFQRFTAGLVPDPSVLPLLDAQPE-FTTPIWDYLASLVDN 83

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           + +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL +LATL+  
Sbjct: 84  QRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGVESDYGRVTGKRPLLVSLATLSCA 143

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF ++F   L L+++G +++    G+  G  GQ QF+P    + A+D D DG+ D
Sbjct: 144 GRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFGQTQFMPSTYTRIAVDGDGDGRRD 203

Query: 221 LVKSNIDAIASAAKFLAKLG------W--------------------TKCAGYQPGE--- 251
           LV S  DA+AS A +L K G      W                         +Q      
Sbjct: 204 LVASIPDALASTANYLVKAGWERARPWGMEVTLPRGFDASKAGRTRRQPLQAWQTAGLLG 263

Query: 252 ---------------------------------KNFAILKHWNASLNYNKTIAYIAAHID 278
                                            +N+  +  +NA+ +Y  +IA +A  + 
Sbjct: 264 TDGKPLAPIGLPAETPAALLLPAGATGPAFLVFRNYDAIYAYNAAESYALSIALLADRLR 323

Query: 279 GVP 281
           G P
Sbjct: 324 GGP 326


>gi|222087083|ref|YP_002545618.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
 gi|221724531|gb|ACM27687.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
          Length = 407

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 72/309 (23%), Positives = 125/309 (40%), Gaps = 63/309 (20%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPVSF 91
            I ++    F +W +   + A + G++  T ++ FA +     T + + +          
Sbjct: 26  PINANADPGFQKWIAGFYSTAAKSGITQSTYRNAFAGVTDPDPTVLEKAQYQPE-FKSQI 84

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK--- 148
            DYLD   +   +  G  +       L +L++ +GV   I++A+W +E+++G  + K   
Sbjct: 85  WDYLDSRVNPYTVDVGRKMATKYGSTLRSLEQHFGVDRNIMLAIWSMESNYGAVLAKEEK 144

Query: 149 -TPLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVN 205
              +   LATLAY D +RA +  +Q   AL +++ G I      G+  G +G  QF+P +
Sbjct: 145 LHYVPRALATLAYADPKRANYAKKQLIAALKILQNGDISRKELTGSWAGAMGHTQFIPTS 204

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ----------------- 248
            + YA+DAD  G  D+  S  DA+A+ A  LAK GW+    +                  
Sbjct: 205 YLLYAVDADGSGHADIWNSIPDALATTANLLAKNGWSTGHTWGYEVTVPPGGSAQTGKTR 264

Query: 249 -----------------------------PGEK---------NFAILKHWNASLNYNKTI 270
                                        PG           NF  +K +NAS +Y   +
Sbjct: 265 TLAQWAALGFARPSGKGFRLNSERAQLKMPGGPNGPGFLMTSNFFTIKRYNASDSYAIAV 324

Query: 271 AYIAAHIDG 279
             +A  + G
Sbjct: 325 GLLADQLAG 333


>gi|86751619|ref|YP_488115.1| lytic murein transglycosylase [Rhodopseudomonas palustris HaA2]
 gi|86574647|gb|ABD09204.1| Lytic murein transglycosylase [Rhodopseudomonas palustris HaA2]
          Length = 464

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 68/313 (21%), Positives = 115/313 (36%), Gaps = 60/313 (19%)

Query: 28  KATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSP 87
              T     + A  F    +     A R G+S  +     A L      +          
Sbjct: 80  PTMTAQAIREAAANFDNCVAGFWPDAQRRGISRDSFARFTAGLSPDLRLMDLMDSQPE-F 138

Query: 88  PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
             +  +YLD L +   +A+G  +          +++ YGV   I+ ++WG+E+++   MG
Sbjct: 139 TKAIWEYLDILVNDNRMARGREILAQYKPQFDAVERAYGVDRYIIASIWGIESNYSTQMG 198

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNV 206
              +L++ ATLA   RR  +F ++F  AL+++ +G +      G+  G  G  QF+P   
Sbjct: 199 DRYVLNSTATLACVGRRQNYFKDEFLTALEILHRGDLRPEQLRGSWAGAFGPTQFMPTAF 258

Query: 207 VKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT------------------------ 242
            ++A+DAD DG+ D+V +  D IAS A  L K GW                         
Sbjct: 259 KRFAVDADGDGRRDVVDNPADLIASTANNLKKDGWQSGQTWGYEVAVPRGFDYMKADRKQ 318

Query: 243 ---------------KCAGYQPG-------------------EKNFAILKHWNASLNYNK 268
                              +  G                     NF ++  +N +  Y  
Sbjct: 319 MLTLARWEELGVRRPNGQPFPRGGEKAYLLAPAGAEGPGFLMLTNFRVIMKYNPAEAYAL 378

Query: 269 TIAYIAAHIDGVP 281
            I + A  + G P
Sbjct: 379 AIGHFADRLRGGP 391


>gi|254562224|ref|YP_003069319.1| membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
 gi|254269502|emb|CAX25468.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
          Length = 413

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 71/319 (22%), Positives = 123/319 (38%), Gaps = 64/319 (20%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
           P  A  +         F     A +  A   G+    A+   + +    + +   +    
Sbjct: 18  PIPARAEAPTDPAPPDFAYCLGALKTLAEERGVPRTVAETALSGIAPDPSVVPATQSQAE 77

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
                  +Y++   + E IA G A     S +L  ++  YGV   IL+A WG+E+++G  
Sbjct: 78  -FVKPVWEYIEASVTPERIATGQARLAQWSEVLGRIEAAYGVDRHILVAFWGVESNYGAA 136

Query: 146 MGK---TPLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQ 200
           +      P++S LATLA  D  R   + ++   AL ++  G   +  + G+  G +G  Q
Sbjct: 137 LEGAGIRPVVSALATLACGDPARPGLWRDELVAALKILADGDADAERMRGSWAGAMGHTQ 196

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL------GW------------- 241
           F+P   +++A+D D DG+ D+  S  DA+AS A FL +       GW             
Sbjct: 197 FMPTAFLRHAVDFDGDGRRDIWHSVPDALASTANFLKQSGWRVGEGWGLEVLLPDGFDYR 256

Query: 242 -------TKCAGYQPG--------------------------------EKNFAILKHWNA 262
                     A +Q                                  E NF ++  +N 
Sbjct: 257 VADETTERPFAEWQRLGLKPANGAFPDGAERRAALLLPTGAKGPAFLLEPNFRVILRYNT 316

Query: 263 SLNYNKTIAYIAAHIDGVP 281
           +L Y  T+A+++  + G P
Sbjct: 317 ALAYALTVAHLSDRLRGAP 335


>gi|261315622|ref|ZP_05954819.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261318059|ref|ZP_05957256.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261297282|gb|EEY00779.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261304648|gb|EEY08145.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
          Length = 399

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 77/312 (24%), Positives = 115/312 (36%), Gaps = 59/312 (18%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                  +    FG+W       A   G+  K               + RDRK  T   +
Sbjct: 25  AVNMPKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNL 82

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F ++   L S   + +G       + +   ++  YGVP  +L A WGLET +G   G  
Sbjct: 83  TFTEFSKRLISEARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDF 142

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
             L+ L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++ 
Sbjct: 143 DTLNALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLER 202

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNFAILK----- 258
            +D D DGK+DL  S  DA+ +A + L++LGW +   +               ++     
Sbjct: 203 GVDGDGDGKVDLKNSVPDAMMTAGRMLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKP 262

Query: 259 ----------------------------------------------HWNASLNYNKTIAY 272
                                                          WN S+ Y  T AY
Sbjct: 263 HSWWAEHGVTGLNGPLGPDDGDASLLLPLGRKGPAFLSYPNFDIFVEWNKSIVYATTAAY 322

Query: 273 IAAHIDGVPIGK 284
            A  + G P   
Sbjct: 323 FATRLAGAPAFD 334


>gi|170742187|ref|YP_001770842.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
 gi|168196461|gb|ACA18408.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
          Length = 423

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 70/321 (21%), Positives = 117/321 (36%), Gaps = 66/321 (20%)

Query: 31  TQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
                 +    F    +   A A   G+   T   L  DL      +A            
Sbjct: 36  APPPAGEAVPGFARCLTDLAAEATGRGVPEATVSALLGDLAPDPEVLAAAGHQSE-FEKP 94

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT- 149
             DYLD     E +A G A   A   +L  ++  YGV   +L+A+WG+E+ +G  + K  
Sbjct: 95  LWDYLDAAVKDETVADGRAKLAAWEPVLARIEARYGVDRFVLLAIWGIESGYGAVLDKPG 154

Query: 150 ---PLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPV 204
              P+L +LATLA  D  RA  + ++   AL +  +G    +   G+  G +G  QF+P 
Sbjct: 155 KVRPVLRSLATLACADPARAASWRDELAAALRIAAQGDAPVADLTGSWAGAMGHTQFMPT 214

Query: 205 NVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------------------------ 240
             ++YA+D D DG+ D+  S  DA+A+ A +L+  G                        
Sbjct: 215 TYLRYAVDFDGDGRRDIWHSPADALAATAHYLSAEGWPAGAPWGYEVALPPGFAYALADE 274

Query: 241 --------WTK-------CAGYQPG-------------------EKNFAILKHWNASLNY 266
                   W +          +                         F  +  +NAS  Y
Sbjct: 275 TTERPLESWERLGLRRADGQPFAATGVPARLVLPAGARGPAFLLLPGFRAITRYNASFAY 334

Query: 267 NKTIAYIAAHIDG-VPIGKGY 286
              +++++  + G  P+   +
Sbjct: 335 ALAVSHLSDRLRGEGPLVGAW 355


>gi|261219210|ref|ZP_05933491.1| lytic Murein transglycosylase [Brucella ceti M13/05/1]
 gi|261322271|ref|ZP_05961468.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
 gi|260924299|gb|EEX90867.1| lytic Murein transglycosylase [Brucella ceti M13/05/1]
 gi|261294961|gb|EEX98457.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
          Length = 399

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 77/312 (24%), Positives = 115/312 (36%), Gaps = 59/312 (18%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                  +    FG+W       A   G+  K               + RDRK  T   +
Sbjct: 25  AVNMPKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNL 82

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F ++   L S   + +G       + +   ++  YGVP  +L A WGLET +G   G  
Sbjct: 83  TFTEFSKRLISEARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDF 142

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
             L+ L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++ 
Sbjct: 143 DTLNALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLER 202

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNFAILK----- 258
            +D D DGK+DL  S  DA+ +A + L++LGW +   +               ++     
Sbjct: 203 GVDGDGDGKVDLKNSVPDAMMTAGRMLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKP 262

Query: 259 ----------------------------------------------HWNASLNYNKTIAY 272
                                                          WN S+ Y  T AY
Sbjct: 263 HSWWAEHGVTGLNGPLGPDDGDASLLLPLGRKRPAFLSYPNFDIFVEWNKSIVYATTAAY 322

Query: 273 IAAHIDGVPIGK 284
            A  + G P   
Sbjct: 323 FATRLAGAPAFD 334


>gi|294011644|ref|YP_003545104.1| membrane-bound lytic murein transglycosylase B [Sphingobium
           japonicum UT26S]
 gi|292674974|dbj|BAI96492.1| membrane-bound lytic murein transglycosylase B [Sphingobium
           japonicum UT26S]
          Length = 345

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 66/247 (26%), Positives = 112/247 (45%), Gaps = 10/247 (4%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           ++SLL+ +  ++A  +T    +  + +       F  +  + R +A   G+   T   +F
Sbjct: 5   IMSLLLGLAAVMAGGLTADSVSAQEDVA------FRAYLESLRPKARAMGIRDMTLDSVF 58

Query: 68  ADLEYLDTTIARDRKMV----TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
             L      I  D+        +P  +F+ Y      +  I +G     AN   L   + 
Sbjct: 59  PGLTPNPRVIQLDQNQPGGGAYAPIPNFEPYRRQHVDAARIGRGRTAYLANRARLARTEA 118

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
           E GVP  I++A++G ET++G   G   L+ +LATL+Y+ RR   F  +    L ++  GV
Sbjct: 119 ETGVPEEIMVAIYGHETNYGAYTGDFDLIRSLATLSYEGRRRALFEPELLATLKMLDNGV 178

Query: 184 ISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
             S  +G+  G  G  QFLP   ++   D D DG++D+  S  DA+AS A +    GW +
Sbjct: 179 PRSRLVGSWAGATGYPQFLPSVYLRLGRDGDGDGRVDIWNSEADALASIANYFVHAGWRR 238

Query: 244 CAGYQPG 250
              +   
Sbjct: 239 GQPWGIA 245



 Score = 37.2 bits (84), Expect = 2.7,   Method: Composition-based stats.
 Identities = 10/73 (13%), Positives = 20/73 (27%), Gaps = 10/73 (13%)

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLN 265
             +  I     G         D + +    L   G            N+  +  +N S  
Sbjct: 282 WRRMGIVPSGGGW------PADRVMAT--LLEPDG--PGKTAYLLTSNYRAILDYNCSNF 331

Query: 266 YNKTIAYIAAHID 278
           Y  ++  +A  + 
Sbjct: 332 YALSVGLLADAVK 344


>gi|58424505|gb|AAW73542.1| transglycolase; epimerase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 772

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 75/303 (24%), Positives = 123/303 (40%), Gaps = 64/303 (21%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F    +  + +A  +G+ P   +   A L    + +               DYL  L  +
Sbjct: 77  FDRCLAGLQTQAAAKGVDPAGFQRFTAGLVPDPSVLPLLDAQPE-FTTPIWDYLASLVDN 135

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           + +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL +LATL+  
Sbjct: 136 QRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGVESDYGRVTGKRPLLVSLATLSCA 195

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF ++F   L L+++G +++    G+  G  GQ QF+P    + A+D D DG+ D
Sbjct: 196 GRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFGQTQFMPSTYTRIAVDGDGDGRRD 255

Query: 221 LVKSNIDAIASAAKFLAKLG------W--------------------TKCAGYQPGE--- 251
           LV S  DA+AS A +L K G      W                         +Q      
Sbjct: 256 LVASIPDALASTANYLVKAGWERARPWGMEVTLPRGFDASKAGRTRRQPLQAWQTAGLLG 315

Query: 252 ---------------------------------KNFAILKHWNASLNYNKTIAYIAAHID 278
                                            +N+  +  +NA+ +Y  +IA +A  + 
Sbjct: 316 TDGKPLAPIGLPAETPAALLLPAGATGPAFLVFRNYDAIYAYNAAESYALSIALLADRLR 375

Query: 279 GVP 281
           G P
Sbjct: 376 GGP 378


>gi|330824901|ref|YP_004388204.1| lytic murein transglycosylase [Alicycliphilus denitrificans K601]
 gi|329310273|gb|AEB84688.1| lytic murein transglycosylase [Alicycliphilus denitrificans K601]
          Length = 442

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 67/215 (31%), Positives = 108/215 (50%), Gaps = 2/215 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
            +DT   F  W  A    A+  G+  +T   + A  ++    +  DR        +   Y
Sbjct: 66  TADTIAGFHAWLEAFAREALAAGIHTQTVDAMLARAQWQPRVVELDRAQPE-FTRTPWAY 124

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           LD   S + +AQG   ++ ++  L   ++ YGVP  I+ A+WG+E+++G   G    +  
Sbjct: 125 LDSAVSPQRVAQGREQRRLHAAALEAAEQRYGVPASIITAIWGMESNYGRNFGSFSTIDA 184

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDA 213
           LATLAYD RR  +   +    L +V +G +++ A +G+  G +G  QFLP   +++A+DA
Sbjct: 185 LATLAYDGRRRDWARGELLATLRIVDQGDMAADALVGSWAGAMGHTQFLPSVFLRFAVDA 244

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           D DG+ D+  S  D  AS A FLA  GW     + 
Sbjct: 245 DGDGRRDIWGSVPDVAASTANFLAHSGWKSGQPWG 279



 Score = 50.6 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  L  +N S+NY   +  +A  IDG 
Sbjct: 340 PNFRALLRYNNSVNYALAVGLLARRIDGG 368


>gi|254719477|ref|ZP_05181288.1| Putative peptidoglycan binding domain 1 [Brucella sp. 83/13]
 gi|306839256|ref|ZP_07472073.1| lytic murein transglycosylase [Brucella sp. NF 2653]
 gi|306405803|gb|EFM62065.1| lytic murein transglycosylase [Brucella sp. NF 2653]
          Length = 410

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 80/347 (23%), Positives = 121/347 (34%), Gaps = 65/347 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAV 54
           M     +L + L     +                        +    FG+W       A 
Sbjct: 1   MKIIASVLAAALFASTALSGAGAATTPAPAAATDNAVNMPKPECETDFGQWMENLTREAR 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
             G+  K               + RDRK  T   ++F ++   L S   + +G       
Sbjct: 61  EAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNLTFTEFSKRLISDARLKKGQENLVKY 118

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q   
Sbjct: 119 ADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIA 178

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
            L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A +
Sbjct: 179 LLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGR 238

Query: 235 FLAKLGWTKCAGYQPG------EKNFAILK------------------------------ 258
            L++LGW +   +               ++                              
Sbjct: 239 MLSELGWKRSQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDASL 298

Query: 259 ---------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                 WN S+ Y  T AY A  + G P   
Sbjct: 299 LLPLGRKGPAFLSYPNFDIFVEWNKSIVYATTAAYFATRLAGAPAFD 345


>gi|89069939|ref|ZP_01157272.1| peptidoglycan binding domain protein [Oceanicola granulosus
           HTCC2516]
 gi|89044493|gb|EAR50621.1| peptidoglycan binding domain protein [Oceanicola granulosus
           HTCC2516]
          Length = 375

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 77/305 (25%), Positives = 120/305 (39%), Gaps = 62/305 (20%)

Query: 35  CSDTADRFGEWKSAARARAVREG-MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
            +D    F +W +A R RA + G + P      F  L      + RDR           D
Sbjct: 2   SADEQRSFTDWHAAFRERARQRGNVGPAAL-AAFDALTPDPEVLQRDRSQAELVRP-IWD 59

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           YLD   +   +  G AL      L   + + YGV P I++A+WG+ET +G   G+  +L 
Sbjct: 60  YLDRAVTDARVDAGRALLSERRELFGRISERYGVAPEIVVAIWGVETGYGRDRGRFDVLR 119

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
            LATLA D RR   F  Q   AL + + G  +    G+  G +G  QF+P + + YA+D 
Sbjct: 120 ALATLAADGRRRGLFEAQLMAALRIHEDG-DAREMRGSWAGAMGHTQFMPTSYLAYAVDF 178

Query: 214 DEDGKIDLV-KSNIDAIASAAKFLAKLGWTK--------------------------CAG 246
           D DG+ D+      DA+AS A +LA+ GW                             A 
Sbjct: 179 DGDGRRDIWSDDPTDALASTAAYLARFGWQSGAPWGHEVRLPEGFDLRLADRRTRRGGAD 238

Query: 247 YQP-------------------------------GEKNFAILKHWNASLNYNKTIAYIAA 275
           +                                    NF +++ +N +++Y   + ++A 
Sbjct: 239 WARLGVARADGGLLDEAGEGALLLPAGAEGVAFLALDNFRVVERYNRAVSYVLAVGHLAD 298

Query: 276 HIDGV 280
            + G 
Sbjct: 299 RLAGR 303


>gi|190576433|ref|YP_001974278.1| putative transglycosylase protein [Stenotrophomonas maltophilia
           K279a]
 gi|190014355|emb|CAQ48002.1| putative transglycosylase protein [Stenotrophomonas maltophilia
           K279a]
          Length = 422

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 74/245 (30%), Positives = 112/245 (45%), Gaps = 8/245 (3%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
            D    F    S  +A AV +G+SP     + A L    + +               DYL
Sbjct: 25  GDIDPAFSRCLSGLQATAVTQGISPDRFNAITAGLTPDPSVLGLLDAQPE-FTTPIWDYL 83

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             L   + +A G AL + +  LL  +  +YGV P  ++A+WG+E+ +G   GK PLL +L
Sbjct: 84  AALVDRQRVADGRALLQQHRDLLDRVSAQYGVDPATIVAVWGVESDYGRVFGKRPLLQSL 143

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATL+   RR  FF  +    L L+ +G + +    G+  G  G  QF+P    + A+D D
Sbjct: 144 ATLSCAGRRQPFFRGELLALLKLIDRGDLQAQGLTGSWAGAFGHTQFMPSTYARIAVDGD 203

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLN---YNKTIA 271
            DG+ DLV S  DA+AS A +L + GW     +        +   +NAS       + +A
Sbjct: 204 GDGRRDLVGSIPDALASTANYLKRAGWRSGEPWGME---VRVPAGFNASQAGRTQRRALA 260

Query: 272 YIAAH 276
              A 
Sbjct: 261 DWRAQ 265



 Score = 42.9 bits (99), Expect = 0.053,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 46/132 (34%), Gaps = 14/132 (10%)

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLP-VNVVK 208
            +   LA+ A   +RA + + + +        G+      G    + G+ Q     +   
Sbjct: 213 SIPDALASTANYLKRAGWRSGEPW--------GMEVRVPAGFNASQAGRTQRRALADWRA 264

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNK 268
             + A +   +       DA A+    L   G           +N+  +  +NA+ +Y  
Sbjct: 265 QGVTALDGSVLAPANLPADARAA---LLLPAG--NKGPALLVFRNYDAIYSYNAAESYAL 319

Query: 269 TIAYIAAHIDGV 280
            IA +A  + G 
Sbjct: 320 AIATLADQLRGG 331


>gi|307131213|ref|YP_003883229.1| membrane-bound lytic murein transglycosylase B [Dickeya dadantii
           3937]
 gi|306528742|gb|ADM98672.1| Membrane-bound lytic murein transglycosylase B [Dickeya dadantii
           3937]
          Length = 437

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 64/290 (22%), Positives = 120/290 (41%), Gaps = 20/290 (6%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKA----------------TTQFICSDTADRFGEWKSA 48
               + ++++   +L+    +P                    T        +   +W++A
Sbjct: 13  SMARVLVVVLGAGLLSSCAHRPTPPGECRNIDSLLKSHGITDTPAGLPTPDESVEQWEAA 72

Query: 49  ARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGI 108
            R +A+ +G++  T    FA        +A  +K        +  Y++   + E IAQG 
Sbjct: 73  LRQQALSQGITADTFDKAFAGFTPDSDVVAATQKQPELVTPVWT-YIEQRVTPENIAQGK 131

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
            L K  +++   +++ Y V P +L A   +E+ +G   G   ++ +LATL Y   R  F 
Sbjct: 132 TLLKQYAKVTNRIEQRYQVEPPLLFAFLSIESGYGANTGDKAVIRSLATLDYYNYRRAFN 191

Query: 169 TEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
            +    AL +++ G        G+  G +G  QF+P + ++YA+D D D   D+  S  D
Sbjct: 192 RQNLIAALRMIQNGDARPEQIKGSWAGAMGMPQFIPTSYLQYAVDFDGDRHPDIWTSFPD 251

Query: 228 AIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLN-YNKTIAYIAAH 276
            +AS A ++ +  W     +   E N      ++ S     KT+A   A 
Sbjct: 252 TLASVANYMQQAKWKAGVPWGF-EVNLPAGFDYSLSGLDNQKTVADWQAR 300


>gi|117620167|ref|YP_856660.1| membrane-bound lytic murein transglycosylase B [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117561574|gb|ABK38522.1| membrane-bound lytic murein transglycosylase B [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 319

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 80/323 (24%), Positives = 132/323 (40%), Gaps = 69/323 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           +   +++  ++ P +A+           F  + +  +  A+  G+SP T    FAD+  +
Sbjct: 5   LALLLISGIISYPLQASP---------DFEHYVTGLKQEALAAGISPATVATAFADIHLI 55

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
           +  I  D+        +   Y+        + Q   L +    LL  +  EY V P  ++
Sbjct: 56  EVAIRHDKNQPE-FKQTLATYIPRAVPQWKVNQAKRLYRQYLPLLTKIGAEYDVQPRFIV 114

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGAT 192
           ALWG+ET+FG+  GK PL+S+LATLA++ RR  FF  Q F AL ++++  ++     G+ 
Sbjct: 115 ALWGIETNFGKLTGKYPLVSSLATLAWEGRREAFFKGQLFDALRILEQQKMAPADLKGSW 174

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------------ 240
            G +GQ QF+P + +KYA+D D DGK DL  +  D   SAA +L + G            
Sbjct: 175 AGAMGQVQFMPSSYLKYAVDQDGDGKQDLWGNLADVFGSAANYLHQNGWHGDETWGRLVR 234

Query: 241 --------------------WTK--------------------CAGYQPG------EKNF 254
                               W                            G        N+
Sbjct: 235 APAGLDSALVGLEEIRALSAWQALGVRKADGADLPQASLQASLVQPDGEGGAAYLAYPNY 294

Query: 255 AILKHWNASLNYNKTIAYIAAHI 277
            +L+ WN S  +   +  +A  I
Sbjct: 295 RVLRDWNRSHYFVVAVGTLADRI 317


>gi|261214431|ref|ZP_05928712.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|260916038|gb|EEX82899.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
          Length = 399

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 77/312 (24%), Positives = 115/312 (36%), Gaps = 59/312 (18%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                  +    FG+W       A   G+  K               + RDRK  T   +
Sbjct: 25  AVNMPKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNL 82

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F ++   L S   + +G       + +   ++  YGVP  +L A WGLET +G   G  
Sbjct: 83  TFTEFSKRLISEARLKKGQENLVKYADVFKKVEDAYGVPCPVLAAFWGLETDYGAIQGDF 142

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
             L+ L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++ 
Sbjct: 143 DTLNALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLER 202

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNFAILK----- 258
            +D D DGK+DL  S  DA+ +A + L++LGW +   +               ++     
Sbjct: 203 GVDGDGDGKVDLKNSVPDAMMTAGRMLSELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKP 262

Query: 259 ----------------------------------------------HWNASLNYNKTIAY 272
                                                          WN S+ Y  T AY
Sbjct: 263 HSWWAEHGVTGLNGPLGPDDGDASLLLPLGRKGPAFLSYLNFDIFVEWNKSIVYATTAAY 322

Query: 273 IAAHIDGVPIGK 284
            A  + G P   
Sbjct: 323 FATRLAGAPAFD 334


>gi|15963987|ref|NP_384340.1| putative transglycosylase transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307306399|ref|ZP_07586143.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
 gi|15073163|emb|CAC41671.1| Membrane-bound lytic murein transglycosylase B [Sinorhizobium
           meliloti 1021]
 gi|306902241|gb|EFN32838.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
          Length = 412

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 71/339 (20%), Positives = 120/339 (35%), Gaps = 72/339 (21%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWK-SAARARAVREGMSPKTAKHLFAD 69
           +L  +  +L   ++    +      +D   +F +W  +     A + G+S    +  F  
Sbjct: 1   MLRFLSVLLLACLSFATFSFAA-SKADVETQFRQWLRNDFWPEAKKAGISNAAFEAAFKG 59

Query: 70  LEYLDTTIARDRK---------MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +                        +   S   Y        + A G +L  A++  L  
Sbjct: 60  VRLDWDLPDLAPPGFPKPKQRKQSQAEFSSPGSYFSEKRLQGLAATGRSLASAHASTLKR 119

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +++ YGVP  I++A+WG E+ FG      P++  LAT A+   R + F  +   AL ++ 
Sbjct: 120 IERTYGVPGQIVLAIWGKESGFGRAKIPHPIMDVLATKAFMSTRPELFRRELIAALHILD 179

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G +  +   G+  G +GQ QFLP + +KYA+D D DG+ D+  S  D++AS A +LA+ 
Sbjct: 180 SGDVKEAQMRGSWAGAMGQPQFLPSSFLKYAVDFDGDGRRDIWNSVPDSLASIANYLAQK 239

Query: 240 GWTKCAGY-------------QPGEKNFAILKHW-------------------------- 260
           GW     +             Q G      +  W                          
Sbjct: 240 GWQSGRDWGFEVAIPSGVSCAQEGPDLARPIAEWAGMGIGRISGKAFPAAERAAAGMMLV 299

Query: 261 ---------------------NASLNYNKTIAYIAAHID 278
                                N S  Y   I  +A  I 
Sbjct: 300 PAGTHGPQFIVTPNFYVIKEYNNSDLYALYIGNLADRIA 338


>gi|84502911|ref|ZP_01001024.1| lytic murein transglycosylase, putative [Oceanicola batsensis
           HTCC2597]
 gi|84388894|gb|EAQ01764.1| lytic murein transglycosylase, putative [Oceanicola batsensis
           HTCC2597]
          Length = 263

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 97/250 (38%), Positives = 139/250 (55%), Gaps = 3/250 (1%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
           +    C DT+  F  WK+A    A R G+  +  +   A + Y   TIA DR+       
Sbjct: 17  SVAAPCGDTSRGFETWKAAFAQEAARAGVGQRGLQ-ALAGVRYSQGTIAADRRQTGV-RY 74

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           S +D++       I++ G   K AN     ++++ YGVP GIL+A+ G+E+ FG   GK 
Sbjct: 75  SLQDFMRIRGVDAIVSGGRKRKAANPAFYASIERIYGVPAGILLAIHGMESGFGSGFGKY 134

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
            +LS+ AT+AYDCRR+ FF+     AL LV +G +  +A+GA  GEIG  QFL  NV++Y
Sbjct: 135 HVLSSNATVAYDCRRSDFFSGHLIAALKLVDRGWLDPNAIGAAHGEIGHTQFLAGNVLEY 194

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKT 269
             D + DG++DL  +  DA+ S A FL + GW     Y  G +NF +L  WNA+  Y + 
Sbjct: 195 GRDGNGDGRVDLY-NLSDAMVSTAHFLRQKGWRPGRPYAEGTRNFRVLNEWNAATVYQQA 253

Query: 270 IAYIAAHIDG 279
           IA  AA IDG
Sbjct: 254 IAIAAARIDG 263


>gi|167623768|ref|YP_001674062.1| lytic murein transglycosylase [Shewanella halifaxensis HAW-EB4]
 gi|167353790|gb|ABZ76403.1| lytic murein transglycosylase [Shewanella halifaxensis HAW-EB4]
          Length = 331

 Score =  183 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 72/232 (31%), Positives = 118/232 (50%), Gaps = 2/232 (0%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
           +LA            F  S+    F ++  + +  A+ +G+S +T   +F  ++     +
Sbjct: 7   VLALVCCLSLLPVVAFAESEPKAHFSDYVVSLKQEALDKGVSLQTVNDVFPKIKMFKKAL 66

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
           A D+    +  V+ + YL  +     +    AL K +   L  + K YGV P  ++ALWG
Sbjct: 67  ASDKNQPEN-QVTLETYLPKVVPQSKVDTARALYKQHYPELEKIGKRYGVQPRFIVALWG 125

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFGEI 196
           +E++FG+  G  P+LS  A+LAY+ RR  FF E+FF AL + ++ G+  S   G+  G +
Sbjct: 126 VESNFGQYGGDYPILSVTASLAYEGRREAFFREEFFAALKIAEREGIAFSELKGSWAGAM 185

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           GQ QF+P + + YA D D DGK D+  +  D  AS A +L + GW     + 
Sbjct: 186 GQTQFMPSSYLTYAQDGDGDGKKDIWTNTSDVFASLAYYLQQTGWKASETWG 237



 Score = 41.0 bits (94), Expect = 0.18,   Method: Composition-based stats.
 Identities = 8/28 (28%), Positives = 14/28 (50%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             N+  L  WN S  +  T+A+++  I 
Sbjct: 299 YDNYRSLLRWNNSDYFAITVAHLSERIK 326


>gi|218531228|ref|YP_002422044.1| lytic murein transglycosylase [Methylobacterium chloromethanicum
           CM4]
 gi|218523531|gb|ACK84116.1| lytic murein transglycosylase [Methylobacterium chloromethanicum
           CM4]
          Length = 413

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 70/319 (21%), Positives = 121/319 (37%), Gaps = 64/319 (20%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
           P  A  +         F     A +  A   G+    A+   + +    + +   +    
Sbjct: 18  PIPARAETPTDPAPADFAHCLGALKTLAEERGVPRTVAETALSGIAPDPSVVPATQSQAE 77

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
                  +Y++   + E IA G A     S +L  ++  YGV   IL+A WG+E+++G  
Sbjct: 78  -FVKPVWEYIEASVTPERIATGQAKLAQWSEVLGRIEAAYGVDRHILVAFWGVESNYGAA 136

Query: 146 MGK---TPLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQ 200
           +      P++  LATLA  D  R   + E+   AL ++  G   +  + G+  G +G  Q
Sbjct: 137 LEGAGIRPVVPALATLACGDPARPGLWREELVAALKILADGDADAERMRGSWAGAMGHTQ 196

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL------GW------------- 241
           F+P   +++A+D   DG+ D+  S  DA+AS A FL +       GW             
Sbjct: 197 FMPTAFLRHAVDFGGDGRRDIWHSVPDALASTANFLKQSGWRAGEGWGLEVLLPDGFDYR 256

Query: 242 -------TKCAGYQPG--------------------------------EKNFAILKHWNA 262
                     A +Q                                  E NF ++  +N 
Sbjct: 257 VADETTERPFAEWQRLGLKPANGAFPDGAERRAALLLPTGAKGPAFLLEPNFRVILRYNT 316

Query: 263 SLNYNKTIAYIAAHIDGVP 281
           +L Y  T+A+++  + G P
Sbjct: 317 ALAYALTVAHLSDRLRGAP 335


>gi|90418886|ref|ZP_01226797.1| transglycosylase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336966|gb|EAS50671.1| transglycosylase [Aurantimonas manganoxydans SI85-9A1]
          Length = 426

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 72/302 (23%), Positives = 116/302 (38%), Gaps = 64/302 (21%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLE-YLDTTIARDRKMVTSPPVSFKDYLDGLS 99
            F  W +   + A   G+S    +  F  +       + + R        +  DYLD   
Sbjct: 51  GFQRWIADFESVAASNGISRDVYRAAFKGVTSPDPDVVEKARYQPE-FRSTVWDYLDNRV 109

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----STL 155
           + E +A+G  +       L  ++K +GV   IL+A+W +ET++G  + +  ++     +L
Sbjct: 110 NDEQVAKGRQMAAKYKDWLDRIEKRFGVDRNILLAIWSMETNYGAILARDDVMKNLPRSL 169

Query: 156 ATLAY-DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDA 213
           ATLAY D RRAKF  +Q   AL +V+ G ++      +  G +G  QF+P + + YA D 
Sbjct: 170 ATLAYLDKRRAKFARQQLIAALKIVQAGHVAPGDLTSSWAGAMGHTQFIPTSYLAYAADI 229

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG-----------EKNFAILKHW-- 260
           D DG  ++  S  DA+A+AA  L K GW     +              E++   L  W  
Sbjct: 230 DGDGHPNIWGSIPDALATAANLLRKNGWQTGKTWGYEVEVPSQYRGKLERDNRSLSQWQG 289

Query: 261 -------------------------------------------NASLNYNKTIAYIAAHI 277
                                                      N S  Y   +  +A  I
Sbjct: 290 LGFSRPNGSGFAYPSDRANLVRLAGDSGPAFLMSKNFFVLKNYNNSDKYALAVGLLADQI 349

Query: 278 DG 279
            G
Sbjct: 350 AG 351


>gi|319408149|emb|CBI81802.1| peptidoglycan-binding protein [Bartonella schoenbuchensis R1]
          Length = 418

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 70/326 (21%), Positives = 126/326 (38%), Gaps = 60/326 (18%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
             ++    T    +T+ F  + T   F  W +  +  A+   +S  T    F  +E +D 
Sbjct: 20  AFIIGVISTLLALSTSFFSFAHTERDFKSWINEFKKIALANNISSTTFDMAFKTVETIDP 79

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            + +          S  +Y D    +  I +G    +     L  ++K +GV   IL+A+
Sbjct: 80  AVLQKAAYQPEFIDSPWNYFDNRVHNIAIVEGQRHAQKWEPWLSKIEKRFGVNRNILLAI 139

Query: 136 WGLETHFGETMGKTPLLS----TLATLAY-DCRRAKFFTEQFFYALDLVKK-GVISSHAL 189
           W +E+ +G+ +    ++     +LATLAY D +R K+   Q   A+ +++  G+  S  +
Sbjct: 140 WSIESSYGKVLQNKNVMHDVIRSLATLAYADQKRKKYAYTQLIAAMKILQSSGIHRSQLI 199

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY-- 247
           G+  G +G  QF+P + + Y +D D DG+ ++  S  DA+A+AA  L   GW     +  
Sbjct: 200 GSWAGALGHTQFIPTSYLAYGVDMDGDGRCNIWTSIPDALATAANLLHMNGWQSDLPWGV 259

Query: 248 ----------------------------------------------QPGEKNFAI----- 256
                                                          P    F +     
Sbjct: 260 EVKLPHRKKLPEDWLSFEQWAKLGVRHAHGQPFPSSSQLAILKFPDGPEGPIFLVTKNFF 319

Query: 257 -LKHWNASLNYNKTIAYIAAHIDGVP 281
            +K +N +  Y   +A +A  I G P
Sbjct: 320 VIKRYNNADRYAFAVALLANRIAGHP 345


>gi|114571066|ref|YP_757746.1| lytic murein transglycosylase [Maricaulis maris MCS10]
 gi|114341528|gb|ABI66808.1| lytic murein transglycosylase [Maricaulis maris MCS10]
          Length = 406

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 74/317 (23%), Positives = 118/317 (37%), Gaps = 61/317 (19%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                     + F +W+   R R +  G    TA  +   L+     I RDR        
Sbjct: 16  AADAAAQPEGESFADWRGGFRERLIASGAEEATAAAMLDGLQPEMRIIERDRSQPE-FVR 74

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
               YLD  +S   I  G      N   +  +   +GV   IL+A+WGLE+ +G   G  
Sbjct: 75  PLWSYLDIAASDLRIRNGRDAFAGNRDDVDAVAAHFGVRAEILIAIWGLESSYGAIPGNN 134

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVK 208
            ++  LATLA++ RR  +   Q     ++++ G  +     G+  G +GQ QF+P   ++
Sbjct: 135 DIVQALATLAWEGRRRDWAEAQLIAVAEMLESGYATRQQLTGSWAGAMGQMQFIPTTYLE 194

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLG---------------------WTKCAG- 246
            A D D DG+ D+  +  DA+ASAA  L++ G                     W      
Sbjct: 195 RAHDWDGDGRRDIWTNPADALASAANLLSRAGWRDGEPAIREVRVPVGFDFAAWDPDQSR 254

Query: 247 ----------------YQPGE---------------------KNFAILKHWNASLNYNKT 269
                           +Q  +                      NF ++K +N S +Y   
Sbjct: 255 LVSDWAMRGLRPASGEWQADDLMRAARLELPAGGQAPGFLTFPNFRVIKRYNNSTSYAIG 314

Query: 270 IAYIAAHIDGVPIGKGY 286
           +A++A  I G P   G 
Sbjct: 315 VAHLADRIAGDPALVGP 331


>gi|312882551|ref|ZP_07742292.1| membrane-bound lytic murein transglycosylase B [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369951|gb|EFP97462.1| membrane-bound lytic murein transglycosylase B [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 323

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 70/277 (25%), Positives = 118/277 (42%), Gaps = 26/277 (9%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
           +     T           F  +    +  A   G+S +T +  FA + +    +  D+  
Sbjct: 6   SVALSFTIASSAFANDASFNSYIEGLKKEARSNGISERTIQEAFAGVSHRPKAVTADKNQ 65

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
                ++  +Y+        + Q  AL + + + L ++   YGV P  ++ALWG+E++FG
Sbjct: 66  PEK-RLTLDEYIPRAVPDWKVKQAKALYEKHYQELQSIGLAYGVQPRFIVALWGVESNFG 124

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFL 202
           +  G   ++  L+TLA+D RR  FF ++   AL+++ +G I      G+  G +GQ QF+
Sbjct: 125 KFTGNYKVIDALSTLAFDGRREAFFRKETMAALEILDQGHIKVEDFKGSWAGAMGQCQFM 184

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY--------------- 247
           P + + +A D   DG+ D+  S  D  ASAA +L + GW     +               
Sbjct: 185 PSSFLSFAKDGSGDGRKDIWNSEADVFASAANYLHQSGWNDSFTWGRQVKLPKGFDTSVQ 244

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGK 284
             GE     L  WN        I       DG P+ K
Sbjct: 245 GRGEAQGKYLSEWN-----KMGI----TRYDGKPLPK 272


>gi|209551644|ref|YP_002283561.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209537400|gb|ACI57335.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 423

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 67/282 (23%), Positives = 112/282 (39%), Gaps = 15/282 (5%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKS-AARARAVREGMSPKTAKHLFADLE 71
           + ++ +       P  A      +D   +F  W        A   G+S K+ K  F+ + 
Sbjct: 13  LRIFALAIMTALLPLSAHAAPSKTDVEAQFETWVQKDLWPEAKANGISEKSFKAAFSGIT 72

Query: 72  ---------YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
                           +++K   +   S   Y +      + A G          L  ++
Sbjct: 73  LNWNLPDLAPPGFPPPKEQKQTQAEFSSPGPYFNEDHLKRLAATGRGFAAQYGSTLKRIE 132

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           K YGVP  I++A+WG ET FG        +  LAT A+   R + F  +   AL ++  G
Sbjct: 133 KTYGVPGPIVLAIWGRETGFGAAKIPNSAIEVLATKAFMSTRKEMFRTELVAALHILDGG 192

Query: 183 VISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            ++     G+  G +GQ QF+P + +KYA+D D DG  ++  S  D +AS A FL K GW
Sbjct: 193 DVTPADFKGSWAGALGQPQFMPTSYLKYAVDFDGDGHRNIWTSVPDTLASIANFLVKKGW 252

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA----AHIDG 279
            +   +         +       +  K +++ A      I G
Sbjct: 253 QRDRDWGFEVSIPEAVSCAQEGPDLAKPLSHWASLGIDRISG 294



 Score = 42.9 bits (99), Expect = 0.055,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 13/27 (48%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHI 277
             NF I+K +N S  Y   I  +A  I
Sbjct: 322 TPNFYIIKEYNNSDLYALYIGNLADRI 348


>gi|323516092|gb|ADX90473.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 378

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 73/257 (28%), Positives = 118/257 (45%), Gaps = 24/257 (9%)

Query: 46  KSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIA 105
            +  R++A+  G+S  T      +L    + I +             DYL GL   E +A
Sbjct: 1   MANLRSQAIAAGVSGSTYDRYTQNLTPDYSVIDKLNYQPE-FSTPIWDYLSGLVDEERVA 59

Query: 106 QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRA 165
            G      +  +L    + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR 
Sbjct: 60  LGKQKLAQHRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQ 119

Query: 166 KFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
            +F  +FF  + ++++G ++     G+  G  G  QF+P    + A+D D DG+ DLV S
Sbjct: 120 SYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSS 179

Query: 225 NIDAIASAAKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNASLNYNKTIA 271
             DA+AS A FL K GW     +               G ++   L  W+      + + 
Sbjct: 180 TADALASTANFLNKAGWQTGMPWGFEVQIPAGMSIDGEGRRSKKPLSSWS-----ARGV- 233

Query: 272 YIAAHIDGVPIGKGYDT 288
                IDG P+ +G  +
Sbjct: 234 ---TRIDGSPLIQGPLS 247



 Score = 47.6 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
           KNF  +  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 269 KNFDAIYSYNAAESYGLAIAHLSDRLRGAGPFVSSWPT 306


>gi|13471570|ref|NP_103136.1| transglycolase [Mesorhizobium loti MAFF303099]
 gi|14022312|dbj|BAB48922.1| probable transglycolase [Mesorhizobium loti MAFF303099]
          Length = 392

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 85/339 (25%), Positives = 126/339 (37%), Gaps = 73/339 (21%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M  +   L +L +    + A A              +    F  WK    A A   G+  
Sbjct: 1   MRLRSQALAALFLCATALPAMA-------------QECGGDFETWKQGVAAEAKAAGVGA 47

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
                   D    +  +ARDR        +F ++ + + S+  + QG A  K  + +   
Sbjct: 48  VGLD-ALEDATIDERALARDRAQG-VFTQTFIEFSNRMISAYRLKQGAANMKKYADVFAR 105

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
             +++GV   ++ A W LET FG   G    LS L TL++DCRR + F +Q    L+L+ 
Sbjct: 106 ADQQFGVQAPVITAFWALETDFGAVQGDFHTLSALVTLSHDCRRPQLFRQQLVPLLELID 165

Query: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           +GV+ +   GA  GEIGQ Q LP + +   +D D DGKIDL  S  D I + A  +   G
Sbjct: 166 RGVLPADVKGAWAGEIGQTQILPSDYLARGVDGDGDGKIDLRNSVPDVIMTTANKVLSRG 225

Query: 241 WTKCAGY---------------------------QPGEKN-------------------- 253
           W +   +                           Q G  N                    
Sbjct: 226 WKRDEPWIQEVHVPDEMPWDQTGRTNKLPLTQWAQWGVTNPDGSPLVDMGLKAGLALPMG 285

Query: 254 -----------FAILKHWNASLNYNKTIAYIAAHIDGVP 281
                      F +   WN S  Y  T A +AA + G P
Sbjct: 286 RKGPAFLTYDNFDVYLEWNQSFTYALTAANLAARLAGAP 324


>gi|307319286|ref|ZP_07598715.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|306895122|gb|EFN25879.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
          Length = 412

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 71/339 (20%), Positives = 120/339 (35%), Gaps = 72/339 (21%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWK-SAARARAVREGMSPKTAKHLFAD 69
           +L  +  +L   ++    +      +D   +F +W  +     A + G+S    +  F  
Sbjct: 1   MLRFLSVLLLACLSFATFSFAA-SKADVETQFRQWLRNDLWPEAKKAGISNAAFEAAFKG 59

Query: 70  LEYLDTTIARDRK---------MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +                        +   S   Y        + A G +L  A++  L  
Sbjct: 60  VRLDWDLPDLAPPGFPKPKQRKQSQAEFSSPGSYFSEKRLQGLAATGRSLASAHASTLKR 119

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           +++ YGVP  I++A+WG E+ FG      P++  LAT A+   R + F  +   AL ++ 
Sbjct: 120 IERTYGVPGQIVLAIWGKESGFGRAKIPHPIMDVLATKAFMSTRPELFRRELIAALHILD 179

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G +  +   G+  G +GQ QFLP + +KYA+D D DG+ D+  S  D++AS A +LA+ 
Sbjct: 180 SGDVKEAQMRGSWAGAMGQPQFLPSSFLKYAVDFDGDGRRDIWNSVPDSLASIANYLAQK 239

Query: 240 GWTKCAGY-------------QPGEKNFAILKHW-------------------------- 260
           GW     +             Q G      +  W                          
Sbjct: 240 GWQSGRDWGFEVAIPSGVSCAQEGPDLARPIAEWAGMGIGRISGKAFPAAERAAAGMMLV 299

Query: 261 ---------------------NASLNYNKTIAYIAAHID 278
                                N S  Y   I  +A  I 
Sbjct: 300 PAGTHGPQFIVTPNFYVIKEYNNSDLYALYIGNLADRIA 338


>gi|77920031|ref|YP_357846.1| membrane-bound lytic murein transglycosylase B [Pelobacter
           carbinolicus DSM 2380]
 gi|77546114|gb|ABA89676.1| membrane-bound lytic murein transglycosylase B [Pelobacter
           carbinolicus DSM 2380]
          Length = 363

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 67/310 (21%), Positives = 121/310 (39%), Gaps = 56/310 (18%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           +         Q     ++  F  W +  +  A+++G+ P+  +      +     +    
Sbjct: 42  SAAPADPDNRQNSAEQSSADFQTWLAELKTEALQQGIRPEVVQEALEGQQPAPAVLKPRH 101

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
           K      +S  +Y+  L+S     +G+     +  LL  + + YGVP   L+ALW +E+ 
Sbjct: 102 KQAE-FVLSKSEYVRRLASETRFREGLRQMAQHRVLLRKVAETYGVPESYLLALWAIESD 160

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQ 200
           FG+   +  ++  L T A+  +R  FF +Q   AL ++ +  + S A  G+  G +G FQ
Sbjct: 161 FGKGGSRHSVIGALVTQAWQSQRRNFFRKQLLAALTILDQEHMPSSALRGSWAGAMGHFQ 220

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY------------- 247
           F+P     YA+D D DG  ++     DA+ASAA +L + GW K  G+             
Sbjct: 221 FIPTTYRDYAVDFDGDGHRNIWTDVGDALASAASYLVRAGWKKDRGWGWQVSVPQGFDVS 280

Query: 248 -----------------------------------QPGEKNFAI------LKHWNASLNY 266
                                               PG + + +      L  WN S+ +
Sbjct: 281 LADLKNKKSLGDWRKLGLPAVSGADDLTASLILPDGPGGQAYLVTDNFRALMRWNRSVAF 340

Query: 267 NKTIAYIAAH 276
              + ++A  
Sbjct: 341 GLAVGHLADR 350


>gi|257093810|ref|YP_003167451.1| lytic murein transglycosylase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257046334|gb|ACV35522.1| lytic murein transglycosylase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 410

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 78/310 (25%), Positives = 120/310 (38%), Gaps = 60/310 (19%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                 +  ADRF    S  R  A  +G+S  +   L   L    + +            
Sbjct: 24  AVAAQEAVPADRFSSCMSTLRGEAASKGVSAASFDRLTKGLAPDLSVLEFLDYQPE-FRT 82

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
              DYL GL   E +A  +A+++     L    + Y V    ++A+WG+E++FG   GK 
Sbjct: 83  PIWDYLAGLVDDERVADALAMREKWLGPLAAAGERYQVDQDTVLAVWGVESNFGRNFGKR 142

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVK 208
           PLL++L TLA   RR  +F  +F  AL ++  G I+    +G+  G  G  QF+P   ++
Sbjct: 143 PLLTSLGTLACFGRRQGYFRGEFLSALKILDTGDIAPERLVGSWAGAFGHTQFMPSTFLR 202

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ-------------PGEKNFA 255
            A+D D DG+ DL+ S  DA+AS A FL + GW     +               G  N  
Sbjct: 203 LAVDGDGDGRRDLMDSVPDALASTANFLHRAGWRTGEPWGYEVVLPAGFDTSIAGRSNKR 262

Query: 256 IL---------------------------------------------KHWNASLNYNKTI 270
            L                                               +NA+ +Y   I
Sbjct: 263 PLAQWNARGVRRADGQPIAASDAAAGLLLPAGPRGPAFLVFRNFDVIYGYNAAESYALAI 322

Query: 271 AYIAAHIDGV 280
           A+++  I G 
Sbjct: 323 AHLSDRIKGG 332


>gi|282599681|ref|ZP_05971471.2| type III effector HopAJ2 [Providencia rustigianii DSM 4541]
 gi|282568209|gb|EFB73744.1| type III effector HopAJ2 [Providencia rustigianii DSM 4541]
          Length = 330

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 67/225 (29%), Positives = 109/225 (48%), Gaps = 3/225 (1%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
                  I      +F  +    +  A  +G+   T    FA++ +L+  +  D+     
Sbjct: 13  ALDKAFPIEQRDPSQFPAYVELLKQHAAVQGIKQSTIDRGFANIYFLERVVKADKGQPEK 72

Query: 87  P-PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
              V+   YL  +     I  G+   K N   L    ++YGVPP  +++LWGLE+ FG +
Sbjct: 73  RATVTLASYLKNVLPQSRINAGVEKYKENQATLDATSQKYGVPPQFIVSLWGLESGFGRS 132

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL--GATFGEIGQFQFLP 203
            GK  ++S LATL+++ RR   F++Q   AL+++ KG I       G+  G +GQ QF+P
Sbjct: 133 QGKEDVISALATLSFEGRRETLFSKQLLAALEIMDKGYIPEEQQLKGSWAGAMGQSQFMP 192

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            + + YA D D DGK+D+  +  D  AS A +L+  GW     + 
Sbjct: 193 TSYLSYAADGDGDGKMDIWNNKADVFASIANYLSTEGWQAALPWG 237


>gi|304312079|ref|YP_003811677.1| Putative peptidoglycan-binding protein [gamma proteobacterium HdN1]
 gi|301797812|emb|CBL46034.1| Putative peptidoglycan-binding protein [gamma proteobacterium HdN1]
          Length = 444

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 70/226 (30%), Positives = 116/226 (51%), Gaps = 2/226 (0%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
                         D F       + RA  EG+   T  +   ++++++  I  DR+   
Sbjct: 55  NTTPAPPPSAEIHHDGFDVCVEKLQQRARNEGIRDSTILNALGEVQFIERVIELDRRQPE 114

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
               +F +YL+   +   + QG  L   + +L  +L+ +YG+P  IL+A WGLET+FG  
Sbjct: 115 -YTETFGNYLNSHVTKSRVQQGQKLLDQHQKLFQSLESQYGIPGSILVAFWGLETNFGSY 173

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPV 204
           MG  P++ +L TLA D RR+ FF  +   A+ ++ +G ++     G+  G +G  QF+P 
Sbjct: 174 MGSMPIIDSLTTLACDGRRSSFFAAELLNAMQMMDQGAVTKDQLKGSWAGAMGNMQFMPS 233

Query: 205 NVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
               +A+D D+DG+IDL KS  DA+ SAA +L K+ W + A +   
Sbjct: 234 TFRSFAMDGDQDGRIDLWKSVPDAMTSAANYLRKINWQRDARWGDE 279



 Score = 50.2 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 9/31 (29%), Positives = 16/31 (51%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
             NF ++  WN S  Y  ++ +++  I G P
Sbjct: 338 YSNFDVIMKWNRSEYYAISVGHLSDRIQGKP 368


>gi|197285033|ref|YP_002150905.1| lipoprotein [Proteus mirabilis HI4320]
 gi|194682520|emb|CAR42503.1| putative lipoprotein [Proteus mirabilis HI4320]
          Length = 375

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 73/222 (32%), Positives = 116/222 (52%), Gaps = 3/222 (1%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                 S T  +F  +  A + +A   G  P+T    F+++ ++D  +  DR       +
Sbjct: 57  QAFPKQSRTPAQFPAYVDALKQKAAELGYKPETINFAFSEIHFIDRVVKSDRNQPEK-KI 115

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +   YL  + +   IA+G  L +AN + L  +  +YGVP   ++ALWGLE+ FG   GK 
Sbjct: 116 TLDVYLPRVVTKGRIAEGAKLYQANQQTLAQISNQYGVPANYIVALWGLESGFGRVQGKE 175

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS--SHALGATFGEIGQFQFLPVNVV 207
            ++S LATLA++ RR   F+ Q   AL++++ G +       G+  G +GQ QF+P + +
Sbjct: 176 DVISALATLAFEGRREALFSRQLMAALEIIENGHLPVGQRLKGSWAGAMGQTQFMPSSFL 235

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
            YA D + DG ID+  S  DA ASAA +LA  GW +   +  
Sbjct: 236 TYAADGNGDGNIDIWNSREDAFASAANYLATEGWQRDLPWGE 277


>gi|330872617|gb|EGH06766.1| type III helper protein HopAJ1 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330943490|gb|EGH45832.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 413

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 73/341 (21%), Positives = 128/341 (37%), Gaps = 65/341 (19%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTA---DRFGEWKSAARARAVREGMS 59
            +  ++ + L+++    A A      A      S+ +     F +W +  R+ A  +G+ 
Sbjct: 1   MRSRVITTSLVVIMLSCASAAPACFSADMTPSVSNESTSEANFQQWLATFRSNATTKGID 60

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
             T    F ++    T    D         +  DYL    + + I QG  L +    +L 
Sbjct: 61  TATLDLAFQNITLDPTVHQLDMAQPE-FTTAIWDYLSERLTPKNIQQGQELLQ-KEPVLN 118

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATLAY  RR  +   Q   AL ++
Sbjct: 119 EVERHYGVDAKIIAAIWCIESGYGKDIGSRDVIRSLATLAYKGRRMDYGATQLMAALHIL 178

Query: 180 KKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           +   I  +  +G+  G +GQ QF+P   + YA+D + D + D+  S  DA+AS A +L +
Sbjct: 179 QNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRDVWSSRADALASTASYLKR 238

Query: 239 LGWTKCAGYQPGEK---NF----------AILKHW------------------------- 260
             W     +    +   NF            +  W                         
Sbjct: 239 SAWNSRISWGQEVQLPENFDYAQADMSIKKPVAEWQRLGVMGTTHAIPGELAQEQASVLL 298

Query: 261 ---------------------NASLNYNKTIAYIAAHIDGV 280
                                N S  Y  TI  +A    G 
Sbjct: 299 PAGYRGPAFMVLSNFRSILRYNNSTAYALTIGLLADSYAGG 339


>gi|83593041|ref|YP_426793.1| lytic murein transglycosylase [Rhodospirillum rubrum ATCC 11170]
 gi|83575955|gb|ABC22506.1| Lytic murein transglycosylase [Rhodospirillum rubrum ATCC 11170]
          Length = 454

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 73/232 (31%), Positives = 110/232 (47%), Gaps = 2/232 (0%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
             A   P         +     F +W    RA A+  G+S  T              +  
Sbjct: 56  GMAPVSPIAPAAALSPAAEQAAFAQWLVGMRAEALAAGISRATVDSALGRARIEPRIVEL 115

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DRK       +   Y         IA+   +   ++ LL +L++ YGVP   L+A WGLE
Sbjct: 116 DRKQPE-FNKTLAGYFASTLPDSRIAKAREMMALHAPLLRSLEQRYGVPGRFLVAFWGLE 174

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQ 198
           T+FG T+G   ++  L+TLA++ RR  FF  Q   AL ++  G +S+   +G+  G +GQ
Sbjct: 175 TNFGGTLGSFRVVDALSTLAFEGRRGAFFRAQLLDALRIIDAGHVSADAMIGSWAGAMGQ 234

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
            QF+P     +A+D D DG+ID+  S  DA+ASAAK+L+ LGW     +   
Sbjct: 235 TQFMPSTFRAHAVDYDGDGRIDIWGSLPDALASAAKYLSDLGWKGAEPWGWE 286


>gi|56478199|ref|YP_159788.1| putative peptidoglycan-binding protein [Aromatoleum aromaticum
           EbN1]
 gi|56314242|emb|CAI08887.1| putative peptidoglycan-binding protein [Aromatoleum aromaticum
           EbN1]
          Length = 401

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 88/348 (25%), Positives = 134/348 (38%), Gaps = 76/348 (21%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M  +++   SLL                       +D  + F       R  A    ++P
Sbjct: 1   MISRRFPAWSLLCAALL---------------PFHADAQESFARCLEELRGMAATHDIAP 45

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T +   A LE     I               DYL GL   E +A G A+    +  L +
Sbjct: 46  PTFEQHVARLEPDMAVIGLLDYQPE-FRTPIWDYLAGLVDDERVADGRAMAVQWAGTLQD 104

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++  YGV P  ++A+WG+E++FG   GK PLL +LATL+   RR  +F  +FF AL +++
Sbjct: 105 IEARYGVDPATVVAVWGVESNFGRNFGKRPLLVSLATLSCFGRRQDYFRGEFFTALKIIE 164

Query: 181 KGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G I++  L G+  G  G  QF+P    + A+D D DG+ DL+ S  DA+AS A FL K 
Sbjct: 165 DGDIAAQHLAGSWAGAFGHTQFMPSTFRRVAVDFDGDGRRDLIDSIPDALASTANFLRKA 224

Query: 240 GWTKCAGYQ-------------PGEKNFAI------------------------------ 256
           GW     +               G +N                                 
Sbjct: 225 GWQTGRPWGFEVALPPDFDAGLAGRRNKRPLSEWVALGVRRADGSAIEPGAEAAGLLLPA 284

Query: 257 ---------------LKHWNASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
                          L  +NA+ +Y   IA+++  + G  P    + T
Sbjct: 285 GERGPAFLVLRNFDALYSYNAAESYALAIAHLSDRLRGGEPFRASWPT 332


>gi|221065451|ref|ZP_03541556.1| lytic murein transglycosylase [Comamonas testosteroni KF-1]
 gi|220710474|gb|EED65842.1| lytic murein transglycosylase [Comamonas testosteroni KF-1]
          Length = 445

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 66/229 (28%), Positives = 104/229 (45%), Gaps = 2/229 (0%)

Query: 25  QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
           Q             A  F  WK     RA   G+S +T     A  +   + +  DR   
Sbjct: 53  QASGEPAAAENPIQARNFAHWKQEFAPRARAAGISERTLGSALAGAKLQPSIVKLDRSQP 112

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
                +   YLD   S++ I  G    + +   L    + YGVP  ++ A+WG+E+++G 
Sbjct: 113 E-FTRTPWQYLDSAVSAQRIKTGKLKMQEHGASLQAASQRYGVPAPVIAAIWGMESNYGS 171

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLP 203
             G    +  LATLA+D RRA++  ++   AL ++  G I +  +  +  G +G  QFLP
Sbjct: 172 NFGSFSAVDALATLAFDGRRAEWAQKELIAALRIIDNGDIDAAHMISSWAGAMGNTQFLP 231

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
              ++YA+DAD DG+ D+  S  D  AS A +LA  GW     +    +
Sbjct: 232 SVFLQYAVDADGDGRRDIWGSMADVAASTANYLASAGWNASEPWGIEVR 280



 Score = 42.9 bits (99), Expect = 0.046,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 16/27 (59%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           NF  +  +N S NY   ++ +A+H+ G
Sbjct: 338 NFRAILRYNNSTNYALAVSLLASHLAG 364


>gi|148652098|ref|YP_001279191.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
 gi|148571182|gb|ABQ93241.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
          Length = 474

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 77/275 (28%), Positives = 121/275 (44%), Gaps = 8/275 (2%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           +   +          A      + +   F +  S  +  +   G+S  T ++ +   E  
Sbjct: 10  LTTALGISLAATSAHAAKPPAPNLSNAEFQQCLSGLKNSSTFRGVSSSTFEN-YRPSEPD 68

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
            + IA              DYL  L   E +  GI  K   +  L  ++  YGV P  ++
Sbjct: 69  PSVIASLNYQPE-FQKDVWDYLSSLVDKERVEDGIRAKHEMADTLRRIEARYGVTPEHVL 127

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGAT 192
            +WG+E++FG+T+GK  L  +LATL+   RR  +F  ++  AL +V++G I      G+ 
Sbjct: 128 GVWGVESNFGQTLGKKDLFQSLATLSCFDRRQSYFRGEYANALKIVQQGDIRPQDMTGSW 187

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            G  GQ QF+P   +  A+D D DG+ DLV S  DA+AS A FLAK G+     +    K
Sbjct: 188 AGAFGQTQFMPGTFLDLAVDFDGDGRRDLVNSKADALASTANFLAKRGYRSGEPWGYEVK 247

Query: 253 NFAILKHWNASLNYNKTIAYIAAH----IDGVPIG 283
                   N S    K+++Y         DG P+ 
Sbjct: 248 IPQGFWGSN-SRKDKKSMSYWRDKGFTLADGRPLP 281


>gi|217977417|ref|YP_002361564.1| lytic murein transglycosylase [Methylocella silvestris BL2]
 gi|217502793|gb|ACK50202.1| lytic murein transglycosylase [Methylocella silvestris BL2]
          Length = 405

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 72/306 (23%), Positives = 113/306 (36%), Gaps = 58/306 (18%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
                  A    E  +  R   +  G+S  T     A L+      A  +          
Sbjct: 26  AGATPSQAASLQECLAGLRPGILSSGVSAATFDKATAGLQADPDIFALAQAQPE-FKTPI 84

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
            DYL GL   E +  G A  +  ++ L   +  YGV    ++A+WG+E+ FG + GK P+
Sbjct: 85  WDYLAGLVDDERVEDGRAQMRKWAQPLSAAQSRYGVDAATIVAVWGVESDFGRSFGKRPI 144

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
           + +LATL+    RA +F  +   A  ++  G I      G+  G  G  QF+P   ++ A
Sbjct: 145 IQSLATLSCGPYRAAYFRTELTAAFKILDHGDIVPEQFVGSWAGAFGHTQFMPSTFLRTA 204

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ---------------------- 248
           +D D DG+ DL+ S  DA+ S A +L K GWT    +                       
Sbjct: 205 VDFDGDGRRDLINSVPDALGSTAAYLRKGGWTPGVEWGFEVRLPQGYAGPSGRTRKEPIG 264

Query: 249 -------------------------PGEKN---------FAILKHWNASLNYNKTIAYIA 274
                                    P   N         F  +  +NA+ +Y   IA ++
Sbjct: 265 HWAARGLVKVDGSPLGSGPNAGLLLPAGPNGPAFLVTRNFDAIYSYNAAESYALAIALLS 324

Query: 275 AHIDGV 280
             + G 
Sbjct: 325 DRLKGR 330


>gi|241207074|ref|YP_002978170.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860964|gb|ACS58631.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 477

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 66/288 (22%), Positives = 115/288 (39%), Gaps = 15/288 (5%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKS-AARARAVREGMSPKTAKHLFADLE 71
           + ++ +   A   P         +D   +F +W        A   G+S K  +  F+ + 
Sbjct: 67  LRIFALTLAAALLPLSCYAAPSKADVEAQFEKWVQSDLWPEAKANGISEKVFQAAFSGIT 126

Query: 72  ---------YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
                           +++K   +   S   Y +     ++ A G          L  ++
Sbjct: 127 LNWNLPDLAPPGFPPPKEQKQTQAEFSSPAPYFNEDQLKKLAATGRGFAAQYGSTLKRIE 186

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           K YGVP  I++A+WG ET FG        +  LAT A+   R + F  +   AL ++  G
Sbjct: 187 KTYGVPGSIVLAIWGRETGFGAAKIPNSAIEVLATKAFMSTRKEMFRTELVAALHILDGG 246

Query: 183 VISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            ++  +  G+  G +GQ QF+P + +KYA+D D DG  ++  S  D +AS A +L K GW
Sbjct: 247 DVTPANFKGSWAGALGQPQFMPTSYLKYAVDFDGDGHRNIWTSVPDTLASIANYLVKKGW 306

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA----AHIDGVPIGKG 285
            +   +         +       +  K +++ A      I G     G
Sbjct: 307 QRGRDWGFEVSIPEAVSCAQEGPDLAKPLSHWASLGIDRISGKGFPSG 354



 Score = 44.1 bits (102), Expect = 0.025,   Method: Composition-based stats.
 Identities = 10/28 (35%), Positives = 13/28 (46%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             NF I+K +N S  Y   I  +A  I 
Sbjct: 376 TPNFYIIKEYNNSDLYALYIGNLADRIA 403


>gi|90408519|ref|ZP_01216677.1| membrane-bound lytic murein transglycosylase B [Psychromonas sp.
           CNPT3]
 gi|90310398|gb|EAS38525.1| membrane-bound lytic murein transglycosylase B [Psychromonas sp.
           CNPT3]
          Length = 339

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 115/218 (52%), Gaps = 5/218 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++ +  +  A+ +G+      + F ++++L  ++  D++      +S  DYL      
Sbjct: 33  FNDYINTLKKEAITKGIDSDIVNNAFHNVKFLKRSVTSDKQQPQ-FKLSLDDYLSKAVPE 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +     + N  LL  + K+Y V P  +++LWG+E++FG   G+  ++S+L+T+AY+
Sbjct: 92  WKVKRARNAYRDNYTLLNEIGKKYNVQPRFIVSLWGIESNFGRITGRHDVISSLSTMAYE 151

Query: 162 CRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR   F +Q F AL +++ G I   + LG+  G +GQ QF+P + + YA+D D DGK D
Sbjct: 152 GRREALFKKQLFAALSILEAGYIEQENFLGSWAGAMGQVQFMPTSYLHYAVDHDGDGKKD 211

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK---NFA 255
           +  +  D  ASAA +L   GW     +    K   NF 
Sbjct: 212 IWSNLGDVFASAANYLKMEGWEGSETWGRQVKLPTNFD 249



 Score = 38.7 bits (88), Expect = 0.89,   Method: Composition-based stats.
 Identities = 9/29 (31%), Positives = 16/29 (55%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDG 279
             N+ +L HWN S  +   ++Y+A  I+ 
Sbjct: 300 YNNYKVLMHWNRSYYFASAVSYLAERINN 328


>gi|15887446|ref|NP_353127.1| lytic murein transglycosylase [Agrobacterium tumefaciens str. C58]
 gi|15154961|gb|AAK85912.1| lytic murein transglycosylase [Agrobacterium tumefaciens str. C58]
          Length = 421

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 69/295 (23%), Positives = 119/295 (40%), Gaps = 25/295 (8%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEW-KSAARARAVREGMSPKTA 63
                  L  +  + +      + A      +     F  W K      A + G+S +T 
Sbjct: 3   HRFATKALAAILSVFSATTVLAQSAPKGAAAAKYDADFNAWLKKEIWPEARKAGISQETL 62

Query: 64  KHLFADLEY---------LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
           +   + L                 +++    +   S   Y        +   G +L   +
Sbjct: 63  EATLSGLSISWNLPDLVIPGQKPPKEQSQSQAEFSSPGAYFSEKRLQGLAVTGRSLAATH 122

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           +  L  ++ +YGVP  I++A+WG E+ FG       ++  LAT AY   R + F  +   
Sbjct: 123 AATLRRIETKYGVPGDIVVAIWGRESGFGRAKLPHSVVDVLATKAYMSTRKEMFRTELID 182

Query: 175 ALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAA 233
           AL +V+ G I++   +G+  G +GQ QF+P + +KYA+D D DG  D+  S  DA+AS A
Sbjct: 183 ALKIVESGDIAASRMMGSWAGALGQPQFMPSSYLKYAVDFDGDGHRDIWNSVPDALASIA 242

Query: 234 KFLAKLGWTKCAGYQPGEKNFAILKHWNASLNY-----NKTIAYIAA----HIDG 279
            +L++ GW +   +      F +    N S         + +A  A      I G
Sbjct: 243 NYLSQRGWQRNRDWG-----FEVSIPANVSCAQEGPDLARPVADWAKMGITRISG 292



 Score = 48.3 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 42/158 (26%), Gaps = 28/158 (17%)

Query: 136 WGLETHFGETMGKTP-LLSTLATLAYD------CRRAKFFTEQFFYALDLVKKGVISSHA 188
           + ++            +   LA++A         R   +  E    A     +       
Sbjct: 218 YAVDFDGDGHRDIWNSVPDALASIANYLSQRGWQRNRDWGFEVSIPANVSCAQEGPDLAR 277

Query: 189 LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
             A + ++G  +          + AD                     L   G  +     
Sbjct: 278 PVADWAKMGITRISGKAFPVNDLTADGM------------------MLVPAG--RHGPEF 317

Query: 249 PGEKNFAILKHWNASLNYNKTIAYIAAHID-GVPIGKG 285
               NF ++K +N S  Y   I  +A  I  G    KG
Sbjct: 318 VVTPNFYVIKEYNNSDLYALFIGNLADRIAHGAGPFKG 355


>gi|319407603|emb|CBI81253.1| putative membrane-bound lytic murein transglycosylase [Bartonella
           sp. 1-1C]
          Length = 418

 Score =  182 bits (462), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 70/349 (20%), Positives = 129/349 (36%), Gaps = 72/349 (20%)

Query: 1   MSFKKYLLISLL-------MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
           M   K+  +  L       ++   +L+   T P   ++     ++   F  W +  +  A
Sbjct: 1   MKTTKFSPLFFLKKTINQRLLFICLLSIFATLPIVFSSLTYADNS---FQHWINEFKKTA 57

Query: 54  VREGMSPKTAKHLFADL-EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           +   +S  T    F  +       + +         +S+ +Y D     + I +G    K
Sbjct: 58  LANNISSSTFDIAFKTIHTIDQEVLKKAAYQPEFVDMSW-EYFDNRVHDDAIVEGKQQAK 116

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK----TPLLSTLATLAY-DCRRAKF 167
              + L  ++K +GV   +L+A+W +E+++G+ +         + +LATLAY D +R K+
Sbjct: 117 KWQQWLQKIEKRFGVNHNLLLAIWSMESNYGKVLTNKGVMRDAIRSLATLAYADPKRQKY 176

Query: 168 FTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
              Q   A+ +++ G I     +G+  G +G  QF+P + + YAID D  G  D+  S  
Sbjct: 177 ARTQLIAAMKILQSGEIDRSQLVGSWAGALGHTQFIPSSYLIYAIDMDGSGHSDIWNSIP 236

Query: 227 DAIASAAKFLAKLGWTKCAGYQPG--EKNFA----------------------------- 255
           D++A+AA  L   GW     +       N                               
Sbjct: 237 DSLATAANLLHMNGWQSNLIWGIEVKLPNNKTLPENWLSFKQWKELGVQHAHGKPFPSLS 296

Query: 256 -----------------------ILKHWNASLNYNKTIAYIAAHIDGVP 281
                                  +LK +N +  Y   +  +A  I G P
Sbjct: 297 EQAILKFPDGPKGPAFLVTKNFFVLKRYNNADRYAFAVGLLADRIAGHP 345


>gi|325291536|ref|YP_004277400.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
 gi|325059389|gb|ADY63080.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
          Length = 440

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 76/353 (21%), Positives = 128/353 (36%), Gaps = 72/353 (20%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEW-KSAARARAVREGMSPKTA 63
            +  +  L  +  + +      + A T    +     F  W K      A + G+S KT 
Sbjct: 22  SWKSLKALAAILSVFSATDALAQSAPTGAAAARYDAGFNAWLKKEIWPEARKAGISQKTL 81

Query: 64  KHLFADLEYLDT---------TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
           +   + L    +            +++    +   S   Y        + A G +L   +
Sbjct: 82  EAALSGLSINWSLPDLVIPGQKPPKEQSQSQAEFSSPGAYFSEKRLQGLAATGRSLAATH 141

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           +  L  ++ +YGVP  +++A+WG E+ FG       ++  LAT AY   R + F  +   
Sbjct: 142 AATLRRIEAKYGVPGDVVLAIWGRESGFGRAKLPHSVVDVLATKAYMSTRKEMFRTELID 201

Query: 175 ALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAA 233
           AL +V+ G I++   +G+  G +GQ QF+P + +KYA+D D DG  D+  S  DA+AS A
Sbjct: 202 ALKIVESGDIAASRMMGSWAGALGQPQFMPSSYLKYAVDFDGDGHRDIWNSVPDALASIA 261

Query: 234 KFLAKLGWTKCAGY-------------QPGEKNFAILKHW-------------------- 260
            +L++ GW +   +             Q G      +  W                    
Sbjct: 262 NYLSQRGWQRDRDWGFEVSIPGNVSCAQEGPDLARPVSAWAKMGITRISGKAFPSNDLSA 321

Query: 261 ---------------------------NASLNYNKTIAYIAAHID-GVPIGKG 285
                                      N S  Y   I  +A  I  G    KG
Sbjct: 322 DGMMLVPAGRHGPEFVVTPNFYVIKEYNNSDLYALFIGNLADRISHGAGPFKG 374


>gi|227355435|ref|ZP_03839831.1| membrane-bound lytic murein transglycosylase B [Proteus mirabilis
           ATCC 29906]
 gi|227164422|gb|EEI49306.1| membrane-bound lytic murein transglycosylase B [Proteus mirabilis
           ATCC 29906]
          Length = 375

 Score =  182 bits (461), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 72/226 (31%), Positives = 115/226 (50%), Gaps = 3/226 (1%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
                     S T  +F  +  A + +A   G  P+T    F+++ ++D  +  DR    
Sbjct: 53  ASLEQAFPKQSRTPAQFPAYVDALKQKAAELGYKPETINFAFSEIHFIDRVVKSDRNQPE 112

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
              ++   YL  + +   IA+G  L +AN + L  +  +Y VP   ++ALWGLE+ FG  
Sbjct: 113 K-KITLDVYLPRVVTKGRIAEGAKLYQANQQTLAQISNQYDVPANYIVALWGLESGFGRV 171

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS--SHALGATFGEIGQFQFLP 203
            GK  ++S LATLA++ RR   F+ Q   AL++++ G +       G+  G +GQ QF+P
Sbjct: 172 QGKEDVISALATLAFEGRREALFSRQLMAALEIIENGHLPVGQRLKGSWAGAMGQTQFMP 231

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
            + + YA D + DG ID+  S  DA ASAA +LA  GW +   +  
Sbjct: 232 SSFLTYAADGNGDGNIDIWNSREDAFASAANYLATEGWQRDLPWGE 277


>gi|298485427|ref|ZP_07003514.1| Hrp-associated lytic transglycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160047|gb|EFI01081.1| Hrp-associated lytic transglycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 413

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 74/341 (21%), Positives = 128/341 (37%), Gaps = 65/341 (19%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTA---DRFGEWKSAARARAVREGMS 59
            +  ++ + L+++    A A      A      S+ +     F +W +  R+ A  +G+ 
Sbjct: 1   MRSRVITTSLVVIMLSCASAAPACFSADMTPSVSNESTSEADFQQWLATFRSNATTKGID 60

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
             T    F ++    T    D         +  DYL    + + I QG  L +    +L 
Sbjct: 61  TATLDLAFQNITLDPTVHQLDMAQPE-FTTAIWDYLSERLTPKNIQQGQELLQ-KEPVLN 118

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATLAY  RR  +   Q   AL +V
Sbjct: 119 EVERHYGVDAKIIAAIWCIESGYGKDIGSRDVIRSLATLAYKGRRMDYGATQLMAALHIV 178

Query: 180 KKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           +   I  +  +G+  G +GQ QF+P   + YA+D + D + D+  S  DA+AS A +L +
Sbjct: 179 QNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRDVWSSRADALASTASYLQR 238

Query: 239 LGWTKCAGYQPGEK---NF----------AILKHW------------------------- 260
             W     +    +   NF            +  W                         
Sbjct: 239 SAWNSRVSWGQEVQLPENFDYAQADISIKKPVAEWQRLGVMGTKQAIPGELAQEQASVLL 298

Query: 261 ---------------------NASLNYNKTIAYIAAHIDGV 280
                                N S  Y  TI  +A    G 
Sbjct: 299 PAGYRGPAFMVLSNFRSILRYNNSTAYALTIGLLADSYAGG 339


>gi|33592814|ref|NP_880458.1| putative peptidoglycan-binding protein [Bordetella pertussis Tohama
           I]
 gi|33572462|emb|CAE42032.1| putative peptidoglycan-binding protein [Bordetella pertussis Tohama
           I]
 gi|332382227|gb|AEE67074.1| putative peptidoglycan-binding protein [Bordetella pertussis CS]
          Length = 409

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 75/309 (24%), Positives = 122/309 (39%), Gaps = 61/309 (19%)

Query: 40  DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLS 99
           D +       R  A++ G+   T     A L      +               DY+ GL 
Sbjct: 37  DAYRACLKQLRGDAIKSGVQAATYDAQTASLAPDMDVLGFLDVQPE-FKTPIWDYMAGLV 95

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
             E I  G      ++ +L   + EYGV P  ++A+WG+E++FG+ +G  PLL++L+TL+
Sbjct: 96  DEERIEDGRQALARHADVLARAQAEYGVDPATVVAVWGVESNFGKNLGGRPLLTSLSTLS 155

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
              RR  +F  +FF  L +++   +    L G+  G  GQ QF+P   ++ A+D D DG+
Sbjct: 156 CFGRRQSYFRGEFFATLKIIQDEHMQPERLAGSWAGAFGQTQFMPSTYLRLAVDFDGDGR 215

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTKCAGY-------------QPGEKNFAILKHW----- 260
            DLV S  DA+ S A FL + GW     +               G +N   +  W     
Sbjct: 216 RDLVDSVPDALGSTANFLRRAGWQTGQPWGFEVKLPAGMDLAGTGRRNKQPMSAWQARGI 275

Query: 261 ----------------------------------------NASLNYNKTIAYIAAHIDGV 280
                                                   NA+ +Y   IA+++  + G 
Sbjct: 276 KRVDGGALPAGDTPAALLAPAGAQGPVFLVLRNFDALYSYNAAESYALAIAHLSDRLRGD 335

Query: 281 -PIGKGYDT 288
            P  + + T
Sbjct: 336 LPFARAWPT 344


>gi|289662030|ref|ZP_06483611.1| epimerase [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 713

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 79/334 (23%), Positives = 130/334 (38%), Gaps = 80/334 (23%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           L++ + P+ A A                   F    +  +++A  +G+   + +   A L
Sbjct: 3   LVLGLLPLAACADPA----------------FDRCLAGLQSQAAAKGVDAASFQRFTAGL 46

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
               + +               DYL  L  S+ +  G A+   +  LL  L ++ GV P 
Sbjct: 47  VPDPSVLPLLDAQPE-FTTPIWDYLASLVDSQRVTDGQAMLVTHRELLSRLSEQTGVDPA 105

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-L 189
            ++A+WG+E+ +G   GK PLL +LATL+   RR  FF  +F   L L+++G +S+    
Sbjct: 106 TVVAVWGVESDYGRVTGKRPLLVSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSADGLT 165

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG------W-- 241
           G+  G  GQ QF+P    + A+D D DG+ DLV S  DA+AS A +L K G      W  
Sbjct: 166 GSWAGAFGQTQFMPSTYARIAVDGDGDGRRDLVASIPDALASTANYLVKAGWERARPWGM 225

Query: 242 ------------------TKCAGYQPGE-------------------------------- 251
                                  +Q                                   
Sbjct: 226 EVTLPRGFDASKAGRTRRQPLQAWQTAGLLGTDGKPLVPTGLPAETPAALLLPAGATGPA 285

Query: 252 ----KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
               +N+  +  +NA+ +Y  +IA +A  +   P
Sbjct: 286 FLVFRNYDAIYAYNAAESYALSIALLADRLRAGP 319


>gi|254475203|ref|ZP_05088589.1| lytic murein transglycosylase [Ruegeria sp. R11]
 gi|214029446|gb|EEB70281.1| lytic murein transglycosylase [Ruegeria sp. R11]
          Length = 390

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 75/319 (23%), Positives = 110/319 (34%), Gaps = 59/319 (18%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           +        A      +     F  + S+ +  A+  G    T    F  +      +  
Sbjct: 4   SSLFALITLALPVTAHAQCGGGFSNFVSSLKEEAMTGGYDRATVNRFFKGVRQDPAVLKA 63

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR         F ++   L S   + +G A+ K    +   ++  YG+  G+L+A W  E
Sbjct: 64  DRAQG-VFQKPFVEFSQRLISQGRLDRGRAMSKKYDAIFRRIETTYGIDRGVLLAFWAFE 122

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQ 198
           T +G   G    L+ L TLA+DCRR + F  Q F AL+L   G        GA  GEIG 
Sbjct: 123 TDYGAVQGNFNTLNALVTLAHDCRRPELFRPQVFAALELYSNGDFDPQKTTGAWAGEIGM 182

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY----------- 247
            Q LP ++++  +DAD DG + L  S  DA+ S AK L+ LGW     +           
Sbjct: 183 VQMLPRDILENGVDADGDGHVRLKTSAPDALMSGAKMLSHLGWRPNEPWLQEVKIPTDLD 242

Query: 248 -------------------------QPGEKNFAI---------------------LKHWN 261
                                    +    N                           WN
Sbjct: 243 LSQTGAYRKKSVAQWQKLGVAPRDGRLANPNMKAALLLPQGHKGPAFLAYPNFDVYFEWN 302

Query: 262 ASLNYNKTIAYIAAHIDGV 280
            S  Y  T AY    + G 
Sbjct: 303 QSFTYVLTAAYFGTRLSGA 321


>gi|71282243|ref|YP_270190.1| putative transglycosylase [Colwellia psychrerythraea 34H]
 gi|71147983|gb|AAZ28456.1| putative transglycosylase [Colwellia psychrerythraea 34H]
          Length = 347

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 75/259 (28%), Positives = 128/259 (49%), Gaps = 13/259 (5%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+     +I  ++++  M+  ++              T + F E+    +A A+ +G S 
Sbjct: 1   MNLTIKSIILSMLLIIGMMNSSMAAKA--------ELTEEGFAEYVIKLKAEALAKGFSK 52

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
                 FA++++ +  +  DR    +   +   YL        + +  AL K +  LL  
Sbjct: 53  ALIDESFAEVKFHERAVKADRSQPENVE-TLDTYLPKRVPKWKVDKARALYKEHQVLLNQ 111

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           + ++Y V P  ++ALWGLET+FG+  G   ++S LATLAY+ RR  FF +Q   AL ++ 
Sbjct: 112 IGEKYQVQPRFIVALWGLETNFGKFTGGYNVISALATLAYEGRREVFFKKQLMAALTILD 171

Query: 181 KGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G I + +  G+  G +GQ QF+P + + YA+D D DGK D+ ++  D  +S A +L K 
Sbjct: 172 EGHITNKNMKGSWAGAMGQNQFMPTSFLSYAVDGDGDGKKDIWQNQADIFSSMANYLQKE 231

Query: 240 GWTKCAGYQPG---EKNFA 255
           GW     +       KNF 
Sbjct: 232 GWNDELTWGRQVKLPKNFD 250


>gi|116253819|ref|YP_769657.1| peptidoglycan binding protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258467|emb|CAK09571.1| putative peptidoglycan binding protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 407

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 74/309 (23%), Positives = 125/309 (40%), Gaps = 63/309 (20%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL-EYLDTTIARDRKMVTSPPVSF 91
              +    RF +W +     A + G+S  T +  F+ + E   T + +            
Sbjct: 26  PDNAKADSRFQKWIADFYQTAAQSGISKATYQKAFSGVSEPDPTVLEKAAYQPE-FTSKI 84

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP- 150
            DY+D   +   +  G  +   ++R L  +++ +GV   IL+A+W +E+++G  + K   
Sbjct: 85  WDYVDSRVNPYTVKIGREMAAKHARTLAAIEQRFGVDKTILLAIWSMESNYGAVLDKDDR 144

Query: 151 ---LLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVN 205
              +   LATLAY D  RAKF  +Q   AL +++ G + +    G+  G +G  QF+P +
Sbjct: 145 LHYVPRALATLAYADPSRAKFAKKQLVAALKILQNGDVPAREMTGSWAGAMGHTQFIPTS 204

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ----------------- 248
            + YAIDAD +G  D+  S  DA+A++A  L K GW     +                  
Sbjct: 205 YLLYAIDADGNGHRDIWNSIPDALATSANLLMKNGWDTGKTWGYEVVVPAAAAKQAGKSH 264

Query: 249 ------------PGEKNFA--------------------------ILKHWNASLNYNKTI 270
                       P  K F                            +K++NAS +Y   +
Sbjct: 265 TLAQWAALGLTRPNGKAFRESATKAVLKMPAGAGGPGFLMTANFYTIKNYNASDSYALAV 324

Query: 271 AYIAAHIDG 279
             +A  I G
Sbjct: 325 GLLADQIAG 333


>gi|146338190|ref|YP_001203238.1| putative membrane-bound lytic murein transglycosylase signal
           peptide [Bradyrhizobium sp. ORS278]
 gi|146190996|emb|CAL75001.1| Putative membrane-bound lytic murein transglycosylase, putative
           signal peptide [Bradyrhizobium sp. ORS278]
          Length = 475

 Score =  181 bits (460), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 69/317 (21%), Positives = 114/317 (35%), Gaps = 60/317 (18%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
                  T     + A  F    +     A R  ++    +   A L      +      
Sbjct: 87  ASGHPLMTAAAIREAAGNFDACVAGMWPDAARRNITQDNFQRFTAGLTPDLRIMDLLDAQ 146

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
                 S  DYLD L +   +A+G  +           ++ YGV   I+ A+WG+E+++ 
Sbjct: 147 PE-FTKSIWDYLDILVNDNRLAKGREVLAKYKPQFDATERAYGVDRFIIAAIWGIESNYS 205

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFL 202
             +G   +L + ATLA   RR  +F ++F  AL+++ +G +      G+  G  G  QF+
Sbjct: 206 TQIGDRSVLQSTATLACIGRRQAYFKDEFLSALEILNRGDLRPEQLRGSWAGAFGPTQFM 265

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT-------------------- 242
           P    ++A+DAD DG+ D+V +  D IAS A  L K GW                     
Sbjct: 266 PTAFKRFAVDADGDGRRDVVDNPADLIASTANNLKKDGWQSGQSWGYEVVLPQGFNFMLA 325

Query: 243 -------------------KCAGY----------------QPG---EKNFAILKHWNASL 264
                                  +                 PG    +NF ++  +N + 
Sbjct: 326 DRAKTMSFAQWEQLGLRRANGQPFPATTEKAYLLAPAGAQGPGFLMLQNFRVIMKYNPAE 385

Query: 265 NYNKTIAYIAAHIDGVP 281
            Y   I + A  + G P
Sbjct: 386 AYALAIGHFADRLRGAP 402


>gi|126739507|ref|ZP_01755200.1| hypothetical protein RSK20926_21360 [Roseobacter sp. SK209-2-6]
 gi|126719607|gb|EBA16316.1| hypothetical protein RSK20926_21360 [Roseobacter sp. SK209-2-6]
          Length = 266

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 99/266 (37%), Positives = 146/266 (54%), Gaps = 3/266 (1%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           ++    +A   +    A+    C +TA  F  WK++    A R G+     +   ++  Y
Sbjct: 3   ILQISAIALVASFFSSASFAASCGNTAAGFEAWKASFAKTAKRAGVKRPGLQ-ALSNARY 61

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TIA DR   +    S + ++    S  IIAQG   +  N      L+K+YGVP G+L
Sbjct: 62  ASRTIAADRNQKS-FRYSLEKFMQVRGSETIIAQGRKRRARNQAFFAALEKKYGVPAGVL 120

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+ G+ET FG  MG + ++S + TL YDCRR+ FF      AL LV +G I+S  LGA 
Sbjct: 121 IAIHGMETAFGNFMGDSQVVSAIVTLTYDCRRSAFFEPHALGALKLVDQGAITSATLGAK 180

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GE+G  QFLP N +++ +D D +G++D   +  DA+AS A FL K GW +  GYQ GE 
Sbjct: 181 HGELGHTQFLPGNALRFGVDWDRNGRVDFY-NLEDALASTAFFLKKKGWKRGKGYQQGEP 239

Query: 253 NFAILKHWNASLNYNKTIAYIAAHID 278
           NF +LK WNA+  Y +++A +   ID
Sbjct: 240 NFRVLKEWNAATVYQQSLAIMGRRID 265


>gi|240849841|ref|YP_002971229.1| membrane-bound lytic murein transglycosylase [Bartonella grahamii
           as4aup]
 gi|240266964|gb|ACS50552.1| membrane-bound lytic murein transglycosylase [Bartonella grahamii
           as4aup]
          Length = 418

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 75/326 (23%), Positives = 126/326 (38%), Gaps = 60/326 (18%)

Query: 16  YPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
             +   AV            S     F  W    +  A+   ++P T    F  +  +D 
Sbjct: 20  TLLTGSAVIFSAFLMFFVSLSYADSGFKHWIKEFKKIAIAHNITPSTFHMAFKGVNAIDP 79

Query: 76  TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
            + +             +Y D       I +G    +  ++ L+ ++K +GV   IL+A+
Sbjct: 80  EVLKSAAYQPEFVAPSWNYFDNRVHDIAIVEGRRQTQKWNKWLLQIEKRFGVDRNILLAI 139

Query: 136 WGLETHFGETMGK----TPLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHA-L 189
           W +E+++G+ +         + +LATLAY D +RAK+   Q   A+ +++ G I      
Sbjct: 140 WSMESNYGKVLANKSVMRDTIRSLATLAYADKKRAKYAYTQLIAAMKILQSGEIKRSQLT 199

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ- 248
           G+  G +G  QF+P + + YA+D D+DG+ D+  S  DA+A+AA  L K GW     +  
Sbjct: 200 GSWAGALGHTQFIPSSYLAYAVDMDQDGRRDIWNSVPDALATAANLLHKNGWQPNLIWGV 259

Query: 249 ----PGEKN-------------------------------------------------FA 255
               P  KN                                                 F 
Sbjct: 260 EVKVPQGKNLPEGWYSFEQWKKLGVKHANGRPLPTLAEQAILKYPDGAKGPIFLVTKNFF 319

Query: 256 ILKHWNASLNYNKTIAYIAAHIDGVP 281
           +LKH+N +  Y   +A +A  I G P
Sbjct: 320 VLKHYNNADRYAFAVALLADRIAGHP 345


>gi|28868073|ref|NP_790692.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28851309|gb|AAO54387.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 413

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 74/341 (21%), Positives = 128/341 (37%), Gaps = 65/341 (19%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTA---DRFGEWKSAARARAVREGMS 59
            +  ++ + L+++    A A      A      S+ +     F +W +  R+ A  +G+ 
Sbjct: 1   MRSRVITTSLVVIMLSCASAAPACFSADMTPSVSNESTSEADFQQWLATFRSNATTKGID 60

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
             T    F ++    T    D         +  DYL    + + I QG  L +    +L 
Sbjct: 61  TATLDLAFQNITLDPTVHQLDMAQPE-FTTAIWDYLSERLTPKNIQQGQELLQ-KEPVLN 118

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATLAY  RR  +   Q   AL +V
Sbjct: 119 EVERHYGVDAKIIAAIWCIESGYGKDIGSRDVIRSLATLAYKGRRMDYGATQLMAALHIV 178

Query: 180 KKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           +   I  +  +G+  G +GQ QF+P   + YA+D + D + D+  S  DA+AS A +L +
Sbjct: 179 QNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRDVWSSRADALASTASYLQR 238

Query: 239 LGWTKCAGYQPGEK---NF----------AILKHW------------------------- 260
             W     +    +   NF            +  W                         
Sbjct: 239 SAWNSRVSWGQEVQLPENFDYAQADMSIKKPVAEWQRLGVMGTKQAIPGELAQEQASVLL 298

Query: 261 ---------------------NASLNYNKTIAYIAAHIDGV 280
                                N S  Y  TI  +A    G 
Sbjct: 299 PAGYRGPAFMVLSNFRSILRYNNSTAYALTIGLLADSYAGG 339


>gi|126733869|ref|ZP_01749616.1| Membrane-bound lytic murein transglycosylase B [Roseobacter sp.
           CCS2]
 gi|126716735|gb|EBA13599.1| Membrane-bound lytic murein transglycosylase B [Roseobacter sp.
           CCS2]
          Length = 399

 Score =  181 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 79/259 (30%), Positives = 128/259 (49%), Gaps = 18/259 (6%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M  + ++  SL  +  P LA A                A  F  W +A R RA   G++ 
Sbjct: 5   MHRRHFIAASLSTIALPSLATA---------------QASGFQNWIAAFRGRARAAGIND 49

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +T    FAD++YL  +I RDR           DY+    S   ++ G  + +  + LL  
Sbjct: 50  RTFNAAFADIQYLPDSIERDRNQAE-FVRPLADYMSTAVSDTRVSNGRDMVRRYAGLLAQ 108

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++  + V P +++A+WG+E+++G+  G TPL+STLATLAYD RR +FF  Q   AL +++
Sbjct: 109 IEARFDVEPQVVVAVWGMESNYGQRRGDTPLISTLATLAYDGRRGQFFESQLIAALKILQ 168

Query: 181 KGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV-KSNIDAIASAAKFLAK 238
            G ++  +  G+  G +G  QF+P +   YA+D   DG+ D+      DA+AS A +  +
Sbjct: 169 NGDVAPRNMTGSWAGAMGHTQFIPTSYEAYAVDFTGDGRRDIWTDDPSDALASTAAYFRR 228

Query: 239 LGWTKCAGYQPGEKNFAIL 257
            GW K   +    +     
Sbjct: 229 FGWRKGQPWGVEVRLPRAF 247



 Score = 46.0 bits (107), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 36/132 (27%), Gaps = 17/132 (12%)

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFL----PVNVVKYAIDA-DE 215
           D   A   T  +F      K              + GQ        P    +  +   D 
Sbjct: 214 DPSDALASTAAYFRRFGWRKGQPWGVEVRLPRAFDFGQTGRTVTRRPSEWARLGVVGVDG 273

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
               D      DA  S        G           +N+ ++  +N +  Y   + +++ 
Sbjct: 274 RAVPD----YGDATLST-----PTG--AGGPAFLLFRNYDVIGRYNNAEAYIIGVGHLSD 322

Query: 276 HIDGV-PIGKGY 286
            I G  P+   +
Sbjct: 323 RIRGAGPLQTAF 334


>gi|33597706|ref|NP_885349.1| putative peptidoglycan-binding protein [Bordetella parapertussis
           12822]
 gi|33602554|ref|NP_890114.1| putative peptidoglycan-binding protein [Bordetella bronchiseptica
           RB50]
 gi|33574134|emb|CAE38463.1| putative peptidoglycan-binding protein [Bordetella parapertussis]
 gi|33576993|emb|CAE34073.1| putative peptidoglycan-binding protein [Bordetella bronchiseptica
           RB50]
          Length = 409

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 79/339 (23%), Positives = 129/339 (38%), Gaps = 61/339 (17%)

Query: 10  SLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFAD 69
           + L ++      A   P  A          D +       R  A++ G+   T     A 
Sbjct: 7   AYLRLLCATAFAAAATPALAAPAAATPADLDAYRACLKQLRGDAIKSGVQAATYDAQTAS 66

Query: 70  LEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPP 129
           L      +               DY+ GL   E I  G      ++ +L   + EYGV P
Sbjct: 67  LAPDMDVLGFLDAQPE-FKTPIWDYMAGLVDEERIEDGRQALARHADVLARAQAEYGVDP 125

Query: 130 GILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL 189
             ++A+WG+E++FG+ +G  PLL++L+TL+   RR  +F  +FF  L +++   +    L
Sbjct: 126 ATVVAVWGVESNFGKNLGGRPLLTSLSTLSCFGRRQSYFRGEFFATLKIIQDEHMQPERL 185

Query: 190 -GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY- 247
            G+  G  GQ QF+P   ++ A+D D DG+ DLV S  DA+ S A FL + GW     + 
Sbjct: 186 AGSWAGAFGQTQFMPSTYLRLAVDFDGDGRRDLVDSVPDALGSTANFLRRAGWQTGQPWG 245

Query: 248 ------------QPGEKNFAILKHW----------------------------------- 260
                         G +N   +  W                                   
Sbjct: 246 FEVKLPAGMDLAGTGRRNKQPMSAWQARGIKRVDGGALPAGDAPAALLAPAGAQGPVFLV 305

Query: 261 ----------NASLNYNKTIAYIAAHIDGV-PIGKGYDT 288
                     NA+ +Y   IA+++  + G  P  + + T
Sbjct: 306 LRNFDALYSYNAAESYALAIAHLSDRLRGDLPFARAWPT 344


>gi|307292801|ref|ZP_07572647.1| lytic murein transglycosylase [Sphingobium chlorophenolicum L-1]
 gi|306880867|gb|EFN12083.1| lytic murein transglycosylase [Sphingobium chlorophenolicum L-1]
          Length = 345

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 62/223 (27%), Positives = 101/223 (45%), Gaps = 4/223 (1%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV----T 85
           T   + +     F  +  + R RA   G+   T   +F  L      +  D+        
Sbjct: 21  TADSVMAQEDPAFRAYLESLRPRARALGIRDATLDSVFPGLTPNPRVVQLDQNQPGGGAY 80

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
           +P  +F+ Y      +  I +G     AN   L  ++ E GVP  I++A++G ET++G  
Sbjct: 81  APIPNFEPYRRQHVDAARIGRGRTAYIANRARLGRIEAETGVPEEIMVAIYGHETNYGSY 140

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVN 205
            G   L+ +LATL+Y+ RR   F  +    L ++  GV  S  +G+  G  G  QFLP  
Sbjct: 141 TGDFDLIRSLATLSYEGRRRALFEPELLATLKMLDNGVPRSRLVGSWAGATGYPQFLPSV 200

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            ++   D D DG++D+  S  DA+AS A +    GW +   + 
Sbjct: 201 YLRLGKDGDGDGRVDIWNSEADALASIANYFVHAGWRRGQPWG 243


>gi|89052848|ref|YP_508299.1| lytic murein transglycosylase [Jannaschia sp. CCS1]
 gi|88862397|gb|ABD53274.1| Lytic murein transglycosylase [Jannaschia sp. CCS1]
          Length = 514

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 73/314 (23%), Positives = 126/314 (40%), Gaps = 63/314 (20%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
               +   F  W +   ARA+  G+S +T    F  L+     + RDR        +  D
Sbjct: 136 PPRTSDPEFRAWIAEFEARALAAGISAETFARAFDGLQLNTRVLERDRNQAE-FSRALWD 194

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           YLD   S+  I  G          L  ++ +Y V   +++A+WGLE+ +G   G   ++ 
Sbjct: 195 YLDTAVSATRIRNGREALSEWRTTLGRIEAQYQVEAEVVVAVWGLESAYGAMRGSEGIVE 254

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAID 212
            +A+LA+D RR  FF EQ   AL +++ G   + +  G+  G +G  QF+P + +++A D
Sbjct: 255 AMASLAFDGRRQDFFEEQLIAALQILEAGDTRARNMTGSWAGAMGHTQFMPTSYLEFAQD 314

Query: 213 ADEDGKIDLV-KSNIDAIASAAKFLAKLGWTKCAGYQ-------------PGEKNFAILK 258
            D+DG+ ++   + +DA+AS A +L + GW     +               GE+      
Sbjct: 315 FDDDGRRNIWSDNPVDALASTAHYLVEHGWVYGQPWGMEVRLPEGFDYRLAGEQERIGAA 374

Query: 259 HWNA--------------------------------------------SLNYNKTIAYIA 274
            WNA                                            +  Y   I +++
Sbjct: 375 FWNAMGVRLVNGDPLPDHGPASILLPAGAEGVALVVHSNFRVIERYNPADAYVIAIGHLS 434

Query: 275 AHIDGVPIGKGYDT 288
             I+G P   G++ 
Sbjct: 435 DRINGGP---GFEA 445


>gi|56698058|ref|YP_168429.1| hypothetical protein SPO3226 [Ruegeria pomeroyi DSS-3]
 gi|56679795|gb|AAV96461.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 387

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 79/324 (24%), Positives = 116/324 (35%), Gaps = 62/324 (19%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
           + P +  A+     A +Q         F  +    +A AV  G         F       
Sbjct: 3   ILPQIMAAIVLASPALSQ-----CGGGFSSFVDGLKAEAVSMGHDAALVDRFFQGAAQDA 57

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
             +  DR         F ++   L S   +  G A+ +    +   ++ EYGV  G+L+A
Sbjct: 58  KVLKADRAQG-VFQKPFVEFSRRLISQNRLDTGKAMGRKYDAVFDRIEAEYGVSRGVLLA 116

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATF 193
            W  ET FG   G     + L TLA+DCRR + F  Q F A++L   G        GA  
Sbjct: 117 FWAFETDFGGFQGDFNTRNALITLAHDCRRPELFRPQIFAAIELYSHGDFDPARTTGAWA 176

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY------ 247
           GEIG  Q LP ++++  +D D DG + L  S  DA+ S A+ L+ LGW     +      
Sbjct: 177 GEIGMVQMLPRDILENGVDGDGDGHVTLKTSAPDALMSGARMLSHLGWRAGEPWLQEVTL 236

Query: 248 ---------QPGEK----------------------------------------NFAILK 258
                     PG+                                         NF +  
Sbjct: 237 PAQMDWSLSGPGKPRSAGEWQAMGVRPRAGDLADLPASLILPQGHKGPAFLAYPNFDVYF 296

Query: 259 HWNASLNYNKTIAYIAAHIDGVPI 282
            WN S  Y  T AY    ++G  +
Sbjct: 297 EWNQSFVYVLTAAYFGTRLEGGQV 320


>gi|167424561|ref|ZP_02316314.1| transglycosylase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|270490813|ref|ZP_06207887.1| lytic murein transglycosylase [Yersinia pestis KIM D27]
 gi|294503856|ref|YP_003567918.1| putative lipoprotein [Yersinia pestis Z176003]
 gi|167056443|gb|EDR66212.1| transglycosylase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|262362025|gb|ACY58746.1| putative lipoprotein [Yersinia pestis D106004]
 gi|270339317|gb|EFA50094.1| lytic murein transglycosylase [Yersinia pestis KIM D27]
 gi|294354315|gb|ADE64656.1| putative lipoprotein [Yersinia pestis Z176003]
 gi|320015239|gb|ADV98810.1| putative lipoprotein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 309

 Score =  181 bits (460), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 69/216 (31%), Positives = 115/216 (53%), Gaps = 2/216 (0%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
                +F  +    +A+A  +G + +T    FA++ ++D  I  DR  +    ++  DYL
Sbjct: 6   GRDPSQFPAYVEQLKAQARAKGYTTETLDTAFANIHFVDRVIKSDRNQLEK-KITLDDYL 64

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             +   + I QG AL +     L  +  +YGVP   ++ALWG+E+ FG+  GK  ++S L
Sbjct: 65  TRVLPRKRIEQGRALYQRYQPQLSQVNAQYGVPGRYIVALWGMESAFGQIQGKEDVISAL 124

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +TLA++ RR  FFT++   AL+++ +G +      G+  G +GQ QF+P + + Y  D D
Sbjct: 125 STLAFEGRREAFFTKELMAALEIIHQGKVDDPQLRGSWAGAMGQSQFMPSSFLTYGADGD 184

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
            DGKID+  +  D  AS A +L+  GW    G+   
Sbjct: 185 SDGKIDIWNNIDDVFASTANYLSTQGWKSEQGWGQE 220


>gi|320326151|gb|EFW82207.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320330685|gb|EFW86662.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330882645|gb|EGH16794.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 413

 Score =  181 bits (459), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 74/332 (22%), Positives = 123/332 (37%), Gaps = 67/332 (20%)

Query: 14  MVYPMLAQAVTQPKKATTQFICS-----DTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +V  MLA A   P    T           +   F +W +  R+ A  +G+   T    F 
Sbjct: 10  LVVIMLACASAAPACFATDMTPGVQNESTSEADFQQWLATFRSNATTKGIDTATLDLAFQ 69

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
           ++    T    D         +  DYL    + +   QG  L +    +L  +++ YGV 
Sbjct: 70  NITLDPTVHQLDTAQPE-FTTTIWDYLSERLTPKNTQQGQELLQ-KEPVLNEVERHYGVN 127

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSH 187
             I+ A+W +E+ +G+ +G   ++ +LATLAY  RR  +   Q   AL +++   I  + 
Sbjct: 128 AKIIAAIWCIESGYGKDIGSRDVIRSLATLAYKGRRMNYGATQLMAALHILQNKDIARAQ 187

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
            +G+  G +GQ QF+P   + YA+D + D + D+  S  DA+AS A +L +  W     +
Sbjct: 188 LIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRDVWSSRADALASTASYLKRSAWNSRISW 247

Query: 248 QPGEK---NF----------AILKHW---------------------------------- 260
               +   NF            +  W                                  
Sbjct: 248 GQEVQLPENFDYAQADMSIKKPVAEWQRLGVMGTTHAIPGELAQEQASVLLPAGYRGPAF 307

Query: 261 ------------NASLNYNKTIAYIAAHIDGV 280
                       N S+ Y  TI  +A    G 
Sbjct: 308 MVLSNFRSILRYNNSIAYALTIGLLADSYAGG 339


>gi|262277222|ref|ZP_06055015.1| membrane-bound lytic murein transglycosylase B [alpha
           proteobacterium HIMB114]
 gi|262224325|gb|EEY74784.1| membrane-bound lytic murein transglycosylase B [alpha
           proteobacterium HIMB114]
          Length = 318

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 75/223 (33%), Positives = 119/223 (53%), Gaps = 3/223 (1%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           S + ++F  W    +  A+ +G+S KT    F + + L   I  DR        +   Y+
Sbjct: 13  SKSDEKFSTWLENYKKYAINQGVSKKTVNEAFKNTKLLKRIITYDRNQPEFIEKT-DVYV 71

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
               + + +     L   N +LL  ++K+Y +P   L+ALWG+ET FG+  GK  ++S L
Sbjct: 72  AKRVNKQKVIYAKKLINNNKKLLDKVEKKYKIPKNYLVALWGVETVFGKHKGKVDIISAL 131

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATL++D RR+K+F+ +    L L+ + V++ S   G+  G  G FQF+P ++  YAID +
Sbjct: 132 ATLSFDKRRSKYFSNELIILLKLIDRQVVNISDLKGSWAGAHGNFQFMPSSIKNYAIDYN 191

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAIL 257
            DGKIDL  S  D+ ASAA +L K+GW K   +    K    +
Sbjct: 192 RDGKIDLYTSLEDSFASAANYLKKIGWDKN-PWGLKVKLTKEI 233


>gi|49474987|ref|YP_033028.1| peptidoglycan-binding protein [Bartonella henselae str. Houston-1]
 gi|49237792|emb|CAF26986.1| Peptidoglycan-binding protein [Bartonella henselae str. Houston-1]
          Length = 418

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 73/325 (22%), Positives = 125/325 (38%), Gaps = 62/325 (19%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD 74
           +   LA   +       Q   ++    F +W    +  A+   +   T    F  +  +D
Sbjct: 21  LIIGLAVLFSVFLMFFAQLSYANV--GFQQWIKEFKKVALTNNILSSTFDMAFKGINAID 78

Query: 75  TTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
             + +             +Y D       I +G +  K   + L  ++K +GV   IL+A
Sbjct: 79  PEVLKKAAYQPEFVDPSWNYFDNRVHDIAIMEGQSQTKKWQKWLSQIEKRFGVDRNILLA 138

Query: 135 LWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQFFYALDLVKKGVI-SSHA 188
           +W +E+++G+ +    ++     +LATLAY D +RAK+   Q   A+ +++ G I  +  
Sbjct: 139 IWSMESNYGKVLANKDVMRDTIRSLATLAYADQKRAKYAQAQLIAAMTILQNGEITRAQL 198

Query: 189 LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            G+  G +G  QF+P + + YAID D DG+ D+  S  DA+A+AA  L   GW     + 
Sbjct: 199 TGSWAGAMGHTQFIPSSYLAYAIDMDGDGRRDIWTSVPDALATAANLLYMNGWQSKLPWG 258

Query: 249 -----PGEKN-------------------------------------------------F 254
                P  KN                                                 F
Sbjct: 259 VEVKLPQGKNLPEDWHSFEQWAKLGVKQANGKHLPSLSERAILKYPDGPEGPIFLVTKNF 318

Query: 255 AILKHWNASLNYNKTIAYIAAHIDG 279
            +LK +N +  Y   +A +A  I G
Sbjct: 319 FVLKRYNNADRYAFAVALLANRIAG 343


>gi|265984485|ref|ZP_06097220.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|264663077|gb|EEZ33338.1| lytic Murein transglycosylase [Brucella sp. 83/13]
          Length = 399

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 77/312 (24%), Positives = 115/312 (36%), Gaps = 59/312 (18%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
                  +    FG+W       A   G+  K               + RDRK  T   +
Sbjct: 25  AVNMPKPECETDFGQWMENLTREAREAGVGEKGIAE-LHKASIDQKVLGRDRKQ-TVFNL 82

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F ++   L S   + +G       + +   ++  YGVP  +L A WGLET +G   G  
Sbjct: 83  TFTEFSKRLISDARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDF 142

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
             L+ L TL+YDCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++ 
Sbjct: 143 DTLNALVTLSYDCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLER 202

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG------EKNFAILK----- 258
            +D D DGK+DL  S  DA+ +A + L++LGW +   +               ++     
Sbjct: 203 GVDGDGDGKVDLKNSVPDAMMTAGRMLSELGWKRSQPWLEEVRLTKDLPWEEAIRTNRKP 262

Query: 259 ----------------------------------------------HWNASLNYNKTIAY 272
                                                          WN S+ Y  T AY
Sbjct: 263 HSWWAEHGVTGLNGPLGPDDGDASLLLPLGRKGPAFLSYPNFDIFVEWNKSIVYATTAAY 322

Query: 273 IAAHIDGVPIGK 284
            A  + G P   
Sbjct: 323 FATRLAGAPAFD 334


>gi|19071492|gb|AAL84245.1|AF458045_1 type III effector HopPmaG [Pseudomonas syringae pv. maculicola]
 gi|330962749|gb|EGH63009.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 413

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 72/341 (21%), Positives = 128/341 (37%), Gaps = 65/341 (19%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTA---DRFGEWKSAARARAVREGMS 59
            +  ++ + L+++    A A      A      S+ +     F +W +  R+ A  +G+ 
Sbjct: 1   MRSRVITTSLVVIMLSCASAAPACFSADMTPSVSNESTSEADFQQWLATFRSNATTKGID 60

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
             T    F ++    T    D         +  DYL    + +   QG  L +    +L 
Sbjct: 61  TATLDLAFQNITLDPTVHQLDMAQPE-FTTAIWDYLSERLTPKNTQQGQELLQ-KEPVLN 118

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATLAY  RR  +   Q   AL ++
Sbjct: 119 EVERHYGVNAKIIAAIWCIESGYGKDIGSRDVIRSLATLAYKGRRMDYGATQLMAALHIL 178

Query: 180 KKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           +   I  +  +G+  G +GQ QF+P   + YA+D + D + D+  S  DA+AS A +L +
Sbjct: 179 QNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRDVWSSRADALASTASYLKR 238

Query: 239 LGWTKCAGYQPGEK---NF----------AILKHW------------------------- 260
             W     +    +   NF            +  W                         
Sbjct: 239 SAWNSRISWGQEVQLPENFDYAQADMSIKKPVAEWQRLGVMGTTHAIPGELAQEQASVLL 298

Query: 261 ---------------------NASLNYNKTIAYIAAHIDGV 280
                                N S+ Y  TI  +A    G 
Sbjct: 299 PAGYRGPAFMVLSNFRSILRYNNSIAYALTIGLLADSYAGG 339


>gi|254282058|ref|ZP_04957026.1| glycosidase family protein [gamma proteobacterium NOR51-B]
 gi|219678261|gb|EED34610.1| glycosidase family protein [gamma proteobacterium NOR51-B]
          Length = 395

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 97/338 (28%), Positives = 142/338 (42%), Gaps = 76/338 (22%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M  + Y +I L +      A                     F + K+  + +A  +G+S 
Sbjct: 1   MRLQFYGVILLSLFGTAASA-----------------DPAEFEQCKTQMQLQASAQGVSE 43

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T K +   LEY    I  DR        SF DY     S   I +G  L       L  
Sbjct: 44  ATVKEVIPTLEYQARVIELDRSQPE-FTQSFADYFGKRVSQSRIDKGRELYAQYRDFLAE 102

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           L ++YGVP   L+A WGLET+FG  +G  P L +LATLA D RR++FFT +F  AL L++
Sbjct: 103 LTRKYGVPGQYLVAFWGLETNFGSYLGGMPTLDSLATLACDPRRSEFFTTEFLLALKLLE 162

Query: 181 KGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +  +    + G+  G +G  QF+P + ++YAID D+DG IDL  S  DA+ASAA FL++L
Sbjct: 163 RENLRVDDMKGSWAGAVGHTQFMPSSYLRYAIDGDDDGSIDLWSSRRDALASAAHFLSQL 222

Query: 240 GWTKCAGYQ-----PGEKNF------AILKHW---------------------------- 260
           GW +   +      P + +F        L+ W                            
Sbjct: 223 GWQRQQRWGREVKLPADYDFTQAVQQRPLQDWRSLGLRNADGGPLPVVIGMDADLIIPSG 282

Query: 261 ------------------NASLNYNKTIAYIAAHIDGV 280
                             N S +Y  ++ ++A  I G 
Sbjct: 283 HKGPVFLVYDNFDVIMQWNRSTSYALSVGHLADRIAGA 320


>gi|217979773|ref|YP_002363920.1| hypothetical protein Msil_3674 [Methylocella silvestris BL2]
 gi|217505149|gb|ACK52558.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 272

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 100/268 (37%), Positives = 147/268 (54%), Gaps = 11/268 (4%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           ++V  M+A A+   + +  Q  C ++A  F  WKS     A   G+             Y
Sbjct: 10  VVVAAMMAFAIAPGQASAAQ--CGNSAAGFEAWKSQFANEAKGRGVGAAGI-AAIQGTHY 66

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI  DR       +S   ++     + I A+G ALK++N+ L  ++++ YGVP G L
Sbjct: 67  NGATIGADRGQH-GFRLSLDQFMAKRGGNTIAARGRALKQSNAGLFASIQQRYGVPAGPL 125

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+WG ET FG   G    LS +ATLAYDCRR+ +FT+Q + AL L+ +G++S++  G+ 
Sbjct: 126 IAIWGFETGFGAVHGNQHALSAVATLAYDCRRSAYFTDQLYAALTLIDRGLMSANERGSM 185

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GEIGQ QFLP N+++Y   A+ D       +   A+ + A FL   GW+  AGYQPGE 
Sbjct: 186 HGEIGQTQFLPKNILEYGGGANLD-------TPSGALNATAAFLKAHGWSPGAGYQPGEA 238

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGV 280
           NFA L+ WNA+  Y + IA +   IDG 
Sbjct: 239 NFAALQAWNAASVYQQAIAMVGQKIDGG 266


>gi|332977225|gb|EGK14020.1| type III effector HopAJ2 [Psychrobacter sp. 1501(2011)]
          Length = 469

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/283 (26%), Positives = 125/283 (44%), Gaps = 8/283 (2%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
            L   +   +   +  ++              +  +F +     +  +   G+S  T ++
Sbjct: 1   MLPTRIAAAITTAIGLSLAATSAQAAPEAPYLSNSQFQQCLDGLKNSSTFRGVSSSTFEN 60

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
            +   E   + IA              DYL  L   E +  GI  K+  +  L  ++  Y
Sbjct: 61  -YRPSEPDPSVIASLNYQPE-FQKDVWDYLSSLVDKERVEDGIRAKREMADTLRRIESRY 118

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GV    ++ +WG+E++FG+T+GK  L  +LATL+   RR  +F  ++  AL +V+ G I+
Sbjct: 119 GVKAEHVLGVWGVESNFGQTLGKKDLFQSLATLSCFDRRQSYFRGEYANALKIVQNGDIA 178

Query: 186 S-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           +    G+  G  GQ QF+P   +  A+D D DG+ DLV S  DA+AS A FLAK G+   
Sbjct: 179 ASDMKGSWAGAFGQTQFMPGTFLDLAVDFDGDGRRDLVNSKPDALASTANFLAKRGYRSG 238

Query: 245 AGYQPGEKNFAILKHWNASLNYNKTIAYIAAH----IDGVPIG 283
             +    K  A     N S    K+++Y         DG P+ 
Sbjct: 239 EPWGYEVKIPAGFWGSN-SRTDKKSMSYWRDKGFTLADGRPLP 280


>gi|257455301|ref|ZP_05620536.1| lytic murein transglycosylase [Enhydrobacter aerosaccus SK60]
 gi|257447263|gb|EEV22271.1| lytic murein transglycosylase [Enhydrobacter aerosaccus SK60]
          Length = 447

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 80/327 (24%), Positives = 137/327 (41%), Gaps = 57/327 (17%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           +   P++     +        + ++    F +WKS    RAV++G      + L +   Y
Sbjct: 54  LPTAPVVITVPPKVTPVPPVTVPTNQYSSFYQWKSDFIERAVQKGYPRADVERLLSSANY 113

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
            +  ++ D+           +Y+DG +SS  ++ G     + S LL  ++ +YGVP  I+
Sbjct: 114 SEQVVSLDKGQPE-FAKMPWEYIDGAASSGRVSGGQRNFASQSALLDRIENQYGVPASIV 172

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGA 191
            A+WG+E+ +G+  G + L+++LATLAYD RR  F  +Q    L L+++G I      G+
Sbjct: 173 TAIWGMESSYGQGTGNSSLVNSLATLAYDGRRRSFAEDQLLALLSLLERGDIDWSQLRGS 232

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG----- 246
             G +G  QF+P   +  A+D + DG  +   +  DA+AS A +L   GW +  G     
Sbjct: 233 WAGGMGHTQFIPKTWLDEAVDGNGDGHRNPWHT-ADALASTASYLKNAGWQRGMGSYYEV 291

Query: 247 ----------------------------------------YQPG---------EKNFAIL 257
                                                   + P           KNF  +
Sbjct: 292 RLPSGFDYRQVSTKKTMSDWQNLGVQFITPNAPMDAMAELWLPAGKEGPAILLTKNFDAI 351

Query: 258 KHWNASLNYNKTIAYIAAHIDGVPIGK 284
           K +N S NY   ++ +A  I G P  +
Sbjct: 352 KVYNNSSNYAMGVSLLAKAIIGQPGLQ 378


>gi|21110734|gb|AAM39126.1| transglycolase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 828

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 81/343 (23%), Positives = 131/343 (38%), Gaps = 81/343 (23%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+  +  L  +L +  P+ A A                   F    +  + +A  +G+  
Sbjct: 109 MTLSRGALPFVLGL-LPLAACADPA----------------FDRCLAGLQTQAAAKGVDA 151

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            + +   A L    + +               DYL  L  S+ +  G A+   +  LL  
Sbjct: 152 ASFQRFTAGLAPDSSVLPLLDAQPE-FTTPIWDYLASLVDSQRVTDGQAMLVTHRELLSR 210

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           L  + GV P  ++A+WG+E+ +G   GK PLL +LATL+   RR  FF  +F   L L++
Sbjct: 211 LSDQTGVDPATIVAVWGVESDYGRVTGKRPLLVSLATLSCAGRRQPFFRGEFLALLSLLQ 270

Query: 181 KGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G +S+    G+  G  GQ QF+P    + A+D D DG+ DLV S  DA+AS A +L K 
Sbjct: 271 QGDLSADGLTGSWAGAFGQTQFMPSTYARIAVDGDGDGRRDLVTSIPDALASTANYLVKA 330

Query: 240 G------W--------------------TKCAGYQPGE---------------------- 251
           G      W                         +Q                         
Sbjct: 331 GWERARPWGMEVTLPRGFDASKAGRTRRQPLQAWQSAGLLGTDGKPLAPTGLPAETPAAL 390

Query: 252 --------------KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                         +N+  +  +NA+ +Y  +IA +A  + G 
Sbjct: 391 LLPAGATGPAFLVFRNYDAIYAYNAAESYALSIALLADRLRGG 433


>gi|163757651|ref|ZP_02164740.1| putative transglycosylase transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162285153|gb|EDQ35435.1| putative transglycosylase transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 415

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/254 (22%), Positives = 110/254 (43%), Gaps = 14/254 (5%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWK-SAARARAVREGMSPKTAK 64
            +  ++  ++  ++A     P  A T+   +    +F  W  +     A  +G++ +   
Sbjct: 1   MIRTAVFAVLSLLVALCGVSPAWAATK---AQVESQFARWLEADLWPEARAKGVTKQVFD 57

Query: 65  HLFADLEYLDTTIARDRK---------MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANS 115
             F  ++                       +   S   Y        + A G +L + + 
Sbjct: 58  RAFNGVQLDWDLPDLAPPGFPKPKKRTQSQAEFRSPGAYFSEKRLQSLAASGRSLMQKHQ 117

Query: 116 RLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYA 175
            +L  ++ +YGVP  I++A+WG E+ FG        +  L T A+   R   F  +   A
Sbjct: 118 AVLRRIEDKYGVPASIIVAVWGRESGFGRAKIPHSAVGVLVTKAFMSTRPDLFRTEILAA 177

Query: 176 LDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L ++++G +S+     +  G +GQ QFLP + +K+A+D D DGK D+  S  D++AS   
Sbjct: 178 LQILQRGDVSASAMRSSWAGAMGQPQFLPSSYLKFAVDFDGDGKRDIWNSIPDSLASIGN 237

Query: 235 FLAKLGWTKCAGYQ 248
           +LA+ GW +   + 
Sbjct: 238 YLAQSGWVRGRDWG 251



 Score = 42.5 bits (98), Expect = 0.063,   Method: Composition-based stats.
 Identities = 8/28 (28%), Positives = 13/28 (46%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             NF ++K +N S  Y   I  +A  + 
Sbjct: 314 TPNFYVIKEYNNSDLYALFIGNLADRMA 341


>gi|163738213|ref|ZP_02145629.1| Lytic murein transglycosylase [Phaeobacter gallaeciensis BS107]
 gi|161388829|gb|EDQ13182.1| Lytic murein transglycosylase [Phaeobacter gallaeciensis BS107]
          Length = 390

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/331 (22%), Positives = 118/331 (35%), Gaps = 73/331 (22%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           +++L+  + P+ A               +     F  +    +  A+  G    T    F
Sbjct: 6   ILALVSFLLPLQA--------------HAQCGGGFRNFVQLMKEEALTGGYDSATVNRFF 51

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
            ++      +  DR         F ++   L S   + +G A+ +        ++  YG+
Sbjct: 52  ENVRQDPAVLKADRAQG-VFQKPFIEFSRRLISKSRLDRGQAMSRKYDATFRRIETTYGI 110

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
              +L+A W  ET +G   G    L+ L TLA+DCRR + F  Q F AL+L ++      
Sbjct: 111 DRSVLLAFWAFETDYGAVQGNFNTLNALVTLAHDCRRPELFRPQVFAALELFRQDNFDPR 170

Query: 188 AL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
              GA  GEIG  Q LP ++++  +DAD DG + L  S  DA+ S AK L+ LGW     
Sbjct: 171 RTTGAWAGEIGMVQMLPGDILENGVDADGDGHVSLKTSAPDALMSGAKMLSHLGWHPNEP 230

Query: 247 --------------------------YQP------------------------------- 249
                                     +Q                                
Sbjct: 231 WLQEVTIPADLDLSLSGVHHKKTVADWQALGISPRDGRLADRGTKAALILPQGHKGPAFL 290

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
              NF +   WN S  Y  T AY A  + G 
Sbjct: 291 AYPNFDVYFEWNQSFTYVLTAAYFATRLSGA 321


>gi|115522727|ref|YP_779638.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
 gi|115516674|gb|ABJ04658.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
          Length = 467

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 69/319 (21%), Positives = 120/319 (37%), Gaps = 61/319 (19%)

Query: 28  KATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSP 87
              T     + A  F    ++    A R G+S  + +   A L      +          
Sbjct: 83  PLMTAQAIREAAANFDACVASLWPEAARRGVSQDSFRRFTAGLAPDLRIMDLMDSQPE-F 141

Query: 88  PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
             +  DYLD L +   +A+G  +           ++ +GV   I+ ++WG+E+++   MG
Sbjct: 142 TKAIWDYLDILVNDNRLAKGREILATYKPQFDAAEQAFGVDRYIIASIWGIESNYSTQMG 201

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNV 206
              +L++ ATLA   RR K+F ++F  +L+++ +G +      G+  G  G  QF+P   
Sbjct: 202 DRSVLNSTATLACVGRRQKYFKDEFLVSLEILHRGDLRPEQLRGSWAGAFGPTQFMPTAF 261

Query: 207 VKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT------------------------ 242
            +YA+DAD DG+ D+V +  D I S A  L K GW                         
Sbjct: 262 KRYAVDADGDGRRDVVGNPADLIFSTANNLKKDGWQAGQSWGYEVAVPANFNYLLADRAR 321

Query: 243 ---------------KCAGY----------------QPG---EKNFAILKHWNASLNYNK 268
                              +                 PG    +NF ++  +N +  Y  
Sbjct: 322 AMTIAQWEEIGLRRPNGQPFPRPSDKAYLLAPAGAEGPGFLMLQNFRVIMKYNPAEAYAL 381

Query: 269 TIAYIAAHIDGV-PIGKGY 286
            I + A  + G  P  + +
Sbjct: 382 AIGHFADRLRGGQPFIQPW 400


>gi|89052862|ref|YP_508313.1| lytic murein transglycosylase [Jannaschia sp. CCS1]
 gi|88862411|gb|ABD53288.1| Lytic murein transglycosylase [Jannaschia sp. CCS1]
          Length = 390

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 81/331 (24%), Positives = 117/331 (35%), Gaps = 64/331 (19%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           +  + P+L            Q         F ++    RA A   G S +     F    
Sbjct: 1   MRFLAPLLLSLSIGTAAHAQQ-----CGGDFNQFVQGLRAEAAERGHSQEAIDGFFRHAS 55

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y    +  DR+      V F D+   L S   +  G       +     +++ +GV  GI
Sbjct: 56  YYQRALDADRRQG-IFTVPFTDFARRLISQGRMDNGRRNADRQAATFAEIERRFGVSQGI 114

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALG 190
           L+A W  ET +G   G    L +L TLA+DCRR + F  + F AL+L + G     +  G
Sbjct: 115 LLAFWAFETDYGAFQGDYNTLDSLVTLAHDCRRPELFRPEVFGALELYEMGDFDPVNTQG 174

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY--- 247
           A  GEIG  Q LP ++V + ID D DG + L  S  DA+ S A  L+ LGW     +   
Sbjct: 175 AWAGEIGMVQMLPEDIVAHGIDGDGDGHVYLQTSAPDALMSGANILSSLGWRPGEPWLVE 234

Query: 248 ---------------------------------------------QPGEKNFAILKHW-- 260
                                                         P  +N      +  
Sbjct: 235 ITVPQDLDWYQTGIHTTRSVADWQADGVAGRSGALPMPNAQASIVLPQGRNGPAFMAYQN 294

Query: 261 -------NASLNYNKTIAYIAAHIDGVPIGK 284
                  N S  Y  T AY A  ++G P+  
Sbjct: 295 FNVLFEWNQSFTYVLTAAYFATRLEGAPVFD 325


>gi|258542236|ref|YP_003187669.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633314|dbj|BAH99289.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636373|dbj|BAI02342.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639426|dbj|BAI05388.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642482|dbj|BAI08437.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645537|dbj|BAI11485.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648590|dbj|BAI14531.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651643|dbj|BAI17577.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654634|dbj|BAI20561.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-12]
          Length = 331

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 66/273 (24%), Positives = 113/273 (41%), Gaps = 3/273 (1%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
            L   LL+     L       +           +  +  + +  R  A+ +G+S      
Sbjct: 1   MLRRKLLVGGASALFATPVLARTTAATTPHPAASSSYATFLAGVRREAIGQGISASVVDQ 60

Query: 66  LFA-DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             A   +     +  DR       +++  Y D + + + I+ G+A     + LL  +   
Sbjct: 61  ALALTTQPNAKVLKADRHQPE-FTLTWAQYKDRVLTEKKISDGLAAVGQRAALLNRISST 119

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGV  G +  +WGLE+ +G  MG   ++  LATLAYD RR+ FF  +   AL ++ +G I
Sbjct: 120 YGVDKGAIAGIWGLESAYGTRMGTFHVIDALATLAYDGRRSAFFRSELMKALSILGQGDI 179

Query: 185 SSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +   + G+  G +GQ QF+P   ++YA    E G+ D+  +  D  AS A +LAK  W  
Sbjct: 180 TPAGMLGSYAGAMGQPQFMPSAYLRYAASYPEGGRRDIWHNEADVFASIANYLAKCHWLP 239

Query: 244 CAGYQPGEKNFAILKHWNASLNYNKTIAYIAAH 276
              +         +            I++ A  
Sbjct: 240 GQPWGEEVLLPDTITQAQIGRTAVHPISWWAQQ 272


>gi|260426102|ref|ZP_05780081.1| lytic murein transglycosylase [Citreicella sp. SE45]
 gi|260420594|gb|EEX13845.1| lytic murein transglycosylase [Citreicella sp. SE45]
          Length = 391

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 79/310 (25%), Positives = 115/310 (37%), Gaps = 59/310 (19%)

Query: 31  TQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
                +     F  + S  +  AV  G    T     + +      + RDR         
Sbjct: 16  AAAQEAACGGNFSAFVSGLKDEAVAMGHDAATVDAFLSGVRLDQRVMERDRGQG-IFQTP 74

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
           F D+   L S + + +G  L +    +   ++ +YG+  G+L+A W  ET +G   G   
Sbjct: 75  FIDFSRKLISQDRLDRGRGLAERWDEVFTRIESDYGIARGVLLAFWAFETDYGTFQGDFN 134

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKY 209
            L+ L TLA+DCRR + F  Q F AL+L ++G        GA  GEIGQ Q LP ++++ 
Sbjct: 135 TLNALVTLAHDCRRPEIFRPQIFAALELYERGDFDPSRTTGAWAGEIGQVQMLPKDILEN 194

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY---------------------- 247
            +D D DG + L  S  DA+ S AK LA LGW     +                      
Sbjct: 195 GMDGDGDGHVLLKTSAPDALVSGAKMLASLGWRYGEPWLQEVVLPATLDWSLTGLETTMT 254

Query: 248 -----------------------------QPGEKNFAI------LKHWNASLNYNKTIAY 272
                                          G   F           WN S  Y  T AY
Sbjct: 255 VAEWERLGVAAREGALDDGRLEASILLPQGRGGPAFMAYPNFRVYFEWNQSFVYVTTAAY 314

Query: 273 IAAHIDGVPI 282
            A  ++G P+
Sbjct: 315 FATRLEGAPV 324


>gi|170738408|ref|YP_001767063.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
 gi|168192682|gb|ACA14629.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
          Length = 398

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 76/293 (25%), Positives = 122/293 (41%), Gaps = 22/293 (7%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ +  L  + L+ +          P  A            F    +     A   G+SP
Sbjct: 1   MTLRLRLTAATLLCL-----GGFALPGAA---------RADFRSCLAGLGQEAGGRGISP 46

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
              +   A + Y D  I   +           DY+  L   E +  G A  + ++  L  
Sbjct: 47  AAFQAATAGIVYDDKVIELSQAQPE-FKTPIWDYMAALVDDERVEDGRAAMRQHAAALAE 105

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFFTEQFFYALDLV 179
            +  + V    + A+WG+E++FG+ +GK PL+ +LATLA    RRA +F  +    L ++
Sbjct: 106 AEARFHVDRYTIAAVWGVESNFGKNLGKMPLIQSLATLACSPNRRAGYFRGELMATLKII 165

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
            +G I+     G+  G  GQ QF+P    + A+D D DG+ D+V S  DA+ S A FL  
Sbjct: 166 DRGDIAPDRLTGSWAGAFGQTQFMPSTYQRLAVDLDGDGRRDVVDSVADAVGSTANFLRA 225

Query: 239 LGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA----AHIDGVPI-GKGY 286
             W     +    +         A     + IA+ A    A +DG P+ G+G 
Sbjct: 226 AKWQNGLPWGYEVRLPRGFSVAAAGRKNKRPIAHWASLGVARVDGRPLSGEGP 278



 Score = 42.2 bits (97), Expect = 0.086,   Method: Composition-based stats.
 Identities = 8/30 (26%), Positives = 16/30 (53%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            +NF  +  +NA+ +Y   IA ++  + G 
Sbjct: 295 TRNFDAIYSYNAAESYGLAIAVLSDRLRGR 324


>gi|114765851|ref|ZP_01444944.1| hypothetical protein 1100011001323_R2601_11144 [Pelagibaca
           bermudensis HTCC2601]
 gi|114541850|gb|EAU44887.1| hypothetical protein R2601_11144 [Roseovarius sp. HTCC2601]
          Length = 391

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/323 (23%), Positives = 122/323 (37%), Gaps = 59/323 (18%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
            L+  +                  F  +K+  R  AV  G   + A+   +      + +
Sbjct: 3   ALSCLIALSLSGAAFAQEVPCGGDFQTFKAGLRDEAVAMGHDAEVARRFLSGARQDSSVL 62

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
            RDR         F ++   L S + + +G  L +    +   ++++YG+  G+L+A W 
Sbjct: 63  RRDRAQG-IFQTPFIEFSRKLISQDRLDRGRQLSQRWDEVFDRIERDYGISRGVLLAFWA 121

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEI 196
            ET +G   G    L+ L TLA+DCRR + F  Q F A++L ++G        GA  GEI
Sbjct: 122 FETDYGAFQGDFNTLNALVTLAHDCRRPEIFRPQIFAAMELYERGDFDPATTTGAWAGEI 181

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY--------- 247
           G  Q LP ++++  +D D DG + L  S  DA+ S AK L++LGW     +         
Sbjct: 182 GMVQMLPRDILENGMDGDGDGHVTLKTSAPDALLSGAKMLSELGWRHGEPWLQEVVLPAD 241

Query: 248 ------------------------------------------QPGEKNFAI------LKH 259
                                                       G  +F           
Sbjct: 242 MDWSQTGLETTMSVAEWERLGVRAREGALDDGRLEASILLPQGRGGPSFIAYPNFRVYFE 301

Query: 260 WNASLNYNKTIAYIAAHIDGVPI 282
           WN S  Y  T AY A+ ++G  +
Sbjct: 302 WNQSFTYVMTAAYFASRLEGASV 324


>gi|15602378|ref|NP_245450.1| hypothetical protein PM0513 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720773|gb|AAK02597.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 364

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 72/273 (26%), Positives = 128/273 (46%), Gaps = 17/273 (6%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATT---QFICSDTADRFGEWKSAARARAVREG 57
           MS K +  +S L++   ++  A   P        QF  +   + F ++    + +A  EG
Sbjct: 1   MSIKLWFRVSGLLLSLILVGCANKPPITPLATGSQFSKARQVENFSDYVIFLKRKARAEG 60

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMV------------TSPPVSFKDYLDGLSSSEIIA 105
           +S +T      D++Y+   I  DR+               S P     YL+ + +   + 
Sbjct: 61  VSEQTLNDH-NDIQYISRAIELDRQQAGRVQKRDPNAPVRSNPHGTTHYLNRVLTQRKVD 119

Query: 106 QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRA 165
              +        L    + +GV    LM+LWG+E+ FG   G+  +LS LATLA++ RR 
Sbjct: 120 VATSRYWEQQAQLEKASQRFGVQKEYLMSLWGMESSFGHYQGQYDVLSVLATLAFEGRRE 179

Query: 166 KFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
             F+ +F  A+ ++++  I    + G+  G +GQ QF+P + ++YA D + DG+ D+ K+
Sbjct: 180 SLFSREFVSAMKMLERRDIPRQKMLGSWAGAMGQTQFMPSSYLRYAADGNHDGEKDIWKN 239

Query: 225 NIDAIASAAKFLAKLGWTKCAGYQPGEKNFAIL 257
           + D  AS A +L+ +GW K   +    +    L
Sbjct: 240 HDDVFASIASYLSTVGWDKQLPWGVEVQLTKPL 272


>gi|27379491|ref|NP_771020.1| transglycolase [Bradyrhizobium japonicum USDA 110]
 gi|27352643|dbj|BAC49645.1| bll4380 [Bradyrhizobium japonicum USDA 110]
          Length = 409

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 77/327 (23%), Positives = 127/327 (38%), Gaps = 64/327 (19%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L+     +A  V  P  A            F EW+ + RARA+ +G+S  T +   A +E
Sbjct: 15  LLKSALGVAAIVASPTCALAAPP------GFDEWRESFRARAMAKGISAATWQRAMARVE 68

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
              +   + R            Y++   S   I  G    K N  LL  +++++GV  G 
Sbjct: 69  PDMSVFKQMRNQPE-FHEQVWQYINRRVSDWRIINGKIALKNNEALLARIERDFGVERGT 127

Query: 132 LMALWGLETHFGETMGKT----PLLSTLATLAYD-CRRAKFFTEQFFYALDLVKKGVISS 186
           L+ALWG+E+ +G+ + +     P+  +LA LA++  RR  ++  +   AL +V KG  + 
Sbjct: 128 LLALWGVESAYGDPLVQQNHMTPVFPSLAALAWNEPRRKAYWETELINALRIVDKGWSTP 187

Query: 187 HAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG-WTKC 244
             + G+  G +G  Q++P   +   ID D DGK+       DA+ S AK+L   G W + 
Sbjct: 188 EEMKGSWAGAMGHSQWMPEVWLNVGIDYDGDGKVSPFGKPDDALGSTAKYLVNRGKWRRG 247

Query: 245 AGYQPG--------------------------------------------------EKNF 254
             +                                                       NF
Sbjct: 248 EHWGYEVRASGDVSGSRTYAAWASAGVTRADGQPFPQPNASAQMWTPVAGGPTFLLGPNF 307

Query: 255 AILKHWNASLNYNKTIAYIAAHIDGVP 281
             +K +N S+NY   I ++     G P
Sbjct: 308 YSVKSYNPSMNYALAICHLGDRCLGAP 334


>gi|77748773|ref|NP_644590.2| epimerase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 720

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 81/343 (23%), Positives = 131/343 (38%), Gaps = 81/343 (23%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+  +  L  +L +  P+ A A                   F    +  + +A  +G+  
Sbjct: 1   MTLSRGALPFVLGL-LPLAACADPA----------------FDRCLAGLQTQAAAKGVDA 43

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            + +   A L    + +               DYL  L  S+ +  G A+   +  LL  
Sbjct: 44  ASFQRFTAGLAPDSSVLPLLDAQPE-FTTPIWDYLASLVDSQRVTDGQAMLVTHRELLSR 102

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           L  + GV P  ++A+WG+E+ +G   GK PLL +LATL+   RR  FF  +F   L L++
Sbjct: 103 LSDQTGVDPATIVAVWGVESDYGRVTGKRPLLVSLATLSCAGRRQPFFRGEFLALLSLLQ 162

Query: 181 KGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G +S+    G+  G  GQ QF+P    + A+D D DG+ DLV S  DA+AS A +L K 
Sbjct: 163 QGDLSADGLTGSWAGAFGQTQFMPSTYARIAVDGDGDGRRDLVTSIPDALASTANYLVKA 222

Query: 240 G------W--------------------TKCAGYQPGE---------------------- 251
           G      W                         +Q                         
Sbjct: 223 GWERARPWGMEVTLPRGFDASKAGRTRRQPLQAWQSAGLLGTDGKPLAPTGLPAETPAAL 282

Query: 252 --------------KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
                         +N+  +  +NA+ +Y  +IA +A  + G 
Sbjct: 283 LLPAGATGPAFLVFRNYDAIYAYNAAESYALSIALLADRLRGG 325


>gi|319788601|ref|YP_004148076.1| lytic murein transglycosylase [Pseudoxanthomonas suwonensis 11-1]
 gi|317467113|gb|ADV28845.1| lytic murein transglycosylase [Pseudoxanthomonas suwonensis 11-1]
          Length = 402

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/321 (23%), Positives = 119/321 (37%), Gaps = 61/321 (19%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSA-ARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
            +           + +     F    +   R +AV  G+         A++    + +  
Sbjct: 3   ASFCLAALLLWPALDAHADAAFETCVNERLRPQAVARGIPAAAFDGYMAEVVPDRSVLDL 62

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
                        DYL GL   E +A G+A+ + +  LL  +   +GV P  ++A+WG+E
Sbjct: 63  LDHQPE-FTTPIWDYLSGLVDDERVADGLAMLETHRELLAAVSARHGVDPATVVAVWGVE 121

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQ 198
           + +G   GK PLL +L+TL+   RR  FF  +F  AL L+  G +      G+  G  G 
Sbjct: 122 SDYGRVSGKRPLLQSLSTLSCFGRRQDFFRGEFLAALQLLHAGDLRDPGITGSWAGAFGH 181

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ---------- 248
            QF+P    + A+D D DG+ DLV S  DA+AS A +L + GW     +           
Sbjct: 182 TQFMPSTYARIAVDGDGDGRRDLVGSIPDALASTAHYLQRAGWQTGRHWGHEVQLPPGFD 241

Query: 249 ---PGEKNFAILKHW--------------------------------------------- 260
               G      L+ W                                             
Sbjct: 242 ASLAGRTKRRPLQEWLALGVRRIDGGELGPADARAAILLPAGRTGPAFLVFRNYDAIYAY 301

Query: 261 NASLNYNKTIAYIAAHIDGVP 281
           NA+ +Y   IA +A  + G P
Sbjct: 302 NAAESYALAIATLADRLRGGP 322


>gi|170746489|ref|YP_001752749.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
 gi|170653011|gb|ACB22066.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
          Length = 396

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/309 (24%), Positives = 122/309 (39%), Gaps = 54/309 (17%)

Query: 25  QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
               A+     +   D F  +  A R  A   G++  T    F  +   D  I    +  
Sbjct: 8   LAAAASLATGEARAEDAFRAFIEALRPDAAARGVTAATFDAAFRGITGPDAGILARTRRQ 67

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
           +       +YL G  S+  IA+G A   A +  L  ++  YGVP  + MA WG+E+ FG 
Sbjct: 68  SEFVRPVWEYLVGAVSAGRIARGRARAAALASTLTAIEGRYGVPGRMAMAFWGVESDFGA 127

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLP 203
           + G  P +  LATLA    R   F ++   AL ++++G I+   + G+  G +GQ QFLP
Sbjct: 128 SAGSVPTVRALATLAEARHRGGLFRDELLAALTILQRGDIAPDRMSGSWAGAMGQVQFLP 187

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK-------------------- 243
              + +A+D D DG+ D+  S  D++AS A +L  LGW                      
Sbjct: 188 STYLAHAVDFDGDGRRDIWTSEPDSLASIAAYLKDLGWNPALSWGYEVLLPKDFDLNRYA 247

Query: 244 ---------------------------------CAGYQPGEKNFAILKHWNASLNYNKTI 270
                                             A       NF +++ +N S +Y   +
Sbjct: 248 GDLGSFAERGVRRTDGKPLPGTGRASLFLPGGLGAPVFLITDNFEVIRGYNTSDSYALAV 307

Query: 271 AYIAAHIDG 279
            ++A  + G
Sbjct: 308 GHLADRLAG 316


>gi|39937456|ref|NP_949732.1| lytic murein transglycosylase [Rhodopseudomonas palustris CGA009]
 gi|39651315|emb|CAE29837.1| possible transglycolase [Rhodopseudomonas palustris CGA009]
          Length = 452

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 85/320 (26%), Positives = 126/320 (39%), Gaps = 62/320 (19%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
             ++ P  A     C      F ++ +  + +AV  G+S          L Y    + RD
Sbjct: 31  TLLSSPAFAQRGASCH-GGQSFPQFLAGLKQKAVAAGVSQGAIAEASPYLVYDQGIVNRD 89

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R         F  +   ++S     +G  L K  +      +KEYGVPP ++ A W LE+
Sbjct: 90  RGQR-VFGQIFTVFAGRMASEGRRVKGQQLIKQYANAFARAEKEYGVPPAVITAFWALES 148

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQF 199
            FG   G  P L +L +LAYDCRR++ F ++   AL ++ +G ++    +G+  GE+GQ 
Sbjct: 149 DFGAVQGNLPTLRSLVSLAYDCRRSEMFQDETIAALKIIDRGDLTPGEMIGSWAGELGQT 208

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLA-KLGWTKC------------AG 246
           QFLP +   YA+D D DG  DL+ S  D I S A ++A  L W +               
Sbjct: 209 QFLPRHYFDYAVDYDGDGHRDLLHSAPDVIGSTANYIATGLKWRRGEPWLQEVRVPENLP 268

Query: 247 YQPG----------------------------------------------EKNFAILKHW 260
           +                                                   NFA    W
Sbjct: 269 WDQADLTVKHPRSQWAQWGVTTADGRPLSNDALPASLLLPMGRHGPAFLAYANFAAYTEW 328

Query: 261 NASLNYNKTIAYIAAHIDGV 280
           N SL Y+ T AY+A  I G 
Sbjct: 329 NNSLIYSTTAAYLATRIAGA 348


>gi|209884080|ref|YP_002287937.1| lytic murein transglycosylase [Oligotropha carboxidovorans OM5]
 gi|209872276|gb|ACI92072.1| lytic murein transglycosylase [Oligotropha carboxidovorans OM5]
          Length = 452

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 72/323 (22%), Positives = 123/323 (38%), Gaps = 61/323 (18%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
                  T      +A  F    ++    A R G+S      L A+LE     +      
Sbjct: 64  ASGSPEMTADAIRRSAANFRSCVASMAPEAARRGVSRANFDRLTANLEPDLKIMDFMDSQ 123

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
                 S  DYLD L +   +A+G  +          +++ YGV   I+ ++WG+E+++ 
Sbjct: 124 PE-FTKSVWDYLDVLVNDTRLAKGREVLAKYKPQFDAVERAYGVDRYIIASIWGIESNYS 182

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFL 202
              G   +L++ ATLA   RR K+F  +F  A++++ +G ++   + G+  G  G  QF+
Sbjct: 183 TRGGDRSVLNSTATLACIGRRQKYFRGEFLAAVEILNRGDLTPDEMVGSWAGAFGPTQFM 242

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL------GWT------KCAGY--- 247
           P    ++A+D D DG+ D V S  D IAS A  L         GW       +   Y   
Sbjct: 243 PTVYKRFAVDFDGDGRRDAVGSVPDLIASTANKLKTDGWQAGQGWGYEVSVPRGFDYLLA 302

Query: 248 -------------------------QPGE------------------KNFAILKHWNASL 264
                                    +PG+                  +NF  +  +N + 
Sbjct: 303 DRSKAMTLAQWARLGVSRANGQAFPRPGDHAFLLMPAGADGPGFLMLQNFRAILRYNPAE 362

Query: 265 NYNKTIAYIAAHID-GVPIGKGY 286
           +Y   I + A  +  G P  + +
Sbjct: 363 SYALAIGHFADRLRGGGPFVQAW 385


>gi|126726117|ref|ZP_01741959.1| hypothetical protein RB2150_07913 [Rhodobacterales bacterium
           HTCC2150]
 gi|126705321|gb|EBA04412.1| hypothetical protein RB2150_07913 [Rhodobacterales bacterium
           HTCC2150]
          Length = 381

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 84/319 (26%), Positives = 117/319 (36%), Gaps = 62/319 (19%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
              P  A +          F  W    +  AV  G S  T     A       T+  DR 
Sbjct: 3   SASPVLAASAP----CGGNFNSWLKGVKKEAVANGHSKGTVDKFLASARQDSRTLKADRA 58

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                 + F D+   + S   I  G       + +    +++YGVP G+L+A W LET F
Sbjct: 59  QG-VFKLGFVDFSRRVISQHRINNGRKNGSKYASVFARTERDYGVPAGVLLAFWALETDF 117

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQF 201
           G   G    L++L TL++DCRR + F  Q F AL+L ++G  S     GA  GEIG  Q 
Sbjct: 118 GAVQGDFNTLTSLLTLSHDCRRPELFRPQIFAALELYERGDFSPSKTTGAWAGEIGMVQM 177

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY-------------- 247
           LP +++   +D D DG++ L  S  DA+ S AK L  LGW K   +              
Sbjct: 178 LPEDILHNGVDGDGDGQVKLKTSAPDALLSGAKMLKGLGWRKGEPWLQEVTVPSNLDWSN 237

Query: 248 ---------------------------------QPGEKNFAILKHW---------NASLN 265
                                             P  +N      +         N S  
Sbjct: 238 TGLTTKMLGRDWAKQGVKSRHGKISTKLPASLILPQGRNGPAFLAYPNFDVYFEWNQSFV 297

Query: 266 YNKTIAYIAAHIDGVPIGK 284
           Y  T AY A  + G P+  
Sbjct: 298 YVTTAAYFATRLSGAPVFD 316


>gi|86355782|ref|YP_467674.1| transglycosylase protein [Rhizobium etli CFN 42]
 gi|86279884|gb|ABC88947.1| probable transglycosylase protein [Rhizobium etli CFN 42]
          Length = 412

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 67/286 (23%), Positives = 113/286 (39%), Gaps = 15/286 (5%)

Query: 15  VYPMLAQAVTQPKKATTQFICSDTADRFGEWKS-AARARAVREGMSPKTAKHLFADLE-- 71
           ++ +   A   P  +      +D   +F  W        A   G+S +T K  F+ +   
Sbjct: 4   IFALAITAALLPLPSYAAPSKADVEAQFESWVQKDLWPEAKAGGVSERTFKAAFSGITLN 63

Query: 72  -------YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
                         +++K   +   S   Y +     ++ A G       S  L  ++K 
Sbjct: 64  WNLPDLAPPGFPPPKEQKQTQAEFSSPGPYFNEDRLKKLAATGRGFAAQYSSTLKRIEKT 123

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGVP  I++A+WG ET FG        +  LAT A+   R + F  +   AL ++  G +
Sbjct: 124 YGVPGSIVLAIWGRETGFGAAKIPESAIEVLATKAFMSTRKEMFRTELVAALHILDGGDV 183

Query: 185 SS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +      +  G +GQ QF+P + +KYA+D D DG  ++  S  D +AS A +L K GW +
Sbjct: 184 TPADFRSSWAGALGQPQFMPTSYLKYAVDFDGDGHRNIWASVPDTLASIANYLVKKGWQR 243

Query: 244 CAGYQPGEKNFAILKHWNASLNYNKTIAYIA----AHIDGVPIGKG 285
              +         +       +  K ++  A      I G     G
Sbjct: 244 DRDWGFEVSIPQAVSCAQEGPDLAKPLSQWASLGIERISGKTFPSG 289



 Score = 44.9 bits (104), Expect = 0.014,   Method: Composition-based stats.
 Identities = 9/28 (32%), Positives = 13/28 (46%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             NF ++K +N S  Y   I  +A  I 
Sbjct: 311 TPNFYVIKEYNNSDLYALYIGNLADRIA 338


>gi|326387761|ref|ZP_08209367.1| lytic murein transglycosylase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207807|gb|EGD58618.1| lytic murein transglycosylase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 351

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 68/249 (27%), Positives = 114/249 (45%), Gaps = 4/249 (1%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
            + +  + L+M     +  A             +  A  F  +     ARA  EG+  +T
Sbjct: 2   MRLFRSLGLVMAAACAVTPAFADTVGGVVAPADA-GASGFPAFLQLLAARARGEGVREQT 60

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVS---FKDYLDGLSSSEIIAQGIALKKANSRLLI 119
            + + + + +    +  DR     PP S   F+ Y      +  I +G A+  +   L  
Sbjct: 61  IRDVISGMTFDPDVVRHDRSQPGGPPSSIPRFEPYRRTHVDAGRIDRGRAMLASVGPLAT 120

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            ++  YGVP  +++A+WG ET++G   G   L  ++A+LAY+ RR + F+ +F   L ++
Sbjct: 121 TVETRYGVPASVVLAIWGHETNYGRFTGTYDLPRSIASLAYEGRRRELFSAEFVALLKMI 180

Query: 180 KKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            +GV  S  LG+  G  G  QFLP   ++ A DAD DG  D+  S  D +AS A +    
Sbjct: 181 DRGVPRSRLLGSWAGAFGNPQFLPSVYLRVAQDADGDGIADIWTSRPDTLASIANYFRDA 240

Query: 240 GWTKCAGYQ 248
           GW +   + 
Sbjct: 241 GWRRGEPWG 249


>gi|190889791|ref|YP_001976333.1| transglycosylase [Rhizobium etli CIAT 652]
 gi|190695070|gb|ACE89155.1| probable transglycosylase protein [Rhizobium etli CIAT 652]
          Length = 423

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 73/298 (24%), Positives = 121/298 (40%), Gaps = 22/298 (7%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKS-AARARAVREGMSPK 61
            ++   I+L +MV  +       P  A      +D   +F  W        A   G+S K
Sbjct: 10  LRRLWTIALAVMVALL-------PLSARATPSKADVEAQFESWVQKDLWPEAKANGISEK 62

Query: 62  TAKHLFADLE---------YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           + K  F+ +                 +++K   +   S   Y +    + + A G     
Sbjct: 63  SFKAAFSGVTLNWSLTDLAPPGFPPPKEQKQTQAEFSSPGPYFNEDRLTRLAATGRGFAA 122

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQF 172
             S  L  ++K YGVP  I++A+WG ET FG        +  LAT A+   R + F  + 
Sbjct: 123 QYSATLKRIEKTYGVPGSIVLAIWGRETGFGAAKIPNSAVEVLATKAFMSTRKEMFRTEL 182

Query: 173 FYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIAS 231
             AL ++  G ++     G++ G +GQ QF+P + +KYA+D D DG  ++  S  D +AS
Sbjct: 183 MAALHIIDGGDVAPADFKGSSAGALGQPQFMPTSYLKYAVDFDGDGHRNIWTSVPDTLAS 242

Query: 232 AAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA----AHIDGVPIGKG 285
            A FL K GW +   +         +       +  K +++ A      I G     G
Sbjct: 243 IANFLVKKGWQRDRDWGFEVSIPEAVSCAQEGPDLAKPLSHWASLGIDRISGKGFPSG 300



 Score = 43.7 bits (101), Expect = 0.033,   Method: Composition-based stats.
 Identities = 10/28 (35%), Positives = 13/28 (46%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             NF I+K +N S  Y   I  +A  I 
Sbjct: 322 TPNFYIIKEYNNSDLYALYIGNLADRIA 349


>gi|168036664|ref|XP_001770826.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162677885|gb|EDQ64350.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 530

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 61/244 (25%), Positives = 111/244 (45%), Gaps = 12/244 (4%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           + +   A           +    +   +F EW    R+ A  +G+S +       ++E  
Sbjct: 184 LCFASTALTANDGLTKLQEKAIDEAMQKFKEWVKDVRSDAQSQGVSEEVLDWALENIELS 243

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             ++     M     ++  DYL  +   + +  G  L K N  LL  + +++GVP   L+
Sbjct: 244 KESLVHTESMPEV-KLTLDDYLKRMVDEKRVKIGAELMKENVELLTEVSQKFGVPTQFLV 302

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCR---RAKFFTEQFFYALDLVKKGVISS---- 186
           A+WG+ET++G  MG   ++ +LAT+++  +   R+ +F  +   AL +++KG        
Sbjct: 303 AIWGIETNYGSYMGNWDIIQSLATMSFTEKPASRSNYFRGELIEALLMLQKGTADRGRGP 362

Query: 187 ----HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
                  G+  G +GQ QF+P +   YA+D D DG  D+ +S  D  AS A +  + GW 
Sbjct: 363 EGKTRLRGSWAGAMGQCQFMPTSFRDYALDYDGDGHKDIWESKADVFASIANYFKEHGWK 422

Query: 243 KCAG 246
           +   
Sbjct: 423 EGGP 426


>gi|239832326|ref|ZP_04680655.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
 gi|239824593|gb|EEQ96161.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
          Length = 411

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 79/348 (22%), Positives = 125/348 (35%), Gaps = 71/348 (20%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKA------------TTQFICSDTADRFGEWKSAARARA 53
             L + ++    + + A++  + A                   +    FG+W       A
Sbjct: 1   MKLFASVIAAALLASTAMSNAQAAASPAPAAAPAENAVNLPKPECEIDFGQWMDNLTKEA 60

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
              G+  K               + RDRK  T   ++F ++   L S   + +G      
Sbjct: 61  RDAGVGEKGIAE-LHKAMLEQKVLDRDRKQ-TVFNLTFTEFSKRLISEARLKKGRDNLVK 118

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
            + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q  
Sbjct: 119 YADVFKKVEDTYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLI 178

Query: 174 YALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAA 233
             L L  +GV+ +   GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A 
Sbjct: 179 ALLKLFDQGVVDAATTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAG 238

Query: 234 KFLAKLGWTKCAGYQPG------EKNFAILK----------------------------- 258
           + +++LGW +   +               ++                             
Sbjct: 239 RMISELGWKRGQPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEHGVTGLNGPLGPDDGDAS 298

Query: 259 ----------------------HWNASLNYNKTIAYIAAHIDGVPIGK 284
                                  WN S+ Y  T AY A  + G P   
Sbjct: 299 LLLPLGRKGPAFLSYPNFDVFVEWNKSIVYATTAAYFATRLAGAPAFD 346


>gi|157644751|gb|ABV59081.1| type III effector HopAJ1 [Pseudomonas syringae pv. averrhoi]
          Length = 413

 Score =  179 bits (454), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 77/332 (23%), Positives = 127/332 (38%), Gaps = 67/332 (20%)

Query: 14  MVYPMLAQAVTQPKKATTQFICS-----DTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +V  MLA A   P    T           +   F +W +  R+ A  +G+   T    F 
Sbjct: 10  LVVIMLACASAAPACFATDMTPGVQNESTSEADFQQWLATFRSNATTKGIDTATLDLAFQ 69

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
           ++    T    D         +  DYL    + +   QG  L +    +L  +++ YGV 
Sbjct: 70  NITLDPTVHQLDTAQPE-FTTAIWDYLSERLTPKNTQQGQELLQ-KEPVLNEVERHYGVN 127

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSH 187
             I+ A+W +E+ +G+ +G    + +LATLAY  RR  +   Q   AL +++   I  + 
Sbjct: 128 AKIIAAIWCIESGYGKDIGSRDAIRSLATLAYKGRRMNYGATQLMAALHILQNKDIARAQ 187

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL------AKLGW 241
            +G+  G +GQ QF+P   + YA+D + D + D+  S  D +AS A +L      +++ W
Sbjct: 188 LIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRDVWSSRADTLASTASYLKRSAWNSRISW 247

Query: 242 --------------------TKCAGYQ-----------PGE------------------- 251
                                  A +Q           PGE                   
Sbjct: 248 GQEVQLPENFDYAQADMSIKKPVAEWQRLGVMGTTHAIPGELAQEQASVLLPAGYRGPAF 307

Query: 252 ---KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
               NF  +  +N S+ Y  TI  +A    G 
Sbjct: 308 MVLSNFRSILRYNNSIAYALTIRLLADSYAGG 339


>gi|330891787|gb|EGH24448.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. mori str.
           301020]
          Length = 413

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 74/332 (22%), Positives = 123/332 (37%), Gaps = 67/332 (20%)

Query: 14  MVYPMLAQAVTQPKKATTQFICS-----DTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +V  MLA A   P    T           +   F +W +  R+ A  +G+   T    F 
Sbjct: 10  LVVIMLACASAAPACFATDMTPGVQNESTSEADFQQWLATFRSNATTKGIDTATLDLAFQ 69

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
           ++    T    D         +  DYL    + +   QG  L +    +L  +++ YGV 
Sbjct: 70  NITLDPTVHQLDTAQPE-FTTAIWDYLSERLTPKNTQQGQELLQ-KEPVLNEVERHYGVN 127

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSH 187
             I+ A+W +E+ +G+ +G   ++ +LATLAY  RR  +   Q   AL +++   I  + 
Sbjct: 128 AKIIAAIWCIESGYGKDIGSRDVIRSLATLAYKGRRMNYGATQLMAALHILQNKDIARAQ 187

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
            +G+  G +GQ QF+P   + YA+D + D + D+  S  DA+AS A +L +  W     +
Sbjct: 188 LIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRDVWSSRADALASTASYLKRSAWNSRISW 247

Query: 248 QPGEK---NF----------AILKHW---------------------------------- 260
               +   NF            +  W                                  
Sbjct: 248 GQEVQLPENFDYAQADMSIKKPVAEWQRLGVMGTTHAIPGELAQEQASVLLPAGYRGPAF 307

Query: 261 ------------NASLNYNKTIAYIAAHIDGV 280
                       N S+ Y  TI  +A    G 
Sbjct: 308 MVLSNFRSILRYNNSIAYALTIGLLADSYAGG 339


>gi|316935913|ref|YP_004110895.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
 gi|315603627|gb|ADU46162.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
          Length = 460

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 85/329 (25%), Positives = 128/329 (38%), Gaps = 62/329 (18%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
            M+  +   A   P  A     C      F ++ +  + +AV  G+S          L Y
Sbjct: 33  AMLVTIAISAFASPALAQRGASCH-GGQSFPQFLAGLKQKAVAAGVSQGAIAQASPYLVY 91

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
               + RDR         F  +   ++S     +G  L K  +      +KEYGVPP ++
Sbjct: 92  DQGIVNRDRGQR-VFGQIFTVFAGRMASEGRRVKGQQLIKQYANAFARAEKEYGVPPAVI 150

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGA 191
            A W LE+ FG   G    L +L +LAYDCRR++ F ++   AL ++ +G ++    +G+
Sbjct: 151 AAFWALESDFGAVQGNLSTLRSLVSLAYDCRRSEMFQDETIAALKIIDRGDLTPAEMIGS 210

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLA-KLGWTKCAGYQPG 250
             GE+GQ QFLP +   YA+D D DG  D+++S  D I S A ++A  L W +   +   
Sbjct: 211 WAGELGQTQFLPQHYYDYAVDYDGDGHRDMLRSAPDVIGSTAHYIATGLKWRRGEPWLQE 270

Query: 251 -----------------------------EKNFAILK----------------------- 258
                                          N   L+                       
Sbjct: 271 VQAPDNLPWDQADLTVKHPRSQWAQWGVTYPNGRPLQSDALPASLLLPMGRHGPAFLAYA 330

Query: 259 ------HWNASLNYNKTIAYIAAHIDGVP 281
                  WN SL Y  T AY+A  I G P
Sbjct: 331 NFDAYTEWNNSLIYATTAAYLATRIAGAP 359


>gi|302858020|ref|XP_002959999.1| hypothetical protein VOLCADRAFT_101511 [Volvox carteri f.
           nagariensis]
 gi|300253615|gb|EFJ38936.1| hypothetical protein VOLCADRAFT_101511 [Volvox carteri f.
           nagariensis]
          Length = 263

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 69/258 (26%), Positives = 108/258 (41%), Gaps = 13/258 (5%)

Query: 40  DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLS 99
             F    S  R++A  +G+S +        +      +   +           DYL  L 
Sbjct: 1   ADFNACLSGLRSQAAAKGISSQAFDAATRGIAPDFKILELMQSQPE-FKTEIWDYLAALV 59

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL- 158
             + +  G A  +   R L N +  +GV   ++  +WG+E+ FG   G  PL+ +L+TL 
Sbjct: 60  DEQRVEDGRAAMRQWGRALANAEARFGVDRHVIAGVWGVESDFGRNFGDRPLVQSLSTLA 119

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
            Y  RR ++FT +    L +V+ G I      G+  G  G  QF+P    + A+D D D 
Sbjct: 120 CYAPRRREYFTGELMATLKIVQDGDIDPASLRGSWAGAFGHTQFMPSTFQRLAVDGDGDS 179

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK---NFAILKHWNASLNYNKTIAYIA 274
           + D+V S  DA+AS A FL K GW     +    +   NF             + ++  A
Sbjct: 180 RRDVVNSVPDAVASTANFLRKAGWDNSLPWGYEVRLPENFNAKLA---GRKAKRPLSSWA 236

Query: 275 A----HIDGVPIGKGYDT 288
           A     IDG P+   Y  
Sbjct: 237 AMGVTRIDGRPLSGNYQA 254


>gi|329113405|ref|ZP_08242186.1| Membrane-bound lytic murein transglycosylase B [Acetobacter pomorum
           DM001]
 gi|326697230|gb|EGE48890.1| Membrane-bound lytic murein transglycosylase B [Acetobacter pomorum
           DM001]
          Length = 331

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 66/273 (24%), Positives = 113/273 (41%), Gaps = 3/273 (1%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
            L   LL+     L       +           +  +  + +  R  A+ +G+S      
Sbjct: 1   MLRRKLLVGGASALFATPVLARTTAATTPHPAASSSYATFLAGVRREAIGQGISASVVDQ 60

Query: 66  LFA-DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             A   +     +  DR       +++  Y D + + + I+ G+A     + LL  +   
Sbjct: 61  ALALTTQPNAKVLKADRHQPE-FTLTWAQYKDRILTEKKISDGLAAVGQRTALLNRISST 119

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGV  G +  +WGLE+ +G  MG   ++  LATLAYD RR+ FF  +   AL ++ +G I
Sbjct: 120 YGVNKGAIAGIWGLESAYGTRMGTFHVIDALATLAYDGRRSAFFRSELMKALSILGQGDI 179

Query: 185 SSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +   + G+  G +GQ QF+P   ++YA    E G+ D+  +  D  AS A +LAK  W  
Sbjct: 180 TPAGMLGSYAGAMGQPQFMPSAYLRYAASYPEGGRRDIWHNEADVFASIANYLAKCHWLP 239

Query: 244 CAGYQPGEKNFAILKHWNASLNYNKTIAYIAAH 276
              +         +            I++ A  
Sbjct: 240 GQPWGEEVLLPDTITQAQIGRTAVHPISWWAQQ 272



 Score = 39.8 bits (91), Expect = 0.47,   Method: Composition-based stats.
 Identities = 6/25 (24%), Positives = 12/25 (48%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHI 277
           NF +++ +N S  Y   +  +   I
Sbjct: 306 NFNVIRRYNPSDFYALGVGLLGDAI 330


>gi|326563045|gb|EGE13319.1| lytic murein transglycosylase [Moraxella catarrhalis 103P14B1]
 gi|326573639|gb|EGE23598.1| lytic murein transglycosylase [Moraxella catarrhalis CO72]
 gi|326577288|gb|EGE27176.1| lytic murein transglycosylase [Moraxella catarrhalis 101P30B1]
          Length = 473

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 74/279 (26%), Positives = 125/279 (44%), Gaps = 9/279 (3%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           + L      +    +   + A +    + +   F +  S  +  +    +S  T +  + 
Sbjct: 1   MKLHTSALVLAMSGIMLSQTAFSNDSPNLSNSEFQQCLSTLKNSSTFRSVSGVTFEK-YR 59

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +   + I               DYL  L  SE +  GI  K   + +L  ++  YGV 
Sbjct: 60  PSQPDPSVIRSLNYQPE-FKKDVWDYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVK 118

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-H 187
           P  ++ +WG+E++FG+T+GK  L  +LATL+   RR  +F  ++  AL +V+ G I    
Sbjct: 119 PEHVLGVWGVESNFGQTLGKKNLFDSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPED 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P   ++ A+D D DG+ DLV S  DA+AS A FL K G+     +
Sbjct: 179 MTGSWAGAFGQTQFMPSTFLELAVDFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPW 238

Query: 248 QPGEKNFAILKHWNASL--NYNKTIAYIAAHIDGVPIGK 284
               +    L  +N S      ++I +  A    +P G+
Sbjct: 239 GYEVR----LNGYNGSSGRRNKQSINHWRAQGITLPNGQ 273


>gi|71734551|ref|YP_273050.1| type III helper protein HopAJ1 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555104|gb|AAZ34315.1| type III helper protein HopAJ1 [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 413

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/332 (22%), Positives = 123/332 (37%), Gaps = 67/332 (20%)

Query: 14  MVYPMLAQAVTQPKKATTQFICS-----DTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +V  MLA A   P    T           +   F +W +  R+ A  +G+   T    F 
Sbjct: 10  LVVIMLACASAAPACFATDMTPGVQNESTSEADFQQWLATFRSNATTKGIDTATLDLAFQ 69

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
           ++    T    D         +  DYL    + +   QG  L +    +L  +++ YGV 
Sbjct: 70  NITLDPTVHQLDTAQPE-FTTAIWDYLSERLTPKNTQQGQELLQ-KEPVLNEVERHYGVN 127

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSH 187
             I+ A+W +E+ +G+ +G   ++ +LATLAY  RR  +   Q   AL +++   I  + 
Sbjct: 128 AKIIAAIWCIESGYGKDIGSRDVIRSLATLAYKGRRMNYGATQLMAALHILQNKDIARAQ 187

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
            +G+  G +GQ QF+P   + YA+D + D + D+  S  DA+AS A +L +  W     +
Sbjct: 188 LIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRDVWSSRADALASTASYLKRSAWNSRISW 247

Query: 248 QPGEK---NF----------AILKHW---------------------------------- 260
               +   NF            +  W                                  
Sbjct: 248 GQEVQLPENFDYAQADMSIKKPVAEWQRLGVMGTTHAIPGQLAQEQASVLLPAGYRGPAF 307

Query: 261 ------------NASLNYNKTIAYIAAHIDGV 280
                       N S+ Y  TI  +A    G 
Sbjct: 308 MVLSNFRSILRYNNSIAYALTIGLLADSYAGG 339


>gi|148258168|ref|YP_001242753.1| putative membrane-bound lytic murein transglycosylase signal
           peptide [Bradyrhizobium sp. BTAi1]
 gi|146410341|gb|ABQ38847.1| Putative membrane-bound lytic murein transglycosylase, putative
           signal peptide [Bradyrhizobium sp. BTAi1]
          Length = 464

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 70/317 (22%), Positives = 115/317 (36%), Gaps = 60/317 (18%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
                  T     + A  F    +A    A R  ++    +   A L      +      
Sbjct: 76  ASGHPLMTAAAIREAAGNFDGCVAAMWPDAARRNITQDNFQRFTAGLTPDLRIMDLLDAQ 135

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
                 S  DYLD L +   +A+G  +           ++ YGV   I+ A+WG+E+++ 
Sbjct: 136 PE-FTKSIWDYLDILVNDNRLAKGREVLAKYKAQFDATERAYGVDRYIIAAIWGIESNYS 194

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFL 202
             +G   +L + ATLA   RR  +F ++F  AL+++ +G +      G+  G  G  QF+
Sbjct: 195 TQIGDRSVLQSTATLACIGRRQAYFKDEFLSALEILNRGDLRPEQLRGSWAGAFGPTQFM 254

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT-------------------- 242
           P    ++A+DAD DG+ D+V +  D IAS A  L K GW                     
Sbjct: 255 PTAFKRFAVDADGDGRRDVVDNPADLIASTANNLKKDGWQSGQSWGYEVVLPQGFNFMLA 314

Query: 243 -------------------KCAGY----------------QPG---EKNFAILKHWNASL 264
                                  +                 PG    +NF ++  +N + 
Sbjct: 315 DRAKTMSFGQWEQLGLKRANGQPFPATPEKAYLLAPAGAQGPGFLMLQNFRVIMKYNPAE 374

Query: 265 NYNKTIAYIAAHIDGVP 281
            Y   I + A  + G P
Sbjct: 375 AYALAIGHFADRLRGAP 391


>gi|326567028|gb|EGE17151.1| lytic murein transglycosylase [Moraxella catarrhalis 12P80B1]
          Length = 473

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 74/279 (26%), Positives = 125/279 (44%), Gaps = 9/279 (3%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           + L      +    +   + A +    + +   F +  S  +  +    +S  T +  + 
Sbjct: 1   MKLHTSALVLAMSGIMLSQTAFSNDSANLSNSEFQQCLSTLKNSSTFRSVSGVTFEK-YR 59

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +   + I               DYL  L  SE +  GI  K   + +L  ++  YGV 
Sbjct: 60  PSQPDPSVIRSLNYQPE-FKKDVWDYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVK 118

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-H 187
           P  ++ +WG+E++FG+T+GK  L  +LATL+   RR  +F  ++  AL +V+ G I    
Sbjct: 119 PEHVLGVWGVESNFGQTLGKKNLFDSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPED 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P   ++ A+D D DG+ DLV S  DA+AS A FL K G+     +
Sbjct: 179 MTGSWAGAFGQTQFMPSTFLELAVDFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPW 238

Query: 248 QPGEKNFAILKHWNASL--NYNKTIAYIAAHIDGVPIGK 284
               +    L  +N S      ++I +  A    +P G+
Sbjct: 239 GYEVR----LNGYNGSSGRRNKQSINHWRAQGITLPNGQ 273


>gi|154247769|ref|YP_001418727.1| lytic murein transglycosylase [Xanthobacter autotrophicus Py2]
 gi|154161854|gb|ABS69070.1| lytic murein transglycosylase [Xanthobacter autotrophicus Py2]
          Length = 416

 Score =  179 bits (453), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 70/340 (20%), Positives = 119/340 (35%), Gaps = 67/340 (19%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
                +               +    A  F  W    RARA   G+S  T   +F  L+ 
Sbjct: 9   AFSLGLAGSLAGAGLLTAAPALAQQAAQPFPRWVETFRARARARGVSDATYNRVFNGLKP 68

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
                A+DR            YL+   S   IA G    +  + L   ++K +GV   ++
Sbjct: 69  DTGVYAQDRNQAE-FTEQSWQYLNRRVSDWRIATGKQRARQYAGLFDRIEKAFGVDRRVM 127

Query: 133 MALWGLETHFGETMGKT----PLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVISS- 186
           +  WG+E+ FG+ +       P+  +LA LA+ D RR K++  +   AL +V++G  +  
Sbjct: 128 LGYWGMESAFGDVLDNPKHMTPVFPSLAALAWGDARRRKYWEAELLNALVIVERGWGTPQ 187

Query: 187 HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG-WTKCA 245
              G+  G +G  Q++P   +   +D D DG+I       DA+A  A +L + G + +  
Sbjct: 188 EMRGSWAGAMGHTQWMPEVWLNMGVDFDGDGRISPFGKPDDALAGTANYLVQRGKYRRGE 247

Query: 246 G-------------------------------------------------YQPGEK---- 252
                                                             + PG      
Sbjct: 248 PWGFEAKLPAGFNTDLADNKTRRPLAQWGELGVTTVEGQSLSGYDEPARLWLPGGAGGPA 307

Query: 253 -----NFAILKHWNASLNYNKTIAYIAAHIDG-VPIGKGY 286
                NF  ++ +N S NY   + ++   I G  P    +
Sbjct: 308 LLLLHNFYAVRSYNPSSNYALAVVHLGDRIMGEGPFVASW 347


>gi|47779365|gb|AAT38594.1| predicted membrane bound lytic transglycosylase [uncultured gamma
           proteobacterium eBACHOT4E07]
          Length = 295

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 62/258 (24%), Positives = 99/258 (38%), Gaps = 38/258 (14%)

Query: 56  EGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANS 115
            G      + +  D +     I    K       +++ Y       + I  G    K N 
Sbjct: 36  HGFDKNYVETVLKDAKKQQKIIDSISKPAE-FTWTWERYKKLFIEEKRIRNGKKFIKNNL 94

Query: 116 RLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CRRAKFFTEQFFY 174
             L   +KE+GVP  I+ ++ G+ET +G+ +G   ++ +L TL +D  RR+ FF ++   
Sbjct: 95  VTLERAEKEFGVPKEIITSILGIETRYGKILGNYRVIDSLTTLGFDYPRRSAFFKDELTK 154

Query: 175 ALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAA 233
              L ++  +      G+  G +G  QF+  +   YAID D D  +DL  S  DAI S A
Sbjct: 155 FFLLTRENNLDIYSVKGSYAGAMGYGQFISSSYRAYAIDFDGDNSVDLFNSVDDAIGSIA 214

Query: 234 KFLAKLGWTKCA-----------------------------------GYQPGEKNFAILK 258
            +L   GW K                                      Y  G+ NF  + 
Sbjct: 215 NYLKVHGWKKNGEIVTESSLNNVREIYKPHDSLSKFIPLSFNEDGKDNYFIGDDNFVAIT 274

Query: 259 HWNASLNYNKTIAYIAAH 276
            +N S  Y   + Y+A  
Sbjct: 275 KYNRSHFYAMAVYYLAEE 292


>gi|297538939|ref|YP_003674708.1| lytic murein transglycosylase [Methylotenera sp. 301]
 gi|297258286|gb|ADI30131.1| lytic murein transglycosylase [Methylotenera sp. 301]
          Length = 448

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 81/239 (33%), Positives = 113/239 (47%), Gaps = 11/239 (4%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +  L ++          P  A          + F  W S  R  AV  G++ KT   +  
Sbjct: 1   MRFLSILSVFFCGLFASPAFA---------HEDFNVWLSELRQEAVSVGITEKTVSAIVN 51

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
            +E L   I  DR         F DY      +  I +G  L   ++ LL  ++ +YGVP
Sbjct: 52  HVEILPNVIELDRAQPE-FVSPFLDYYQRRVDTLKITEGRKLLVQHAELLDKIELQYGVP 110

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
             +L+A WG+ET++G   G    LS LATLAYD RRA FF  Q   A+ +V  G  +   
Sbjct: 111 KALLVAFWGMETNYGRNQGNIDTLSALATLAYDGRRASFFRNQLIDAMRMVDAGNANVDQ 170

Query: 189 L-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
             G+  G  G  QF+P   + YA+D D D KID+V S  DA ASAA +L+++GW K   
Sbjct: 171 FVGSWAGAFGNMQFMPTTFITYAVDGDGDKKIDVVNSQADAFASAANYLSQVGWQKGQP 229



 Score = 45.6 bits (106), Expect = 0.008,   Method: Composition-based stats.
 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 2/42 (4%)

Query: 240 GWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           GW           NF  +  WN S+NY  ++  +A  ++G P
Sbjct: 335 GWR--GPAFMVFDNFDAVMDWNRSINYALSVVQLAKRLNGEP 374


>gi|296112423|ref|YP_003626361.1| lytic murein transglycosylase [Moraxella catarrhalis RH4]
 gi|295920117|gb|ADG60468.1| lytic murein transglycosylase [Moraxella catarrhalis RH4]
          Length = 473

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 74/279 (26%), Positives = 125/279 (44%), Gaps = 9/279 (3%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           + L      +    +   + A +    + +   F +  S  +  +    +S  T +  + 
Sbjct: 1   MKLHTSALVLAMSGIMLSQTAFSNDSPNLSNSAFQQCLSTLKNSSTFRSVSGVTFEK-YR 59

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +   + I               DYL  L  SE +  GI  K   + +L  ++  YGV 
Sbjct: 60  PSQPDPSVIRSLNYQPE-FKKDVWDYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVK 118

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-H 187
           P  ++ +WG+E++FG+T+GK  L  +LATL+   RR  +F  ++  AL +V+ G I    
Sbjct: 119 PEHVLGVWGVESNFGQTLGKKNLFDSLATLSCFDRRQSYFRGEYANALKIVQNGDIRPED 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P   ++ A+D D DG+ DLV S  DA+AS A FL K G+     +
Sbjct: 179 MTGSWAGAFGQTQFMPSTFLELAVDFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPW 238

Query: 248 QPGEKNFAILKHWNASL--NYNKTIAYIAAHIDGVPIGK 284
               +    L  +N S      ++I +  A    +P G+
Sbjct: 239 GYEVR----LNGYNGSSGRRNKQSINHWRAQGITLPNGQ 273


>gi|326560825|gb|EGE11191.1| lytic murein transglycosylase [Moraxella catarrhalis 46P47B1]
          Length = 473

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 74/279 (26%), Positives = 125/279 (44%), Gaps = 9/279 (3%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           + L      +    +   + A +    + +   F +  S  +  +    +S  T +  + 
Sbjct: 1   MKLHTSALVLAMSGIMLSQTAFSNDSPNLSNSEFQQCLSTLKNSSTFRSVSGVTFEK-YR 59

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +   + I               DYL  L  SE +  GI  K   + +L  ++  YGV 
Sbjct: 60  PSQPDPSVIRSLNYQPE-FKKDVWDYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVK 118

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-H 187
           P  ++ +WG+E++FG+T+GK  L  +LATL+   RR  +F  ++  AL +V+ G I    
Sbjct: 119 PEHVLGVWGVESNFGQTLGKKNLFDSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPED 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P   ++ A+D D DG+ DLV S  DA+AS A FL K G+     +
Sbjct: 179 MTGSWAGAFGQTQFMPSTFLELAVDFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPW 238

Query: 248 QPGEKNFAILKHWNASL--NYNKTIAYIAAHIDGVPIGK 284
               +    L  +N S      ++I +  A    +P G+
Sbjct: 239 GYEVR----LNGYNGSSGRRNKQSINHWRAQGITLPNGQ 273


>gi|148253742|ref|YP_001238327.1| hypothetical protein BBta_2243 [Bradyrhizobium sp. BTAi1]
 gi|146405915|gb|ABQ34421.1| hypothetical protein BBta_2243 [Bradyrhizobium sp. BTAi1]
          Length = 412

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 85/303 (28%), Positives = 129/303 (42%), Gaps = 61/303 (20%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
               F  + +  + RAV EG+S +        L Y    + RDR         F ++   
Sbjct: 23  NGQSFDRFLAELKQRAVAEGVSQRAIAAASPYLTYDQGIVNRDRGQR-VFGQLFTEFAGR 81

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
           +++   +  G    K ++      +K+YGVPP ++ A WGLE+ FG  MG  P+L +L +
Sbjct: 82  MAAVYRMQNGQQHIKMHAAAFARAEKDYGVPPAVIAAFWGLESDFGANMGNLPVLPSLVS 141

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADED 216
           LAYDCRR++ F  +   AL ++ +G +S    +G+  GE+GQ QFLP + V YA+D D D
Sbjct: 142 LAYDCRRSERFQNETIAALKVIDRGDLSPTEMIGSWAGELGQTQFLPTHYVTYAVDYDGD 201

Query: 217 GKIDLVKSNIDAIASAAKFLA-KLGWTKCA------------GYQPG------------- 250
           G+ DL++S  D I S A ++A  L W +               ++               
Sbjct: 202 GRRDLLRSAPDVIGSTANYIATGLKWRRGEPWLEEIRVPPTFPWEQADLTVKAPRSKWIG 261

Query: 251 ---------------------------------EKNFAILKHWNASLNYNKTIAYIAAHI 277
                                              NFA    WN SL Y+ T AY+A  I
Sbjct: 262 LGVTYADGRPLPNDALEASVLLPMGRNGPAFLAYANFAAYTEWNNSLIYSTTAAYLATRI 321

Query: 278 DGV 280
            G 
Sbjct: 322 AGA 324


>gi|222084330|ref|YP_002542859.1| transglycosylase protein [Agrobacterium radiobacter K84]
 gi|221721778|gb|ACM24934.1| transglycosylase protein [Agrobacterium radiobacter K84]
          Length = 486

 Score =  178 bits (452), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 68/336 (20%), Positives = 113/336 (33%), Gaps = 71/336 (21%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKS-AARARAVREGMSPKTAKHLFADLEY 72
            +  +    +            +D   +F  W        A ++G+S KT +  FA +  
Sbjct: 77  FLSFIYILLLALLPLPAFAASKADVEAQFQTWIQKDLWLEAKKDGISEKTFRAAFAGVTL 136

Query: 73  LDTTIARDRK---------MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
             +                   +   S   Y +      +   G +       +L  ++K
Sbjct: 137 NWSLPDLAPPGFPKPKEQKQTQAEFSSPAPYFNEGRLQRLAVTGRSFASQYGPVLKRIEK 196

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
            YGVP  IL+A+WG ET FG        +  LAT A+   R + F  +    L +++ G 
Sbjct: 197 VYGVPGPILLAIWGRETGFGAAKLPNSAVQVLATKAFMSTRKEMFRTELIAGLRILEHGD 256

Query: 184 ISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           ++    +G+  G +GQ QF+P + +KYA+D D DG  ++  S  D +AS A +L + GW 
Sbjct: 257 VAPDQFMGSWAGALGQPQFMPTSYLKYAVDFDGDGHRNIWTSVPDTLASIANYLVQKGWQ 316

Query: 243 KCAGY-------------QPGEKNFAILKHW----------------------------- 260
           +  G+             Q G      +  W                             
Sbjct: 317 RGRGWGYEVTIPESVSCAQEGPDLAKPISQWTSLGIARIAGKAFPSDELRAGGMMLVPAG 376

Query: 261 ------------------NASLNYNKTIAYIAAHID 278
                             N S  Y   I  +A  I 
Sbjct: 377 RDGPEFIVTPNFYTIKEYNNSDLYGLYIGNLADRIA 412


>gi|170749757|ref|YP_001756017.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
 gi|170656279|gb|ACB25334.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
          Length = 430

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 66/339 (19%), Positives = 119/339 (35%), Gaps = 68/339 (20%)

Query: 10  SLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFAD 69
           ++L     ++   V   + A            F   ++   A      +    A+   A 
Sbjct: 19  AVLATGAALVFGTVVPARAAGPDPTPPVAPQSFAACRADLIAWVTARAVPQGLAEAQLAH 78

Query: 70  LEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPP 129
           L      IA  +           DY++   +   +  G      ++  L  ++ +YGV  
Sbjct: 79  LTPDPDVIAATQSQGE-FVRPIWDYIEASVTPARVESGQRKLAKHADTLAAIEAKYGVDR 137

Query: 130 GILMALWGLETHFGETMGK----TPLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKGVI 184
            IL+A WG+E+ +G  +       P++ +LATL   D  R  ++ ++   AL ++     
Sbjct: 138 HILVAFWGVESSYGAVLDNAAVVKPVVRSLATLGCSDPTRMTYWRDELAAALQILAWNQA 197

Query: 185 SSHAL-----GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
               +     G+  G +G  QF+P    + A+D D DG+ D+  S  DA+AS A +L   
Sbjct: 198 PLDRMPAGLTGSWAGAMGHTQFMPSVYQREAVDFDGDGRRDIWTSVPDALASTANYLRGH 257

Query: 240 GWT-------------------------------KCAGYQPGE----------------- 251
           GW                                +  G +P                   
Sbjct: 258 GWRPGEGWGAEAVLPETFDAALADETTVRTVAAWRGLGVRPARDRALPDTAEATLILPAG 317

Query: 252 ---------KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
                     NFA++  +N +L Y  T+A ++  + G P
Sbjct: 318 IRGPAFLLQPNFAVILRYNTALAYALTVALLSERLRGDP 356


>gi|150398622|ref|YP_001329089.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
 gi|150030137|gb|ABR62254.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
          Length = 412

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 73/338 (21%), Positives = 118/338 (34%), Gaps = 71/338 (21%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKS-AARARAVREGMSPKTAKHLFADL 70
           ++    +L  A      A+     SD   +F +W        A + G+S    K  F  +
Sbjct: 1   MLRFLSVLFLASLFFVSASFAASRSDVEAQFRQWLQSDLWPEAQKAGVSSGAFKAAFKGV 60

Query: 71  EYLDTTIARDRK---------MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
                                   +   S   Y        + A G +L   ++  L  +
Sbjct: 61  RLNWDLPDLAPPGFPKPKQRKQSQAEFSSPGSYFSEKRLQGLAATGRSLASTHASTLKRI 120

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           ++ YGVP  I++A+WG E+ FG      P++  LAT A+   R + F  +   AL ++  
Sbjct: 121 ERTYGVPGTIVLAIWGKESGFGRAKIPHPIMDVLATKAFMSTRPELFRRELIAALHILDS 180

Query: 182 GVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G +  +   G+  G +GQ QFLP + +KYA+D D DG+ D+  S  D++AS A +LA+ G
Sbjct: 181 GDVKEAEMRGSWAGAMGQPQFLPTSFLKYAVDFDGDGRRDIWNSVPDSLASIASYLAQKG 240

Query: 241 WTKCAGY-------------QPGEKNFAILKHW--------------------------- 260
           W +   +             Q G      +  W                           
Sbjct: 241 WQRGRDWGFEVAIPSGVSCAQEGPDLARPIAEWAGMGIGRVSGKPFPAAERGASGMMLVP 300

Query: 261 --------------------NASLNYNKTIAYIAAHID 278
                               N S  Y   I  +A  I 
Sbjct: 301 AGTHGPQFIVTPNFYVIKEYNNSDLYALYIGNLADRIA 338


>gi|78049951|ref|YP_366126.1| putative transglycosylase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78038381|emb|CAJ26126.1| putative transglycosylase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 720

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 78/336 (23%), Positives = 127/336 (37%), Gaps = 73/336 (21%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           ++L     P +   +     A            F    +  + +A  +G+   + +   A
Sbjct: 1   MTLARRALPFVLGLLPLAASADPA---------FDRCLAGLQPQAAAKGVDAASFQRFTA 51

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
            L    + +               DYL  L  S+ ++ G A+   +  LL  L ++ GV 
Sbjct: 52  GLAPDPSVLPLLDAQPE-FTTPIWDYLASLVDSQRVSDGQAMLVTHRELLARLSEQTGVD 110

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
           P  ++A+WG+E+ +G   GK PLL +LATL+   RR  FF  +F   L L+++G +S+  
Sbjct: 111 PATIVAVWGVESDYGRVTGKRPLLVSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSAEG 170

Query: 189 -LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P    + A+D D DG+ DLV S  DA+AS A +L K GW +   +
Sbjct: 171 LTGSWAGAFGQTQFMPSTYARIAVDGDGDGRRDLVTSIPDALASTANYLVKAGWERARPW 230

Query: 248 Q-------------PGEKNFAILKHWNAS------------------------------- 263
                          G      L+ W  +                               
Sbjct: 231 GMEVTLPRGFDASKAGRTRRQPLQAWQRAGLLGTDGTPLAPAGLPAETPAALLLPAGASG 290

Query: 264 ------------------LNYNKTIAYIAAHIDGVP 281
                              +Y  +IA +A  + G P
Sbjct: 291 PAFLVFGNYDAIYAYNAAESYALSIALLADRLRGGP 326


>gi|304320863|ref|YP_003854506.1| hypothetical protein PB2503_06492 [Parvularcula bermudensis
           HTCC2503]
 gi|303299765|gb|ADM09364.1| hypothetical protein PB2503_06492 [Parvularcula bermudensis
           HTCC2503]
          Length = 403

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 72/273 (26%), Positives = 118/273 (43%), Gaps = 2/273 (0%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           M+ +     A      A      + + + F +++S  R  A+ +G+ P            
Sbjct: 1   MISFATALLATILTGNAAAAGSAAQSTENFDDFRSEFRQEAIGQGIDPAVYDREMRAATP 60

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
           L   + R+             YLD   S   IA GIA  +  +  L  ++ EYGV   I+
Sbjct: 61  LAVVLERNSNQPE-FSRPIWAYLDSAVSDTRIANGIAATQRQAAQLDAIEAEYGVDKEII 119

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGA 191
            A+WGLE+ +G  +G   ++S  ATLAY  RR  +   Q   AL +++ G        G+
Sbjct: 120 GAIWGLESSYGAILGDYDIISATATLAYQGRRQSYGRSQLIGALKILQNGYADRSQLKGS 179

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             G +GQ QF+P   + YA+D D DGK DL  S  D  AS A +L++ G+   A +    
Sbjct: 180 WAGAMGQTQFIPTTYLSYAVDEDGDGKRDLWGSYGDVFASTANYLSRSGYEVNAPWGFEV 239

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVPIGK 284
           +      +  A+L   +++    +     P  +
Sbjct: 240 RLPQDFDYATANLQTKRSVGEWLSRGVEAPAAR 272



 Score = 46.0 bits (107), Expect = 0.006,   Method: Composition-based stats.
 Identities = 8/29 (27%), Positives = 12/29 (41%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGV 280
            NF  +  +N S  Y   I  ++  I G 
Sbjct: 300 DNFRAIMRYNNSTAYALGIGLLSDAIAGR 328


>gi|326572366|gb|EGE22359.1| lytic murein transglycosylase [Moraxella catarrhalis BC7]
          Length = 473

 Score =  178 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 74/279 (26%), Positives = 126/279 (45%), Gaps = 9/279 (3%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           + L      +    +   + A +    + +   F +  S  +  +    +S  T +  + 
Sbjct: 1   MKLHTSALVLAMSGIMLSQTAFSNDSPNLSNSEFQQCLSTLKNSSTFRSVSGVTFEK-YR 59

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +   + I               DYL  L  SE +  GI  K   + +L  ++  YGV 
Sbjct: 60  PSQPDPSVIRSLNYQPE-FKKDVWDYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVK 118

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-H 187
           P  ++ +WG+E++FG+T+GK  L ++LATL+   RR  +F  ++  AL +V+ G I    
Sbjct: 119 PEHVLGVWGVESNFGQTLGKKNLFNSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPED 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P   ++ A+D D DG+ DLV S  DA+AS A FL K G+     +
Sbjct: 179 MTGSWAGAFGQTQFMPSTFLELAVDFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPW 238

Query: 248 QPGEKNFAILKHWNASL--NYNKTIAYIAAHIDGVPIGK 284
               +    L  +N S      ++I +  A    +P G+
Sbjct: 239 GYEVR----LNGYNGSSGRRNKQSINHWRAQGITLPNGQ 273


>gi|326561927|gb|EGE12262.1| lytic murein transglycosylase [Moraxella catarrhalis 7169]
 gi|326569567|gb|EGE19621.1| lytic murein transglycosylase [Moraxella catarrhalis BC8]
          Length = 473

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 74/279 (26%), Positives = 125/279 (44%), Gaps = 9/279 (3%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           + L      +    +   + A +    + +   F +  S  +  +    +S  T +  + 
Sbjct: 1   MKLHTSALVLAMSGIMLSQTAFSNDSANLSNSEFQQCLSTLKNSSTFRSVSGVTFEK-YR 59

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +   + I               DYL  L  SE +  GI  K   + +L  ++  YGV 
Sbjct: 60  PSQPDPSVIRSLNYQPE-FKKDVWDYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVK 118

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-H 187
           P  ++ +WG+E++FG+T+GK  L  +LATL+   RR  +F  ++  AL +V+ G I    
Sbjct: 119 PEHVLGVWGVESNFGQTLGKKNLFDSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPED 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P   ++ A+D D DG+ DLV S  DA+AS A FL K G+     +
Sbjct: 179 MTGSWAGAFGQTQFMPSTFLELAVDFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPW 238

Query: 248 QPGEKNFAILKHWNASL--NYNKTIAYIAAHIDGVPIGK 284
               +    L  +N S      ++I +  A    +P G+
Sbjct: 239 GYEVR----LNGYNGSSGRRNKQSINHWRAQGITLPNGQ 273


>gi|325927220|ref|ZP_08188480.1| lytic murein transglycosylase [Xanthomonas perforans 91-118]
 gi|325542418|gb|EGD13900.1| lytic murein transglycosylase [Xanthomonas perforans 91-118]
          Length = 720

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 78/336 (23%), Positives = 127/336 (37%), Gaps = 73/336 (21%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           ++L     P +   +     A            F    +  + +A  +G+   + +   A
Sbjct: 1   MTLARRALPFVLGLLPLAASADPA---------FDRCLAGLQPQAAAKGVDAASFQRFTA 51

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
            L    + +               DYL  L  S+ ++ G A+   +  LL  L ++ GV 
Sbjct: 52  GLAPDPSVLPLLDAQPE-FTTPIWDYLASLVDSQRVSDGQAMLVTHRELLARLSEQTGVD 110

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
           P  ++A+WG+E+ +G   GK PLL +LATL+   RR  FF  +F   L L+++G +S+  
Sbjct: 111 PATIVAVWGVESDYGRVTGKRPLLVSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSAEG 170

Query: 189 -LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P    + A+D D DG+ DLV S  DA+AS A +L K GW +   +
Sbjct: 171 LTGSWAGAFGQTQFMPSTYARIAVDGDGDGRRDLVTSIPDALASTANYLVKAGWERARPW 230

Query: 248 Q-------------PGEKNFAILKHWNAS------------------------------- 263
                          G      L+ W  +                               
Sbjct: 231 GMEVTLPRGFDASKAGRTRRQPLQAWQRAGLLGTDGTPLAPAGLPAETPAALLLPAGASG 290

Query: 264 ------------------LNYNKTIAYIAAHIDGVP 281
                              +Y  +IA +A  + G P
Sbjct: 291 PAFLVFGNYDAIYAYNAAESYALSIALLADRLRGGP 326


>gi|71278899|ref|YP_268059.1| putative peptidoglycan-binding protein [Colwellia psychrerythraea
           34H]
 gi|71144639|gb|AAZ25112.1| putative peptidoglycan-binding protein [Colwellia psychrerythraea
           34H]
          Length = 427

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 78/259 (30%), Positives = 128/259 (49%), Gaps = 18/259 (6%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           ++   +  + +L  ++P+LA A                 + F + K     RA   G S 
Sbjct: 12  LNLVHFRKLIMLCALFPLLANATIA-------------DEDFLQCKVNLAKRAETAGFSS 58

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
              + +  ++  +   IA D+K       +F+ Y+    +   +  G    K N +L   
Sbjct: 59  YITQTVIDNISPIKRVIALDKKQPE-FTQTFEQYIKARVTDYHVRVGKEKLKKNKKLFDA 117

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           L+K+YGVP   L++ WGLET FG+  GK  +L++LATLA D RR++FFT +      L++
Sbjct: 118 LEKKYGVPRQYLVSFWGLETVFGKHKGKMSVLNSLATLACDERRSEFFTLELLNLFTLIE 177

Query: 181 KGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
              ++     G+  G +G  QF+P   +KYA+D D DGK+D+ KS +DA+ +AA +L K+
Sbjct: 178 TKQVAVEQLQGSWAGAMGHMQFMPTAFLKYAVDGDNDGKVDIWKSEVDALTTAANYLNKI 237

Query: 240 GWTKCAGYQPGEK---NFA 255
            W     +    K   NFA
Sbjct: 238 SWQPKERWGREVKLPTNFA 256


>gi|126728532|ref|ZP_01744348.1| hypothetical protein SSE37_21117 [Sagittula stellata E-37]
 gi|126711497|gb|EBA10547.1| hypothetical protein SSE37_21117 [Sagittula stellata E-37]
          Length = 395

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 75/262 (28%), Positives = 114/262 (43%), Gaps = 6/262 (2%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           ++   + A A++ P  A            F  +    + +AV EG  P T    F+ +  
Sbjct: 6   LLGLVLAATALSGPVSAQDVP----CGGSFSSFVQGLKDQAVAEGHDPATVNRFFSGISQ 61

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
             + +  DR+        F  +   L S   +  G+   +  S +   ++ EYG+ PG+L
Sbjct: 62  SQSVLKADRRQG-IFQDPFITFSRKLISQNRLDTGLRKAREWSGVFDRIQSEYGISPGVL 120

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGA 191
           +A W  ET +G   G     + L TLA+DCRR + F  Q F AL L + G        GA
Sbjct: 121 LAFWAFETDYGGYQGDFNTANALVTLAHDCRRPEIFRPQVFSALTLFEHGDFDPATTTGA 180

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             GEIG  Q LP ++++  +D D DG + L  S  DA+ S AK L+ LGW     +    
Sbjct: 181 WAGEIGMVQMLPKDILENGVDGDGDGHVSLKTSPPDALLSGAKMLSHLGWRPNEPWLQEV 240

Query: 252 KNFAILKHWNASLNYNKTIAYI 273
                L  +   L   KT+A  
Sbjct: 241 TLPEDLDWYETGLQTTKTVAEW 262



 Score = 46.4 bits (108), Expect = 0.004,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 13/38 (34%)

Query: 243 KCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
           +         NF +   WN S  Y  T AY    + G 
Sbjct: 289 RKGPAFIAYPNFRVYFEWNQSFTYVLTAAYFGTRLMGA 326


>gi|254460392|ref|ZP_05073808.1| lytic murein transglycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206676981|gb|EDZ41468.1| lytic murein transglycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 391

 Score =  178 bits (451), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 82/319 (25%), Positives = 119/319 (37%), Gaps = 58/319 (18%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA 78
           L+          +  +       F  +    +  AV+ G  P+T    FA+       + 
Sbjct: 5   LSALAVITAFGASPALAQSCGGSFSSFVDGLKNEAVQRGHEPETVDRFFANARKDAAVLK 64

Query: 79  RDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGL 138
            DR       + F D+   L S   I +G A+ +  + +   ++ +YGV  G+L+A W  
Sbjct: 65  ADRAQG-VFQLPFVDFSRRLISQNRINKGRAMGQKYASIFAKIENKYGVSRGVLLAFWAF 123

Query: 139 ETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIG 197
           ET +G   G     + L TLA+DCRR + F  Q F AL+L  KG        GA  GEIG
Sbjct: 124 ETDYGTFQGDFNTANALMTLAHDCRRPELFLPQIFAALELFGKGNFDPTRTTGAWAGEIG 183

Query: 198 QFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG---EKNF 254
             Q LP ++++  ID D DG + L  S  DA+ S  K L+ LGW K   +       KNF
Sbjct: 184 MVQMLPADILENGIDGDGDGHVSLKTSAPDALLSGGKMLSALGWRKGEPWLQEVTMPKNF 243

Query: 255 -----------------------------------------------------AILKHWN 261
                                                                 +   WN
Sbjct: 244 DWSKTGLNHSASAHDWQNMGVQARGGQLVDGLPSSIILPQGRKGPAFLAYPNFRVYFEWN 303

Query: 262 ASLNYNKTIAYIAAHIDGV 280
            S  Y  T AY A  ++G 
Sbjct: 304 QSFTYVLTAAYFANRLEGA 322


>gi|291086293|ref|ZP_06355311.2| lytic murein transglycosylase B [Citrobacter youngae ATCC 29220]
 gi|291068780|gb|EFE06889.1| lytic murein transglycosylase B [Citrobacter youngae ATCC 29220]
          Length = 395

 Score =  178 bits (451), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 70/358 (19%), Positives = 127/358 (35%), Gaps = 84/358 (23%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRF------------------ 42
           M  ++Y+    L+ ++ +LA   ++PK   TQ      +  F                  
Sbjct: 37  MFKRRYV---ALLPLFVLLAACSSKPKPPETQTTTGTPSGGFLLEPQHNVMLTGGDFANN 93

Query: 43  GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS------FKDYLD 96
              +        + G   +  + + +  + LD+ +    +   +          +  Y  
Sbjct: 94  PNAQQFIEKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDRQAPTTQPPAGPNGAWLRYRK 153

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
              + + +  G+A        L    + YGVPP I++ + G+ET +G  MGKT +L  LA
Sbjct: 154 QFITPDNVQNGVAFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALA 213

Query: 157 TLAY-DCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDAD 214
           TL++   RRA++F+ +    L + +          G+  G +G  QF+P +  +YA+D +
Sbjct: 214 TLSFNYPRRAEYFSGELETFLLMARDESDDPLDLKGSFAGAMGYGQFMPSSYKEYAVDFN 273

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK------------------------------- 243
            DG I+L    +DAI S A +    GW K                               
Sbjct: 274 GDGHINLW-DPVDAIGSVANYFKGHGWVKGDTVAVPANGQAPGLANGFKTQYSISQLAAA 332

Query: 244 ---------------------CAGYQPGE--KNFAILKHWNASLNYNKTIAYIAAHID 278
                                  GYQ      NF  +  +N S +Y   +  +   + 
Sbjct: 333 GLTPQQSLGNHQQASLLRLDVGTGYQYWYGLPNFYAITRYNHSTHYAMAVWQLGQAVA 390


>gi|326570329|gb|EGE20373.1| lytic murein transglycosylase [Moraxella catarrhalis BC1]
          Length = 473

 Score =  178 bits (451), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 74/279 (26%), Positives = 125/279 (44%), Gaps = 9/279 (3%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           + L      +    +   + A +    + +   F +  S  +  +    +S  T +  + 
Sbjct: 1   MKLHTSALVLAMSGIMLSQTAFSNDSANLSNSEFQQCLSTLKNSSTFRSVSGVTFEK-YR 59

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +   + I               DYL  L  SE +  GI  K   + +L  ++  YGV 
Sbjct: 60  PSQPNPSVIRSLNYQPE-FKKDVWDYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVK 118

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-H 187
           P  ++ +WG+E++FG+T+GK  L  +LATL+   RR  +F  ++  AL +V+ G I    
Sbjct: 119 PEHVLGVWGVESNFGQTLGKKNLFDSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPED 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P   ++ A+D D DG+ DLV S  DA+AS A FL K G+     +
Sbjct: 179 MTGSWAGAFGQTQFMPSTFLELAVDFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPW 238

Query: 248 QPGEKNFAILKHWNASL--NYNKTIAYIAAHIDGVPIGK 284
               +    L  +N S      ++I +  A    +P G+
Sbjct: 239 GYEVR----LNGYNGSSGRRNKQSINHWRAQGITLPNGQ 273


>gi|332186023|ref|ZP_08387769.1| lytic murein transglycosylase family protein [Sphingomonas sp. S17]
 gi|332013838|gb|EGI55897.1| lytic murein transglycosylase family protein [Sphingomonas sp. S17]
          Length = 338

 Score =  178 bits (451), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 70/275 (25%), Positives = 117/275 (42%), Gaps = 23/275 (8%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M    +  ++LL+   P  A                     F  +    R+ A+ +G+S 
Sbjct: 1   MRLGIFSTLALLIGSTPAFA----------------QDEAGFQSYLQQVRSTALAQGVSR 44

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVS----FKDYLDGLSSSEIIAQGIALKKANSR 116
            T   +   L      I  DR+    P  S    F  Y      +  I++G +   A   
Sbjct: 45  ATLDSVLPTLTLNSRVIELDRRQPGGPANSGFSPFAPYKAAHVDAARISRGRSKYLAQRP 104

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
            L  ++++ GVP  I++A+WG ET++G   G   L+ +LA+LAY+ RR   F  +F  A+
Sbjct: 105 RLSRIERDTGVPESIMVAIWGHETNYGSYTGNFDLIRSLASLAYEGRRRPLFEGEFIAAM 164

Query: 177 DLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
            ++ +GV  S   G+  G  G  QFLP   ++ A D D DG+ D+  S  D +AS   + 
Sbjct: 165 KMMDRGVSRSQLKGSWAGATGNPQFLPSIYLRLARDGDGDGRADIWNSEADTLASIGNYF 224

Query: 237 AKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
              GW     +        +   +N S+  N+ ++
Sbjct: 225 VNAGWRAGQPWGFA---VTVPAGFNRSMVQNRLVS 256



 Score = 40.2 bits (92), Expect = 0.32,   Method: Composition-based stats.
 Identities = 7/27 (25%), Positives = 14/27 (51%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+ ++  +N S  Y  ++  +A  I G
Sbjct: 312 NYRVILDYNCSNFYALSVGLLADAIAG 338


>gi|326578049|gb|EGE27913.1| lytic murein transglycosylase [Moraxella catarrhalis O35E]
          Length = 473

 Score =  178 bits (451), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 74/279 (26%), Positives = 125/279 (44%), Gaps = 9/279 (3%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           + L      +    +   + A +    + +   F +  S  +  +    +S  T +  + 
Sbjct: 1   MKLHTSALVLAMSGIMLSQTAFSNDSANLSNSAFQQCLSTLKNSSTFRSVSGVTFEK-YR 59

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +   + I               DYL  L  SE +  GI  K   + +L  ++  YGV 
Sbjct: 60  PSQPDPSVIRSLNYQPE-FKKDVWDYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVK 118

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-H 187
           P  ++ +WG+E++FG+T+GK  L  +LATL+   RR  +F  ++  AL +V+ G I    
Sbjct: 119 PEHVLGVWGVESNFGQTLGKKNLFDSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPED 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  G  GQ QF+P   ++ A+D D DG+ DLV S  DA+AS A FL K G+     +
Sbjct: 179 MTGSWAGAFGQTQFMPSTFLELAVDFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPW 238

Query: 248 QPGEKNFAILKHWNASL--NYNKTIAYIAAHIDGVPIGK 284
               +    L  +N S      ++I +  A    +P G+
Sbjct: 239 GYEVR----LNGYNGSSGRRNKQSINHWRAQGITLPNGQ 273


>gi|182680540|ref|YP_001834686.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636423|gb|ACB97197.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 419

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 67/308 (21%), Positives = 113/308 (36%), Gaps = 58/308 (18%)

Query: 31  TQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
           TQ         F    ++ RA A  +G +  T       +++    I             
Sbjct: 40  TQGQGQAAGAEFETCVASLRANAQAQGTTSATLARTLDSVQFDPEIIPLSTNQPE-FKTP 98

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
             DYL GL   E +  G ++ + +++     ++ + V   ++ A+WG+E+ FG   G  P
Sbjct: 99  IWDYLSGLVDQERVDDGRSMMQRHAQAFATAEQRFSVDRAVIAAVWGVESDFGRGFGTRP 158

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKY 209
           ++ +L TL+    R  +F  +   AL +V+ G I      G+  G  G  QF+P   ++ 
Sbjct: 159 VIRSLTTLSCAGPRQSYFRSELLAALKIVQNGDIEPSQFNGSWAGAFGHTQFMPSTFLRT 218

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLG----------------------------- 240
           A+D D DG+ DL+ S  DA+ S A +L K G                             
Sbjct: 219 AVDLDGDGRRDLINSVPDALGSTAAYLRKGGWTPGLEWGYEVLLPPHYAGPSGRTRKEPL 278

Query: 241 --WTK-------CAGYQPGEK------------------NFAILKHWNASLNYNKTIAYI 273
             W          A                         NF  +  +NA+ +Y   IA +
Sbjct: 279 ATWAARGLRRMDGAPLSGATPAGLLLPAGPTGPAFLVTRNFEAIYSYNAAESYALAIALL 338

Query: 274 AAHIDGVP 281
           +  + G P
Sbjct: 339 SNRLRGRP 346


>gi|220920095|ref|YP_002495396.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
 gi|219944701|gb|ACL55093.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
          Length = 398

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 70/260 (26%), Positives = 111/260 (42%), Gaps = 8/260 (3%)

Query: 33  FICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
            +       F    +     A   G+SP T +   A + Y D  I   +           
Sbjct: 19  ALPGAAQADFRSCLAGLGREAAAHGISPSTFQSATAGIVYDDKVIELSQAQPE-FKTPIW 77

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+  L   E +  G A  +  +  L   +  + V    + A+WG+E++FG+ +GK PL+
Sbjct: 78  DYIAALVDEERVEDGRAAMRQYASALAQAEARFNVDRYTIAAVWGVESNFGKNLGKMPLV 137

Query: 153 STLATLAYDC-RRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYA 210
            +LATLA    RRA FF  +    L ++ +G I +    G+  G  GQ QF+P    + A
Sbjct: 138 QSLATLACSSNRRAGFFKGELMATLKIIDRGDIEASRLTGSWAGAFGQTQFMPSTYQRLA 197

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTI 270
           +D D DG+ D+V S  DA+ S A FL    W     +    +         A     + +
Sbjct: 198 VDLDGDGRRDVVDSVADAVGSTANFLRVAKWQNGLPWGYEVRLPRGFNLAAAGRKSKRPV 257

Query: 271 AYIA----AHIDGVPI-GKG 285
           ++ A      IDG  + G+G
Sbjct: 258 SHWASLGVTRIDGRQLTGEG 277


>gi|260467300|ref|ZP_05813474.1| transglycolase [Mesorhizobium opportunistum WSM2075]
 gi|259028904|gb|EEW30206.1| transglycolase [Mesorhizobium opportunistum WSM2075]
          Length = 265

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 90/265 (33%), Positives = 133/265 (50%), Gaps = 10/265 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++   +   +           C  T   F  WK    A A  EG+  +      A   Y 
Sbjct: 9   ILAATVVAVLALATGVQAGPSCGKTGAGFEAWKQDFAADAKAEGVGSRGL-AALAGATYA 67

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             TI+ DR +  +   S + ++     S II++G ALKK+N+ L   +++ YGV PG+L+
Sbjct: 68  TRTISADRAIHKAFSGSVEAFMKRRGGSAIISKGRALKKSNAALFNQIERNYGVSPGVLL 127

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF 193
           A+WG+ET FG +MG    +S + TLAYDCRR  +F      AL LV +G +S+ ++GA  
Sbjct: 128 AIWGMETGFGASMGNQNTVSAILTLAYDCRRPDYFHPHAIAALKLVDRGALSASSVGAMH 187

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GE+G  QFLP NV+KYA+ +        ++    A+AS A FL   GW   A       N
Sbjct: 188 GEVGHTQFLPGNVLKYAVGSGN------LRDKATALASTANFLKGHGWRAGAS---ANAN 238

Query: 254 FAILKHWNASLNYNKTIAYIAAHID 278
              +  WN++  Y + IA IA  ID
Sbjct: 239 MGAIAGWNSASVYQQAIAQIATAID 263


>gi|254504789|ref|ZP_05116940.1| lytic murein transglycosylase subfamily [Labrenzia alexandrii
           DFL-11]
 gi|222440860|gb|EEE47539.1| lytic murein transglycosylase subfamily [Labrenzia alexandrii
           DFL-11]
          Length = 398

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 79/326 (24%), Positives = 124/326 (38%), Gaps = 58/326 (17%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
             +      A+T     T   +       F  + +  +  AV +G+S   A    +  + 
Sbjct: 6   FPLKTFTVAALTGLALMTAPAVAQQCGGDFQTFLAGVKQEAVAKGLSASAADQTLSGAQI 65

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
               ++RDR       ++F D+   + SS  +  G A     + +   ++ EYGVP  ++
Sbjct: 66  DRKVLSRDRAQG-VFKMTFLDFSKRVISSYRMKNGAANMVKYASVFDRVESEYGVPAPVI 124

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGA 191
            A W LET FG   G    ++ LATLA+DCRR + F  Q   A+++V+ G +   +  GA
Sbjct: 125 TAFWALETDFGAVQGDFNTVNALATLAHDCRRPELFRPQLIAAIEMVQHGDLDPQNTTGA 184

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG- 250
             GEIG  Q LP +++K+  DAD DG + L  S  DAI +A  F+  LGW     +    
Sbjct: 185 WAGEIGMVQMLPEDIIKFGKDADGDGHVRLKASAPDAILTAGAFIGHLGWQPGEPWLQEV 244

Query: 251 -------------------------------------------------EKNFAILKHW- 260
                                                               F    ++ 
Sbjct: 245 TVPQSLNWAETGLGKTKSGSDWAALGVQPRWGQISGNLPASLLLPQGRKGPAFLAYPNYN 304

Query: 261 -----NASLNYNKTIAYIAAHIDGVP 281
                N S  Y  + AY A  + G P
Sbjct: 305 IYLEWNQSFIYTTSAAYFATRLAGAP 330


>gi|307945426|ref|ZP_07660762.1| lytic murein transglycosylase [Roseibium sp. TrichSKD4]
 gi|307771299|gb|EFO30524.1| lytic murein transglycosylase [Roseibium sp. TrichSKD4]
          Length = 394

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 80/309 (25%), Positives = 120/309 (38%), Gaps = 58/309 (18%)

Query: 31  TQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
                      F ++ +  +  AV +G+S K A    +  +     +ARDR       + 
Sbjct: 20  APAFAQQCGGDFRQFLAGVKKEAVAKGLSAKAADATLSGAQIDRKVLARDRSQG-VFKMP 78

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
           F ++   + S   +  G    K  S +    +KEYGVP  ++ A W LET +G   G   
Sbjct: 79  FINFSQRVISGHRMQHGAKNMKKYSGIFARTEKEYGVPAPVISAFWALETDYGAVQGDFN 138

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKY 209
            ++ LATLA+DCRR + F  Q   A+++V+ G +      GA  GEIG  Q LP +++K+
Sbjct: 139 TVNALATLAHDCRRPELFRPQLIAAIEMVQHGDLDPRRTTGAWAGEIGMVQMLPEDIIKF 198

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK------------CAGYQP-------- 249
             D + DG + L KS  DAI +A  F+  LGW +               +          
Sbjct: 199 GKDGNGDGHVTLKKSAEDAILTAGAFIQNLGWRRGDPWLQEVKVPGNLDWSKTGLKTSMP 258

Query: 250 ------------------------------------GEKNFAILKHWNASLNYNKTIAYI 273
                                                  NF I   WN S  Y  T AY 
Sbjct: 259 VADWARLGITARSGKLRTDLPASLILPQGRKGPAFLAYPNFDIYLEWNQSFVYTTTAAYF 318

Query: 274 AAHIDGVPI 282
           A  + G P+
Sbjct: 319 ATRLGGAPV 327


>gi|187477736|ref|YP_785760.1| lytic murein transglycosylase [Bordetella avium 197N]
 gi|115422322|emb|CAJ48846.1| putative lytic murein transglycosylase [Bordetella avium 197N]
          Length = 405

 Score =  178 bits (450), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 77/315 (24%), Positives = 127/315 (40%), Gaps = 61/315 (19%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
             +     + +     RA+A   G++          LE     I+              D
Sbjct: 26  PTAQELKTYRQCLVDLRAKAPEAGVTQANYDRYTDGLEPDMDVISFLDAQPE-FKTPIWD 84

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y+ GL  +E I  G       + +L  ++ EYGV P  ++A+WG+E++FG+ +G  PLL+
Sbjct: 85  YMAGLVDAERIDDGRQGLNQWASVLARVEAEYGVDPATVVAVWGVESNFGKNLGGRPLLT 144

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAID 212
           +L+TL+   RR  +F  +F   L +++   +SS    G+  G  GQ QF+P   ++ A+D
Sbjct: 145 SLSTLSCFGRRQSYFRGEFLATLRIIQDEHVSSDRLKGSWAGAFGQTQFMPSTYLRLAVD 204

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ-------------PGEKNFAILKH 259
            D DG+ DLV S  DA+AS A FL + GW K   +               G +N   +  
Sbjct: 205 FDGDGRRDLVDSVPDALASTANFLKRAGWNKALPWGFEVNLPAGMDISTAGRRNKQPMSA 264

Query: 260 W---------------------------------------------NASLNYNKTIAYIA 274
           W                                             NA+ +Y   IA+++
Sbjct: 265 WAARGIKRVDGQPLPGGEIPAALLLPAGPEGPAFLVTRNFDALYSYNAAESYALAIAHLS 324

Query: 275 AHIDGV-PIGKGYDT 288
             + G  P  + + T
Sbjct: 325 DRLRGGLPFARPWPT 339


>gi|148653769|ref|YP_001280862.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
 gi|148572853|gb|ABQ94912.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
          Length = 486

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 75/337 (22%), Positives = 129/337 (38%), Gaps = 62/337 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKK-ATTQFICSDTADRFGEWKSAARARAVREGMS 59
           MS  K   +  ++    + +     P   A  + + +   ++F          +    + 
Sbjct: 1   MSSTKLSAVFPVLSTLGLASLVFIAPTSYAEQKPLPTLDNNQFNVCLDNLSQSSAFASV- 59

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
             T    +   +   + +               DYL  L   E +  GIA  +  + +L 
Sbjct: 60  KDTLAQ-YRPAQGDPSVLESLDYQPE-FQKEPWDYLASLVDEERVIDGIAASERYADVLA 117

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            ++ +YGV    ++ +WG+E+ FG T+GK  ++ +LATL+   RR  +F  ++  AL ++
Sbjct: 118 RIEAQYGVNRYDVLGVWGVESDFGTTLGKKEVVQSLATLSCFGRRQSYFRSEYVSALKIL 177

Query: 180 KKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           K+G I+ +   G+  G  GQ QF+P   ++ A D D DG+ DLV S  DA+AS A FL  
Sbjct: 178 KQGDIAPNDFKGSWAGAFGQTQFMPSTFLQLAQDFDGDGRKDLVNSQADALASTANFLKN 237

Query: 239 LGWTKCAGYQ------------------------------------------------PG 250
            G+     +                                                 P 
Sbjct: 238 SGYQSGQPWGYEVRLPANINASNDRKNKQPISHWRNLGITLVDGSELSDSLSNAGLLLPA 297

Query: 251 EKN---------FAILKHWNASLNYNKTIAYIAAHID 278
            KN         F     +NAS NY   IA+++  I+
Sbjct: 298 GKNGPAFLVGRNFDAFYAYNASENYALAIAHLSDRIE 334


>gi|218680765|ref|ZP_03528662.1| lytic murein transglycosylase [Rhizobium etli CIAT 894]
          Length = 403

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 69/281 (24%), Positives = 113/281 (40%), Gaps = 19/281 (6%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKS-AARARAVREGMSPKTAKHLFADLE---------Y 72
              P  A      +D   +F  W        A   G+S KT +  F+ +           
Sbjct: 3   ALLPLSAHAAPSKADVEAQFESWVQKDLWPEAKAGGISEKTFQAAFSGITLNWNLPDLAP 62

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
                 +++K   +   S   Y +      + A G          L  ++K YGVP  I+
Sbjct: 63  PGFPPPKEQKQTQAEFSSPGPYFNEDHLKRLAATGRGFAAQYGSTLKRIEKTYGVPGSIV 122

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGA 191
           +A+WG ET FG        +  LAT A+   R + F  +   AL ++  G ++     G+
Sbjct: 123 LAIWGRETGFGAAKIPNSAVEVLATKAFMSTRKEMFRTELVAALHILDGGDVTPADFKGS 182

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
           + G +GQ QF+P + +KYA+D D DG  ++  S  D +AS A FL K GW +   +    
Sbjct: 183 SAGALGQPQFMPTSYLKYAVDFDGDGHRNIWTSVPDTLASIANFLVKKGWQRDRDWGFEV 242

Query: 252 KNFAILKHWNASLNYNKTIAYIA----AHIDGVPIGKGYDT 288
                +       +  K +++ A      I G    KG+ +
Sbjct: 243 SIPEAVSCAQEGPDLAKPLSHWASLGIERISG----KGFPS 279



 Score = 44.9 bits (104), Expect = 0.012,   Method: Composition-based stats.
 Identities = 9/28 (32%), Positives = 13/28 (46%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             NF ++K +N S  Y   I  +A  I 
Sbjct: 302 TPNFYVIKEYNNSDLYALYIGNLADRIA 329


>gi|285019884|ref|YP_003377595.1| membrane bound lytic murein transglycosylase b transmembrane
           protein [Xanthomonas albilineans GPE PC73]
 gi|283475102|emb|CBA17601.1| putative membrane bound lytic murein transglycosylase b
           transmembrane protein [Xanthomonas albilineans]
          Length = 462

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 119/270 (44%), Gaps = 3/270 (1%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           ++     +  ++  A+ Q   A +    +     F    +  R  A + G++        
Sbjct: 1   MLRFAWALLCVVPCAIAQTPSAASASASAVDPA-FATCVAGLRTAAGKNGVTAAAFDRFT 59

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A L+   + +               DYL GL  ++ I  G A+  A+  LL ++ ++YGV
Sbjct: 60  AGLQPDMSVLPLLDAQPE-FTTPIWDYLAGLVDTQRIDDGRAMLSAHRDLLAHVAQQYGV 118

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
               ++A+WG+E+ +G + GK PLL +L TLA + RR  FF  + F  L L++ G +   
Sbjct: 119 DAQTVVAVWGVESDYGRSTGKRPLLVSLLTLACNGRRQPFFRGELFALLKLLQAGDLKPE 178

Query: 188 A-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
              G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS A +L   GW     
Sbjct: 179 GLTGSWAGAFGHTQFMPSTYARIAVDGDGDGRRDLVASLPDALASTAHYLKLSGWQSGQP 238

Query: 247 YQPGEKNFAILKHWNASLNYNKTIAYIAAH 276
           +    K        +A     + +A   A 
Sbjct: 239 WGLEVKLPDGFDSAHAGRTQRRPLADWRAR 268



 Score = 46.4 bits (108), Expect = 0.005,   Method: Composition-based stats.
 Identities = 8/30 (26%), Positives = 17/30 (56%)

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           +N+  +  +NA+ +Y   IA ++  + G P
Sbjct: 304 RNYDAIYAYNAAESYALAIALLSDRLRGKP 333


>gi|114706685|ref|ZP_01439586.1| probable transglycolase [Fulvimarina pelagi HTCC2506]
 gi|114538077|gb|EAU41200.1| probable transglycolase [Fulvimarina pelagi HTCC2506]
          Length = 408

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 60/259 (23%), Positives = 97/259 (37%), Gaps = 25/259 (9%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKS-AARARAVREGMS 59
           M        SLL+++ P  A                     F  +        A   G+S
Sbjct: 1   MRLLPAFFASLLVLLVPAHA--------------DPSIDAGFRSFLQTEIWPEAEARGVS 46

Query: 60  PKTAKHLFADLEYLDTTIARDRK---------MVTSPPVSFKDYLDGLSSSEIIAQGIAL 110
                  F  +                        +   +  DYL   +    +  G  L
Sbjct: 47  RTVFDRAFQGVAPNLELPDLQLPGASETVEQINFQAEFKNGSDYLSKRALGTTVRTGREL 106

Query: 111 KKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTE 170
              ++ LL  +++ YGVP  I++A+WG E+ FG           L T A+  RR + F  
Sbjct: 107 LARHAALLERIEERYGVPAPIIIAIWGRESAFGNAAIPHNAFEVLGTKAWLSRRKQMFRT 166

Query: 171 QFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAI 229
           +   AL++ + G    +    +  G +GQ QF+P   ++YA+D D DGK D+  S  D +
Sbjct: 167 ELLAALEIAENGDRPVNVMRSSWAGALGQPQFMPSKFLQYAVDFDGDGKRDIWNSVPDTL 226

Query: 230 ASAAKFLAKLGWTKCAGYQ 248
           AS A +L + GW     + 
Sbjct: 227 ASIANYLKEHGWQTGRDWG 245



 Score = 45.2 bits (105), Expect = 0.011,   Method: Composition-based stats.
 Identities = 9/31 (29%), Positives = 14/31 (45%)

Query: 250 GEKNFAILKHWNASLNYNKTIAYIAAHIDGV 280
              NF +LK +N S  Y   + + A  + G 
Sbjct: 307 ATPNFYVLKAYNNSDLYALFVGHAADRMLGS 337


>gi|296444538|ref|ZP_06886502.1| lytic murein transglycosylase [Methylosinus trichosporium OB3b]
 gi|296257806|gb|EFH04869.1| lytic murein transglycosylase [Methylosinus trichosporium OB3b]
          Length = 392

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 74/322 (22%), Positives = 124/322 (38%), Gaps = 59/322 (18%)

Query: 21  QAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
            +      A      +     F    +  R  A   G+S +T +   A LE  D   +  
Sbjct: 4   TSRLLTTLAAALLCAAPARADFASCLAGLRHAAAAAGVSARTIESATAGLEPND-APSFM 62

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
            K          DYL GL   E + +G AL + +   L   ++ YGV P  ++A+WG+E+
Sbjct: 63  DKQPE-FKTPIWDYLAGLVDDERVEEGRALMRQHGAALQAAEQRYGVDPATVVAVWGVES 121

Query: 141 HFGETMGKTPLLSTLATLAYDCRRA-KFFTEQFFYALDLVKKGVISS-HALGATFGEIGQ 198
            FG+  GK  ++ +LATLA + RR   +F  +   AL ++  G I+     G+  G  G 
Sbjct: 122 DFGKNFGKRSVVQSLATLACEARRRNDYFRGELIAALKILDSGDIAPQEFYGSWAGAFGH 181

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ---------- 248
            QF+P   ++ A+D D DG+ ++  S  D++ S A +L K G+     +           
Sbjct: 182 TQFMPSTFLRTAVDLDGDGRRNIASSAADSLGSTANYLHKSGYRPGLRWGFEVRLPDNYS 241

Query: 249 ------------------------------------PGEKN---------FAILKHWNAS 263
                                               P   N         F  +  +NA+
Sbjct: 242 GPSGRTARQPMSAWASRGVSRLDGEPLGDGSAALLLPAGPNGPAFLVTRNFDAIYSYNAA 301

Query: 264 LNYNKTIAYIAAHIDGVPIGKG 285
            +Y   I+ ++  + G P  +G
Sbjct: 302 ESYALAISILSDRLRGRPGVQG 323


>gi|239830868|ref|ZP_04679197.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
 gi|239823135|gb|EEQ94703.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
          Length = 440

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 76/311 (24%), Positives = 126/311 (40%), Gaps = 38/311 (12%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKS-AARARAVREGMSP 60
           ++K  L I L ++    ++ A+  P KA  +        ++  W        A   G+S 
Sbjct: 26  NWKHSLKIGLALVASLAISPAIAAPSKAQVEN-------QYRSWLEKDLWPEAKAAGVSR 78

Query: 61  KTAKHLFADLEYLDTTIARDRK---------MVTSPPVSFKDYLDGLSSSEIIAQGIALK 111
                 F  +                        +   +   Y +  + S + + G A  
Sbjct: 79  AVFDQAFTGVSINWKLPDLVIPGEKPSTPKEQKQAEFGAPGKYFNARTMSAVTSGGQARY 138

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQ 171
              + LL  ++++YGVP  IL+A+WG E+ FG           L T A+   R   F ++
Sbjct: 139 GQYASLLKRIEQKYGVPGPILLAVWGRESGFGTVKIPYNAYEVLGTKAFMATRKDMFRKE 198

Query: 172 FFYALDLVKKGVISSHALGA-TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
              AL++  +G I   A+ +   G +GQ QF+P + +K+A+D D DGK D+  S  D +A
Sbjct: 199 LIAALEIASRGYIDESAMKSSWAGALGQPQFMPTSYLKHAVDFDGDGKRDIWNSVPDTLA 258

Query: 231 SAAKFLAKLGWTKCAGYQPGEKNFAILKHWNAS-----LNYNKTIAYIAA----HIDGVP 281
           S A +L   GW K   +      F +    N S      +  KTIA  A      ++G P
Sbjct: 259 SIANYLKLHGWQKGRDWG-----FEVSVPQNVSCSLEGPDQGKTIAEWAKLGITRVNGKP 313

Query: 282 I------GKGY 286
                  G+G+
Sbjct: 314 FPANEMKGEGF 324



 Score = 39.1 bits (89), Expect = 0.81,   Method: Composition-based stats.
 Identities = 9/28 (32%), Positives = 13/28 (46%)

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
             NF +LK +N S  Y   I ++   I 
Sbjct: 339 SPNFYVLKDYNMSDLYALFIGHVGDRIA 366


>gi|219870866|ref|YP_002475241.1| membrane-bound lytic murein transglycosylase B [Haemophilus
           parasuis SH0165]
 gi|219691070|gb|ACL32293.1| membrane-bound lytic murein transglycosylase B [Haemophilus
           parasuis SH0165]
          Length = 359

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 74/269 (27%), Positives = 125/269 (46%), Gaps = 15/269 (5%)

Query: 3   FKKYLLISLLMMVYPMLAQAVT--QPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
            K YL IS+  +V    A +           ++  + +   F ++ S  + +A  EG+S 
Sbjct: 1   MKSYLTISMACLVLAGCANSEQEYPKVALEAKYPNTRSLIHFDDYVSFLKKKAANEGVSA 60

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSF-----------KDYLDGLSSSEIIAQGIA 109
           +     F +++Y+   +  D++                     +YL+   +   +     
Sbjct: 61  EVLNTTF-NIQYVPRAVELDQQQANRRRDPNLPPPQPNPNGVTNYLNKTLTQAKVDTAAQ 119

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
                   L    ++YGV    LMALWG+E+ FG   G   +LS LATLA+D RR K FT
Sbjct: 120 RWWQYQPQLTKASQKYGVQKEYLMALWGMESSFGRYQGNFDVLSVLATLAFDGRREKLFT 179

Query: 170 EQFFYALDLVKKGV-ISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++F  A+ ++++G  + +   G+  G +GQ QF+P + + YA D D DG+ D+ K+  DA
Sbjct: 180 QEFVNAMKMLQQGTLVRAEMKGSWAGAMGQTQFMPTSYLNYAADGDNDGRKDIWKNQYDA 239

Query: 229 IASAAKFLAKLGWTKCAGYQPGEKNFAIL 257
            AS A +LA +GW K   +    K    +
Sbjct: 240 FASIANYLATVGWDKHLPWGVEVKLAQPI 268


>gi|302806872|ref|XP_002985167.1| hypothetical protein SELMODRAFT_424300 [Selaginella moellendorffii]
 gi|300146995|gb|EFJ13661.1| hypothetical protein SELMODRAFT_424300 [Selaginella moellendorffii]
          Length = 450

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 110/223 (49%), Gaps = 7/223 (3%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           S        W    +  A++ G+   T    F  ++     + +D+       ++ +DY+
Sbjct: 133 STPESDISAWLEDLKEEAIQRGVGKDTVLEAFDGVKISPKIMEKDQTQPEK-TLTAEDYI 191

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             + S   +++G+     N  LL  +  EYGVP  +L+++WG+E+++G   G   ++  L
Sbjct: 192 KTMVSQSRVSRGVQAFVDNKALLEEISAEYGVPASLLVSIWGIESNYGSYTGSWNVIQAL 251

Query: 156 ATLAYDC---RRAKFFTEQFFYALDLVKKGVISSHA---LGATFGEIGQFQFLPVNVVKY 209
            TLA+D    RR  FF ++ F+AL ++ K    S+A    G+  G +GQ QF+P +   Y
Sbjct: 252 VTLAFDSPEARRRAFFRDEVFHALFILDKAEGPSNAAGLKGSWAGAMGQCQFMPSSFRNY 311

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
           A+D D DG+ D+  S  D  AS A +LA+ GW     Y    K
Sbjct: 312 AVDFDRDGRKDIWSSKADIFASIANYLAEHGWEIGGKYAQKVK 354



 Score = 38.7 bits (88), Expect = 1.0,   Method: Composition-based stats.
 Identities = 7/25 (28%), Positives = 14/25 (56%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHI 277
           NF ++  +N S+ Y+  +  +A  I
Sbjct: 413 NFRVVMRYNISILYSLAVYELAEEI 437


>gi|16263566|ref|NP_436359.1| Transglycosylase [Sinorhizobium meliloti 1021]
 gi|14524270|gb|AAK65771.1| Transglycosylase [Sinorhizobium meliloti 1021]
          Length = 265

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 93/267 (34%), Positives = 133/267 (49%), Gaps = 10/267 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++    + A            C  +A  F +WK      A   G+  K         +Y 
Sbjct: 9   LIAAAGSLAFCLLTCVAEAASCGKSAAGFQQWKVEFAETAKAAGVRGKGL-AALLGAKYA 67

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             TI  DR +  +   S  D++     S II++G +LK AN+ L  N++++Y VP G+L+
Sbjct: 68  VGTIRADRSVNKAFSGSVDDFMRRRGGSAIISKGRSLKTANAALFGNIERKYDVPAGVLL 127

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF 193
           A+WG+ET FG +MG    +S + TLAYDCRR +FF      AL LV  GV+S+ ++GA  
Sbjct: 128 AIWGMETGFGASMGNQNTVSAIVTLAYDCRRPQFFAPHAIAALKLVDSGVLSARSVGAMH 187

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GEIGQ  FLP NV+KY + +        ++    A+ S A FL   GW    GYQ    N
Sbjct: 188 GEIGQTGFLPGNVLKYGVGSRN------MRDTSTALMSTANFLKAHGWRAGGGYQ---GN 238

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDGV 280
              +  WN++  Y K IA I   IDG 
Sbjct: 239 MGAIAGWNSASVYQKAIARIGEAIDGR 265


>gi|302772825|ref|XP_002969830.1| hypothetical protein SELMODRAFT_410831 [Selaginella moellendorffii]
 gi|300162341|gb|EFJ28954.1| hypothetical protein SELMODRAFT_410831 [Selaginella moellendorffii]
          Length = 1366

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 110/223 (49%), Gaps = 7/223 (3%)

Query: 36   SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
            S        W    +  A++ G+   T    F  ++     + +D+       ++ +DY+
Sbjct: 1049 STPESDISAWLEDLKEEAIQRGVGKDTVLEAFDGVKISPKIMEKDQTQPEK-TLTAEDYI 1107

Query: 96   DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
              + S   +++G+     N  LL  +  EYGVP  +L+++WG+E+++G   G   ++  L
Sbjct: 1108 KTMVSQSRVSRGVQAFVDNKALLEEISAEYGVPASLLVSIWGIESNYGSYTGSWNVIQAL 1167

Query: 156  ATLAYDC---RRAKFFTEQFFYALDLVKKGVISSHA---LGATFGEIGQFQFLPVNVVKY 209
             TLA+D    RR  FF ++ F+AL ++ K    S+A    G+  G +GQ QF+P +   Y
Sbjct: 1168 VTLAFDSPEARRRAFFRDEVFHALFILDKAEGPSNAAGLKGSWAGAMGQCQFMPSSFRNY 1227

Query: 210  AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            A+D D DG+ D+  S  D  AS A +LA+ GW     Y    K
Sbjct: 1228 AVDFDRDGRKDIWSSKADIFASIANYLAEHGWEIGGKYAQKVK 1270



 Score = 38.7 bits (88), Expect = 1.0,   Method: Composition-based stats.
 Identities = 7/25 (28%), Positives = 14/25 (56%)

Query: 253  NFAILKHWNASLNYNKTIAYIAAHI 277
            NF ++  +N S+ Y+  +  +A  I
Sbjct: 1329 NFRVVMRYNISILYSLAVYELAEEI 1353


>gi|293604157|ref|ZP_06686565.1| type III effector HopAJ2 [Achromobacter piechaudii ATCC 43553]
 gi|292817382|gb|EFF76455.1| type III effector HopAJ2 [Achromobacter piechaudii ATCC 43553]
          Length = 411

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 79/304 (25%), Positives = 119/304 (39%), Gaps = 61/304 (20%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
             S  RA A + G+S  T     A L      I               DY+ GL   E +
Sbjct: 40  CLSQLRAPAQKAGVSAATFDTYTAGLAPDMAVIDLLDAQPE-FKTPIWDYMAGLVDDERV 98

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
             G A        L      Y V P  + A+WG+E++FG T+G  PLL++L+TL+   RR
Sbjct: 99  TDGQAGMARWQAELARAASRYRVDPATIAAVWGVESNFGRTLGGRPLLTSLSTLSCFGRR 158

Query: 165 AKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             +F  +FF  L +++   I     +G+  G  GQ QF+P   ++ A+D D DG+ DL+ 
Sbjct: 159 QAYFRGEFFATLKIIQDEHIDPQRLVGSWAGAFGQTQFMPSTYLRLAVDFDGDGRRDLID 218

Query: 224 SNIDAIASAAKFLAKLGWTKCAGY-------------QPGEKNFA--------------- 255
           S  DA+AS A FLA+ GW     +               G KN                 
Sbjct: 219 SVPDALASTANFLARAGWNPQLAWGYEVRLPAALDTSGAGRKNKRPLSAWARQGVTRADG 278

Query: 256 ------------------------------ILKHWNASLNYNKTIAYIAAHIDGV-PIGK 284
                                          L  +NA+ +Y   IA+++  + G  P+ +
Sbjct: 279 QALPAGDTPVGLLLPAGRKGPAFLVTRNFDALYSYNAAESYALAIAHLSDRLRGAGPLIQ 338

Query: 285 GYDT 288
            + T
Sbjct: 339 PWPT 342


>gi|307313744|ref|ZP_07593362.1| transglycosylase [Sinorhizobium meliloti BL225C]
 gi|306899234|gb|EFN29871.1| transglycosylase [Sinorhizobium meliloti BL225C]
          Length = 265

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 92/267 (34%), Positives = 133/267 (49%), Gaps = 10/267 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYL 73
           ++    + A            C  +A  F +WK      A   G+  K         +Y 
Sbjct: 9   LIAAAGSLAFCLLTCVAEAASCGKSAAGFQQWKVEFAETAKAAGVRGKGL-AALLGAKYA 67

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
             TI  DR +  +   S  D++     S II++G +LK AN+ L  N++++Y VP G+L+
Sbjct: 68  VGTIRADRSVNKAFSGSVDDFMRRRGGSAIISKGRSLKTANAALFGNIERKYDVPAGVLL 127

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF 193
           A+WG+ET FG +MG    +S + TLAYDCRR +FF      AL LV  GV+S+ ++GA  
Sbjct: 128 AIWGMETGFGASMGNQNTVSAIVTLAYDCRRPQFFAPHAIAALKLVDSGVLSARSVGAMH 187

Query: 194 GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKN 253
           GEIGQ  FLP NV+KY + +        ++    A+ S A FL   GW    GYQ    N
Sbjct: 188 GEIGQTGFLPGNVLKYGVGSRN------MRDTSTALMSTANFLKAHGWRAGGGYQ---GN 238

Query: 254 FAILKHWNASLNYNKTIAYIAAHIDGV 280
              +  WN++  Y + IA I   IDG 
Sbjct: 239 MGAIAGWNSASVYQQAIARIGEAIDGR 265


>gi|58038512|ref|YP_190476.1| membrane-bound lytic murein transglycosylase [Gluconobacter oxydans
           621H]
 gi|58000926|gb|AAW59820.1| Membrane-bound lytic murein transglycosylase [Gluconobacter oxydans
           621H]
          Length = 331

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/285 (24%), Positives = 123/285 (43%), Gaps = 15/285 (5%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M  +++LL +L  +         +   +A  Q         +G +  + RA+A+ +G+S 
Sbjct: 1   MLQRRHLLAALTSVAGSAAVGISSANAQARVQ--------SYGAFLESVRAQALAQGLSS 52

Query: 61  KTAKHLFA-DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
                  +   +   + +  DR       +++  Y D +      A+G ++  A   ++ 
Sbjct: 53  SIVSQALSLTTQPNASVLKLDRHQPE-FTLTWAQYRDRVLPESRFAKGRSVYAAQQSVMS 111

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
            +   +G     +M +WGLE+ FG   G   ++  LATLA+D RR+ FF  +   AL ++
Sbjct: 112 PVSARFGCDDRAVMGIWGLESGFGAHDGTYSVIDALATLAFDGRRSAFFRNELMKALQIL 171

Query: 180 KKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
             G I+    +G+  G +GQ QF+P   ++YA D D DGK ++  S  D  AS A +L K
Sbjct: 172 NDGDIAPAAMIGSYAGAMGQAQFMPSAYLRYAADGDGDGKRNIWTSEADVFASIANYLGK 231

Query: 239 LGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI----AAHIDG 279
            GW     +        +L          +T+          +DG
Sbjct: 232 CGWQVNEPWGQEVTLTKVLDKAEIGRTRQRTLGEWMALGVRRVDG 276


>gi|182679997|ref|YP_001834143.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635880|gb|ACB96654.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 422

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/334 (19%), Positives = 123/334 (36%), Gaps = 58/334 (17%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
           +L+  +  ++  + + ++     ++T      +   F  + +     A + G+  +T   
Sbjct: 19  FLMGFVGGLIASLCSLSLHAEGVSSTPLA---SRSSFASFLAGLWPEAQKAGIKRQTFDS 75

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
            F  L Y                   + Y    +S     +G  L+K  +  L  L++ Y
Sbjct: 76  AFDGLTYDPAPARAAMAQPE-FDRPLRLYFAQAASPPRRDRGQVLRKQFNPELTALEQRY 134

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI- 184
           GVP  I++A WG+E+ +G   G   ++ +LA+LA+       + ++   AL ++  G + 
Sbjct: 135 GVPAEIIVAAWGMESDYGRLRGDNDIIRSLASLAFALPERPLYRQELLAALVILDSGQVK 194

Query: 185 SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
            +   G+  G +G  QFLP   + Y I  D     DL     D++AS A FLA+ GW   
Sbjct: 195 RNDMRGSWAGAMGDPQFLPSAYLTYGIGFDGKPFPDLWHKAADSLASIASFLARSGWKPG 254

Query: 245 AGYQPGEK---------------------------------------------------- 252
             +    +                                                    
Sbjct: 255 LPWGLEVRLPQNADLSSLHRDFSTWTKLGVDAASNGTLPVKGEATLFLPAGRQGPAFLLS 314

Query: 253 -NFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
            N+ +LK +N S  Y  ++A++A  I G    +G
Sbjct: 315 DNYWVLKLYNNSDAYALSLAWLAQEIKGEGGLRG 348


>gi|307319728|ref|ZP_07599153.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|306894659|gb|EFN25420.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
          Length = 405

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 83/336 (24%), Positives = 126/336 (37%), Gaps = 62/336 (18%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTA 63
           +K LL    + +    A A    +       C      F       +A AV +G+    A
Sbjct: 6   RKALLSLGFLAIAGAPALAQAPAQPGNPAAACGGDLGSF---LEGVKAEAVAKGIPADVA 62

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
               A        ++RDR        +F ++     S   +  G    +  + +    ++
Sbjct: 63  DRALAGAAIDQKVLSRDRAQG-VFKQTFTEFSKRTVSKSRLDIGAQKMREYADVFARAEQ 121

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
           E+GVP  ++ A W +ET FG   G       L TLA+DCRR + F  Q   A+++V+ G 
Sbjct: 122 EFGVPAPVITAFWAMETDFGAVQGDFNTRDALVTLAHDCRRPEMFRPQLLAAIEMVQHGD 181

Query: 184 ISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           +      GA  GEIGQ Q LP +++ Y +D D DG ++L KS+ DAI +AAKF+  LG+ 
Sbjct: 182 LDPAATTGAWAGEIGQVQMLPEDIIAYGVDGDGDGHVNLKKSSPDAILTAAKFIHSLGFK 241

Query: 243 KCAGY-----------------QPG---EKNF---------------------------- 254
               +                 QPG      F                            
Sbjct: 242 PGEPWIQEVRVPEQLPWEKTGLQPGMTAGDWFALGVAPRDGNTSNSGLEASLVLPQGRKG 301

Query: 255 AILKHW---------NASLNYNKTIAYIAAHIDGVP 281
           A    +         N S  Y  + AY A  + G P
Sbjct: 302 AAFLTYPNFKIYLEWNQSFIYTTSAAYFATRLAGAP 337


>gi|121602067|ref|YP_988653.1| putative membrane-bound lytic murein transglycosylase [Bartonella
           bacilliformis KC583]
 gi|120614244|gb|ABM44845.1| putative membrane-bound lytic murein transglycosylase [Bartonella
           bacilliformis KC583]
          Length = 418

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 68/327 (20%), Positives = 117/327 (35%), Gaps = 64/327 (19%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE-Y 72
            +    A  V       +    +D+   F  W    +  A+   +S  T    F  ++  
Sbjct: 20  PLIIGFAFVVFTSLMLFSSHTHADS--GFKIWIQEFKKTALANNISSATFDMAFETVQAI 77

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
               + R          S  +Y D       I  G    K     L  ++K +GV   I+
Sbjct: 78  DPEVLERAAYQPE-FVDSSWNYFDNRIHDIAIVGGRNHAKKWKTWLDKIEKRFGVNSHII 136

Query: 133 MALWGLETHFGETMGKTPLLS----TLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSH 187
           +A+W +E+++G+ +    ++     +LATLAY D +R K+   Q   A+ +++ G I   
Sbjct: 137 LAIWSMESNYGKALENKRMMRDAIRSLATLAYADKKREKYARTQLIAAMKILQSGAIHRS 196

Query: 188 A-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
              G+  G +G  QF+P + + YA+D D +G  D+  S  DA+A+AA  L   GW     
Sbjct: 197 QLTGSWAGALGHTQFIPSSYLAYAVDMDGNGHCDIWTSIPDALATAANLLHMNGWQPGLH 256

Query: 247 Y------------------------------------------------QPGEKNFAI-- 256
           +                                                 P    F +  
Sbjct: 257 WGFEVKLPHGKQLPDDKLSFAQWTKLGVQNANGKPFPSPSEYATLKLPDGPEGPAFLVTK 316

Query: 257 ----LKHWNASLNYNKTIAYIAAHIDG 279
               LK +N +  Y   ++ +A  I G
Sbjct: 317 NFFVLKRYNNADRYAFAVSLLANRIAG 343


>gi|311104883|ref|YP_003977736.1| lytic murein transglycosylase family protein [Achromobacter
           xylosoxidans A8]
 gi|310759572|gb|ADP15021.1| lytic murein transglycosylase family protein [Achromobacter
           xylosoxidans A8]
          Length = 415

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 82/331 (24%), Positives = 129/331 (38%), Gaps = 61/331 (18%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
            L+ A+      +     +  AD F    +  R  A++ G+S  T     A L    T +
Sbjct: 17  ALSCALAGSAFISLVAPTAYAADAFAACLAQLRGPALKAGVSGATFDTQTAGLAPDMTVL 76

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
                          DY+  L   E +A G A        L      YGV P  + A+WG
Sbjct: 77  DLLDAQPE-FKTPIWDYMAALVDDERVADGQAGMARWQSDLERAASRYGVDPATIAAVWG 135

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEI 196
           +E+++G T+G  PLL++L+TL+   RR  +F  +FF  L +++   I+     G+  G  
Sbjct: 136 VESNYGRTLGGRPLLTSLSTLSCFGRRQAYFRGEFFATLKIIQDEHIAPERLTGSWAGAF 195

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY--------- 247
           GQ QF+P   ++ A+D D DG+ DLV S  DA+AS A FL + GW     +         
Sbjct: 196 GQTQFMPSTYLRLAVDFDGDGRRDLVDSVPDALASTANFLKRAGWNSALHWGYEVRLPAG 255

Query: 248 ----QPGEKNFA---------------------------------------------ILK 258
                 G KN                                                L 
Sbjct: 256 LDTSGAGRKNKRAMSYWAGRGVTRADGQPLPAGDTPAGLLLPAGRGGPAFLVTRNFDALY 315

Query: 259 HWNASLNYNKTIAYIAAHID-GVPIGKGYDT 288
            +NA+ +Y   IA+++  +  G P+ + + T
Sbjct: 316 SYNAAESYALAIAHLSDRLRGGGPLAQAWPT 346


>gi|153009055|ref|YP_001370270.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
 gi|151560943|gb|ABS14441.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
          Length = 412

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 80/348 (22%), Positives = 123/348 (35%), Gaps = 66/348 (18%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA-------TTQFICSDTADRFGEWKSAARARA 53
           M F   ++ + L+    M