RPSBLAST alignment for GI: 254780308 and conserved domain: TIGR02282

>gnl|CDD|162795 TIGR02282, MltB, lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by Pfam model pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. Length = 290
 Score =  114 bits (288), Expect = 2e-26
 Identities = 63/188 (33%), Positives = 95/188 (50%), Gaps = 19/188 (10%)

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFK---DYLDGLSSSEIIAQGIALKKANSRLLINLK 122
           + A  +Y D  I    +++ +P  S K   +Y     + + I  G+   K +   L   +
Sbjct: 21  ILAQAKYNDEVI----RLIDNPAESAKPWLEYRGIFITPKRIQDGVEFWKQHEDALNRAE 76

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFFTEQFFYALDLVK- 180
           + YGVPP I++A+ G+ET++G  MGK  +L  L TLA+D  RRA FF  +    L L + 
Sbjct: 77  QRYGVPPEIIVAIIGVETNYGRNMGKYRVLDALTTLAFDYPRRATFFRGELGQFLLLARE 136

Query: 181 -----KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKF 235
                  +  S+A     G +G  QF+P +  +YA+D D DG IDL  S  DAI S A +
Sbjct: 137 EQLDPLTLKGSYA-----GAMGYPQFMPSSYRQYAVDFDGDGHIDLWNSPDDAIGSVANY 191

Query: 236 LAKLGWTK 243
               GW +
Sbjct: 192 FHAHGWVR 199