RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780308|ref|YP_003064721.1| putative membrane-bound lytic murein transglycosylase signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] (288 letters) >gnl|CDD|32773 COG2951, MltB, Membrane-bound lytic murein transglycosylase B [Cell envelope biogenesis, outer membrane]. Length = 343 Score = 174 bits (442), Expect = 3e-44 Identities = 78/243 (32%), Positives = 111/243 (45%), Gaps = 5/243 (2%) Query: 10 SLLMMVYPMLAQAVTQPKKATTQFI--CSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67 + + +LA A T + F W A G+S F Sbjct: 7 RPALALALLLAAAGTAALAPVLAGAAAAAAAGFAFNAWLQGFAPEAAAAGISAAVLDAAF 66 Query: 68 ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127 A + Y IARDR ++ S + QG + L ++ YGV Sbjct: 67 AGVSYDPRVIARDRP-QPEFRQPVAEFSARRISEARVQQGRGFPAQYAAALARAERRYGV 125 Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAY-DCRRAKFFTEQFFYALDLVKKG-VIS 185 P IL+A+WG+ET FG MGK +L LATLA+ D RRA FF ++ AL +++ G V Sbjct: 126 PAPILVAIWGMETGFGRVMGKFRVLDALATLAFADPRRAGFFRDELIAALKIIQDGDVDP 185 Query: 186 SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245 G+ G +GQ QF+P + +KYA+D D DG D+ S DA+ASAA +L GW + Sbjct: 186 LALKGSWAGAMGQTQFMPSSYLKYAVDGDGDGHRDIWNSVPDALASAANYLKSHGWDRGR 245 Query: 246 GYQ 248 + Sbjct: 246 PWG 248 Score = 33.8 bits (77), Expect = 0.051 Identities = 11/36 (30%), Positives = 15/36 (41%) Query: 246 GYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281 G NF ++ +N S Y I +A I G P Sbjct: 304 PAFLGLPNFYVILRYNRSDVYALAIGLLADRIAGAP 339 >gnl|CDD|145150 pfam01832, Glucosaminidase, Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyse peptidoglycan. Length = 136 Score = 32.3 bits (74), Expect = 0.16 Identities = 11/25 (44%), Positives = 17/25 (68%) Query: 119 INLKKEYGVPPGILMALWGLETHFG 143 L K+YG+PP +L+A LE+ +G Sbjct: 6 QKLAKKYGIPPSLLLAQAALESGWG 30 >gnl|CDD|34572 COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion]. Length = 309 Score = 28.7 bits (64), Expect = 1.8 Identities = 20/113 (17%), Positives = 38/113 (33%), Gaps = 18/113 (15%) Query: 97 GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156 LS+ + + + + + L ++L + + G +A+ + LL L Sbjct: 57 RLSAQDSLKRLDRKQPRQAGLRVSLARLILLSAGAGLAVALVAWLGL------SLLVALV 110 Query: 157 TLAYDC------------RRAKFFTEQFFYALDLVKKGVISSHALGATFGEIG 197 L RR K F +Q ALDL+ + + + L Sbjct: 111 ALIGAALLPRLVLRSRRARRLKRFGQQLPEALDLIVRALRAGAPLPDALRLAA 163 >gnl|CDD|31891 COG1705, FlgJ, Muramidase (flagellum-specific) [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 201 Score = 27.7 bits (61), Expect = 4.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTP 150 L +EYG+ P I +A LE+ +G++ + Sbjct: 57 LAQEYGILPSITIAQAILESGWGKSELASK 86 >gnl|CDD|48207 cd03421, SirA_like_N, SirA_like_N, a protein of unknown function with an N-terminal SirA-like domain. The SirA, YedF, YeeD protein family is present in bacteria as well as archaea. SirA (also known as UvrY, and YhhP) belongs to a family of a two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA. A variety of microorganisms have similar proteins, all of which contain a common CPxP sequence motif in the N-terminal region. YhhP is suggested to be important for normal cell division and growth in rich nutrient medium. Moreover, despite a low primary sequence similarity, the YccP structure closely resembles the non-homologous C-terminal RNA-binding domain of E. coli translation initiation factor IF3. The signature CPxP motif serves to stabilize the N-terminal helix as part of the N-capping box and might be important in mRNA-binding.. Length = 67 Score = 27.5 bits (61), Expect = 4.7 Identities = 12/49 (24%), Positives = 24/49 (48%) Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251 PV K A++ + G+I+++ N A + ++F G+ + GE Sbjct: 12 PVIKTKKALELEAGGEIEVLVDNEVAKENVSRFAESRGYEVSVEEKGGE 60 >gnl|CDD|38051 KOG2840, KOG2840, KOG2840, Uncharacterized conserved protein with similarity to predicted ATPase of the PP-loop superfamily [General function prediction only]. Length = 347 Score = 26.8 bits (59), Expect = 6.9 Identities = 17/102 (16%), Positives = 35/102 (34%), Gaps = 3/102 (2%) Query: 75 TTIARDRKMVTSPP--VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132 + R+ P VS+KD + EI+++ + N +++ + Sbjct: 102 EAVKRNGVQYGLPLCIVSYKDLYGEWTMDEIVSEIGQEIRNNCTFCGVFRRQALDRGADV 161 Query: 133 MALWGLET-HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173 + L T H + +T L++ L + R T Sbjct: 162 LGAAELVTGHNADDWAETVLMNLLRGDSARLERLTEITTPSL 203 >gnl|CDD|110528 pfam01531, Glyco_transf_11, Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes. Length = 298 Score = 26.4 bits (58), Expect = 8.8 Identities = 12/40 (30%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Query: 54 VREG----MSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89 +R G + PK K + AD+ YL + R +SP Sbjct: 170 IRRGDYVDVMPKVWKGVVADINYLIQALDWFRARYSSPVF 209 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.135 0.399 Gapped Lambda K H 0.267 0.0733 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,428,526 Number of extensions: 174918 Number of successful extensions: 436 Number of sequences better than 10.0: 1 Number of HSP's gapped: 434 Number of HSP's successfully gapped: 11 Length of query: 288 Length of database: 6,263,737 Length adjustment: 93 Effective length of query: 195 Effective length of database: 4,254,100 Effective search space: 829549500 Effective search space used: 829549500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 57 (25.7 bits)