RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780308|ref|YP_003064721.1| putative membrane-bound lytic
murein transglycosylase signal peptide protein [Candidatus
Liberibacter asiaticus str. psy62]
         (288 letters)



>1qus_A Lytic murein transglycosylase B; alpha-helical protein with AN
           five-stranded antiparallel beta-sheet, hydrolase; HET:
           BCN; 1.70A {Escherichia coli} SCOP: d.2.1.6 PDB: 1d0k_A*
           1d0m_A* 1qdr_A* 1qdt_A 1d0l_A* 1qut_A* 1ltm_A*
          Length = 322

 Score =  150 bits (379), Expect = 4e-37
 Identities = 57/233 (24%), Positives = 100/233 (42%), Gaps = 13/233 (5%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--------SFKDYLDGLSSSEII 104
             + G   +  + + +  + LD+ +        +  V        ++  Y     + + +
Sbjct: 29  VNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSVKPPSGPNGAWLRYRKKFITPDNV 88

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CR 163
             G+         L    + YGVPP I++ + G+ET +G  MGKT +L  LATL+++  R
Sbjct: 89  QNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPR 148

Query: 164 RAKFFTEQFFYAL-DLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           RA++F+ +    L     +     +  G+  G +G  QF+P +  +YA+D   DG I+L 
Sbjct: 149 RAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINL- 207

Query: 223 KSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
              +DAI S A +    GW K  G Q                    +I+ +AA
Sbjct: 208 WDPVDAIGSVANYFKAHGWVK--GDQVAVMANGQAPGLPNGFKTKYSISQLAA 258


>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 61.5 bits (149), Expect = 2e-10
 Identities = 71/378 (18%), Positives = 104/378 (27%), Gaps = 194/378 (51%)

Query: 6   YLL---ISLLMMVYPM-----LAQ-AVT------QPK------KATT---QFIC------ 35
           YLL   IS      P+     LA   VT       P       K  T   Q +       
Sbjct: 230 YLLSIPISC-----PLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHSQGLVTAVAIA 284

Query: 36  -SDTADRFGEWKSAARARAVREGMSPKTAKHLF-----ADLEYLDTTIARDRKMVTSPPV 89
            +D+ + F     + R +A+           LF         Y +T++         PP 
Sbjct: 285 ETDSWESFFV---SVR-KAITV---------LFFIGVRCYEAYPNTSL---------PPS 322

Query: 90  SFKDYLD-------------GLSSSEIIAQGIALKKANSRL---------LINLKKEYGV 127
             +D L+              L+  ++      + K NS L         L+N  K   V
Sbjct: 323 ILEDSLENNEGVPSPMLSISNLTQEQVQDY---VNKTNSHLPAGKQVEISLVNGAKNLVV 379

Query: 128 --PPGILMALWGLETHF-------GETMGKTPLLSTLATLAYDCRRAKFFTEQF------ 172
             PP    +L+GL           G    + P         +  R+ KF   +F      
Sbjct: 380 SGPP---QSLYGLNLTLRKAKAPSGLDQSRIP---------FSERKLKFSN-RFLPVASP 426

Query: 173 F---YAL---------DLVKKGV-ISSHALGATFGEIGQFQFLPVNVVKYAIDAD-EDGK 218
           F     L         DLVK  V  ++  +            +PV    Y    D  DG 
Sbjct: 427 FHSHL-LVPASDLINKDLVKNNVSFNAKDIQ-----------IPV----Y----DTFDGS 466

Query: 219 IDL--VKSNI-----DAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
            DL  +  +I     D I                              W  +  +  T  
Sbjct: 467 -DLRVLSGSISERIVDCIIRLP----------V--------------KWETTTQFKAT-- 499

Query: 272 YIAAHI-D----GVP-IG 283
               HI D    G   +G
Sbjct: 500 ----HILDFGPGGASGLG 513



 Score = 39.2 bits (91), Expect = 0.001
 Identities = 47/243 (19%), Positives = 80/243 (32%), Gaps = 91/243 (37%)

Query: 65  H-LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
           H L A L   + T     K +       K+Y+        +A+    KK+NS L   + +
Sbjct: 102 HALAAKLLQENDTTLVKTKEL------IKNYITARI----MAKRPFDKKSNSALFRAVGE 151

Query: 124 EYGVPPGILMALWG----LETHFGE--TMGKT--PLLSTL-----ATLAYDCRRA----K 166
                   L+A++G     + +F E   + +T   L+  L      TL+   R      K
Sbjct: 152 G----NAQLVAIFGGQGNTDDYFEELRDLYQTYHVLVGDLIKFSAETLSELIRTTLDAEK 207

Query: 167 FFTEQFFYALDLVK--KG----------------------------VISSHALGATFGEI 196
            FT+     L++++  +                             V+++  LG T GE+
Sbjct: 208 VFTQG----LNILEWLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGEL 263

Query: 197 --------GQFQFLPVNVVKYAI---DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245
                   G  Q L   V   AI   D+ E        S   ++  A   L    +    
Sbjct: 264 RSYLKGATGHSQGL---VTAVAIAETDSWE--------SFFVSVRKAITVLF---FIGVR 309

Query: 246 GYQ 248
            Y+
Sbjct: 310 CYE 312


>3fi7_A LMO1076 protein; listeria monocytogenes, autolysin, N
           acetylglucosaminidase, peptidoglycan hydrolase,
           autoinhibition, GH73; 2.35A {Undefined}
          Length = 183

 Score = 31.3 bits (70), Expect = 0.25
 Identities = 8/28 (28%), Positives = 19/28 (67%)

Query: 119 INLKKEYGVPPGILMALWGLETHFGETM 146
           ++L K+Y + P +++A   LE+++G + 
Sbjct: 42  MDLCKKYNLYPSVMIAQAALESNWGRSE 69


>2zyc_A Peptidoglycan hydrolase FLGJ; 1.74A {Sphingomonas SP}
          Length = 170

 Score = 30.5 bits (68), Expect = 0.48
 Identities = 9/23 (39%), Positives = 14/23 (60%)

Query: 123 KEYGVPPGILMALWGLETHFGET 145
           +  GVP   L+A   LET +G++
Sbjct: 18  QSLGVPAHFLVAQAALETGWGKS 40


>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping,
           EF-hand, allergen; 1.75A {Chenopodium album} SCOP:
           a.39.1.10 PDB: 1h4b_A
          Length = 86

 Score = 30.3 bits (68), Expect = 0.57
 Identities = 19/71 (26%), Positives = 26/71 (36%), Gaps = 6/71 (8%)

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID------LVK 223
           E+ F   D    G ISS  LG     +G      V  +   ID D DG I         +
Sbjct: 14  ERIFKRFDTNGDGKISSSELGDALKTLGSVTPDEVRRMMAEIDTDGDGFISFDEFTDFAR 73

Query: 224 SNIDAIASAAK 234
           +N   +   +K
Sbjct: 74  ANRGLVKDVSK 84


>3evu_A Myosin light chain kinase, green fluorescent protein, calmodulin
           chimera; gcamp2,calcium sensor, GFP, calmodulin,M13,
           signaling protein; HET: CRO; 1.75A {Aequorea victoria}
           PDB: 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3ekj_A*
           3evr_A*
          Length = 449

 Score = 28.7 bits (64), Expect = 1.6
 Identities = 14/50 (28%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 173 FYALDLVKKGVISSHALGATFGEIGQFQFLP-VNVVKYAIDADEDGKIDL 221
           F   D    G I++  LG     +GQ      +  +   +DAD +G ID 
Sbjct: 317 FSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF 366


>3gqc_A DNA repair protein REV1; protein-DNA complex, alternative splicing,
           DNA damage, DNA repair, DNA synthesis; HET: DNA DOC DCP;
           2.50A {Homo sapiens}
          Length = 504

 Score = 28.4 bits (62), Expect = 1.7
 Identities = 8/36 (22%), Positives = 16/36 (44%)

Query: 48  AARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
            AR   ++ GM    AK L  +L+ +       +++
Sbjct: 185 EARQLGIKNGMFFGHAKQLCPNLQAVPYDFHAYKEV 220


>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand,
           cross-reactivity; 1.75A {Phleum pratense} SCOP:
           a.39.1.10
          Length = 78

 Score = 28.3 bits (63), Expect = 1.9
 Identities = 16/52 (30%), Positives = 19/52 (36%)

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           E+ F   D    G IS   L      +G      V  +   ID D DG ID 
Sbjct: 6   ERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDF 57


>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding
           protein,; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5
           PDB: 1c7w_A
          Length = 81

 Score = 27.9 bits (62), Expect = 2.8
 Identities = 12/54 (22%), Positives = 19/54 (35%), Gaps = 2/54 (3%)

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY--AIDADEDGKIDL 221
            + F   D    GVI          ++G+       V +     D D +G ID+
Sbjct: 11  LRAFKVFDANGDGVIDFDEFKFIMQKVGEEPLTDAEVEEAMKEADEDGNGVIDI 64


>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein
           kinase, transferase, calcium-bindin binding, bumped
           kinase inhibitor; HET: BK3; 1.98A {Cryptosporidium
           parvum iowa II} PDB: 3igo_A* 3ncg_A*
          Length = 486

 Score = 27.6 bits (61), Expect = 3.0
 Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%)

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIG-QFQFLPVNVVKYAIDADEDGKIDL 221
           E+ F   D    G IS+  L   F +     Q   +  +   +D ++DG++D 
Sbjct: 420 ERAFKMFDKDGSGKISTKELFKLFSQADSSIQMEELESIIEQVDNNKDGEVDF 472


>3igo_A Calmodulin-domain protein kinase 1; parasite, calcium, CDPK,
           structural genomics, structural genomics consortium,
           SGC; HET: ANP SRT; 2.25A {Cryptosporidium parvum iowa
           II}
          Length = 486

 Score = 27.6 bits (61), Expect = 3.1
 Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%)

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIG-QFQFLPVNVVKYAIDADEDGKIDL 221
           E+ F   D    G IS+  L   F +     Q   +  +   +D ++DG++D 
Sbjct: 420 ERAFKMFDKDGSGKISTKELFKLFSQADSSIQMEELESIIEQVDNNKDGEVDF 472


>2glf_A Probable M18-family aminopeptidase 1; putative, NYSGXRC, structural
           genomics, PSI, protein structure initiative; 2.80A
           {Thermotoga maritima}
          Length = 450

 Score = 27.3 bits (60), Expect = 4.1
 Identities = 10/68 (14%), Positives = 24/68 (35%), Gaps = 8/68 (11%)

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK---CAGYQPGEKNFAILKH-----WNASLNYNKTI 270
           +   K+    +    + L + G+      AG       +A+ +      +    +  + +
Sbjct: 27  MSKAKTERMTVKEIKRILDESGFVPLEDFAGDPMNMTVYAVNRGKAIAAFRVVDDLKRGL 86

Query: 271 AYIAAHID 278
             + AHID
Sbjct: 87  NLVVAHID 94


>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein
           kinase, transferase, calcium-bindin binding, EF hand,
           bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma
           gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3ku2_A*
           3hx4_A*
          Length = 484

 Score = 27.1 bits (60), Expect = 4.6
 Identities = 15/52 (28%), Positives = 22/52 (42%), Gaps = 1/52 (1%)

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           E+ F   D    G ISS  L   FG          +V+   +D + DG++D 
Sbjct: 421 ERAFRMFDSDNSGKISSTELATIFGVSDVDSETWKSVLS-EVDKNNDGEVDF 471


>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15,
           EPS15; EH domain, EF-hand, solution structure, S100
           protein; NMR {Mus musculus} SCOP: a.39.1.6
          Length = 99

 Score = 26.9 bits (59), Expect = 5.9
 Identities = 8/52 (15%), Positives = 19/52 (36%), Gaps = 1/52 (1%)

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           E+++  ++    G + +    A   + G    +   +   A D D  G +  
Sbjct: 14  EKYYRQVEAGNTGRVLALDAAAFLKKSGLPDLILGKIWDLA-DTDGKGVLSK 64


>1jx4_A DNA polymerase IV (family Y); protein-DNA complex, Y-family,
          transferase/DNA complex; HET: DNA MSE ADI; 1.70A
          {Sulfolobus solfataricus} SCOP: d.240.1.1 e.8.1.7 PDB:
          1jxl_A* 1n48_A* 1n56_A* 1ryr_A* 1rys_A* 1s0m_A* 1s0n_A*
          1s0o_A* 1s10_A* 1s97_A* 1s9f_A* 2ia6_A* 2ibk_A* 2r8g_A*
          2r8h_A* 2r8i_A* 2rdj_A* 3fds_A* 2jej_A* 2bqr_A* ...
          Length = 352

 Score = 26.7 bits (58), Expect = 6.0
 Identities = 8/36 (22%), Positives = 15/36 (41%)

Query: 48 AARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
           AR   V+ G+    AK +  +  YL       +++
Sbjct: 49 EARKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQV 84


>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein,
           solution structure, backbone dynamic, structural
           genomics; NMR {Homo sapiens}
          Length = 71

 Score = 26.8 bits (59), Expect = 6.5
 Identities = 12/50 (24%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 173 FYALDLVKKGVISSHALGATFGEIGQFQ-FLPVNVVKYAIDADEDGKIDL 221
           F A D    G I+   L      +GQ      ++ +    D D+DG+++ 
Sbjct: 12  FRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNY 61


>1f54_A Calmodulin; EF-hand, helix-loop-helix, transport protein; NMR
           {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1f55_A
          Length = 77

 Score = 26.3 bits (58), Expect = 8.0
 Identities = 14/50 (28%), Positives = 19/50 (38%), Gaps = 1/50 (2%)

Query: 173 FYALDLVKKGVISSHALGATFGEIGQ-FQFLPVNVVKYAIDADEDGKIDL 221
           F   D    G ISS  L      +G       VN +   ID D + +I+ 
Sbjct: 16  FALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNHQIEF 65


>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant
           photosynthetic reaction center, peripheral antenna; HET:
           CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1
          Length = 154

 Score = 26.1 bits (56), Expect = 8.7
 Identities = 12/50 (24%), Positives = 18/50 (36%), Gaps = 24/50 (48%)

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           ALKK    L  +LK            L+  ++         P L+  AT+
Sbjct: 21  ALKK----LQASLK------------LYADDS--------APALAIKATM 46


>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+)
           requirement, hydrolase chimera; 2.80A {Rattus
           norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3
          Length = 900

 Score = 26.2 bits (57), Expect = 9.2
 Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 4/54 (7%)

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY--AIDADEDGKIDL 221
           +  +   +  + G I S+ L   F   G    L  ++        +DE G +D 
Sbjct: 807 QGIYKRFETDRSGTIGSNELPGAFEAAGFH--LNQHIYSMIIRRYSDETGNMDF 858


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.321    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0626    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 2,438,568
Number of extensions: 107460
Number of successful extensions: 397
Number of sequences better than 10.0: 1
Number of HSP's gapped: 385
Number of HSP's successfully gapped: 29
Length of query: 288
Length of database: 5,693,230
Length adjustment: 91
Effective length of query: 197
Effective length of database: 3,487,026
Effective search space: 686944122
Effective search space used: 686944122
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (25.6 bits)