HHsearch alignment for GI: 254780309 and conserved domain: PRK05259

>PRK05259 consensus.
Probab=98.99  E-value=5.9e-10  Score=75.22  Aligned_cols=47  Identities=34%  Similarity=0.360  Sum_probs=42.9

Q ss_pred             HHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             10028975999920045738899999999978997899999983068
Q gi|254780309|r   12 SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus        12 ~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
T Consensus       204 ~gdV~Gk~~IIvDDiIdTGgTl~~aa~~Lk~~GA~~V~~~~THgvfs  250 (310)
T PRK05259        204 IGDVSGRDCILIDDIVDSGGTLCNAAEALLANGANSVTAYITHGVLS  250 (310)
T ss_pred             CCCCCCCEEEEECCHHHCHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             56623124895173441688999999999877998699999785368