HHsearch alignment for GI: 254780309 and conserved domain: PRK11595

>PRK11595 gluconate periplasmic binding protein; Provisional.
Probab=99.68  E-value=6.6e-17  Score=112.78  Aligned_cols=53  Identities=38%  Similarity=0.564  Sum_probs=49.7

Q ss_pred             CCCEEEECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEEC
Q ss_conf             976088251021002897599992004573889999999997899789999998306
Q gi|254780309|r    1 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL   57 (59)
Q Consensus         1 l~gaf~i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~   57 (59)
T Consensus       175 v~~aF~~~~~----~~g~~vlLVDDV~TTGaTl~~~a~~L~~aGa~~V~v~~laRt~  227 (227)
T PRK11595        175 LKNAFRLELP----VQGQHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL  227 (227)
T ss_pred             HHCCEECCCC----CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEC
T ss_conf             4288784578----8969799962014639999999999998099879999999679