HHsearch alignment of GI: 254780309 and MMDB domain: 1o5o_A_

>1o5o_A (A:) Uracil phosphoribosyltransferase; TM0721, structural genomics, JCSG, PSI, protein structure initiative; HET: U5P; 2.30A {Thermotoga maritima}
Probab=98.82  E-value=4.6e-09  Score=70.07  Aligned_cols=50  Identities=18%  Similarity=0.256  Sum_probs=44.1

Q ss_pred             CCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEEC
Q ss_conf             51021002897599992004573889999999997899789999998306
Q gi|254780309|r    8 PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL   57 (59)
Q Consensus         8 ~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~   57 (59)
                      ......+++||+|+|+||+++||.|+..+++.|++.||++|++++..-..
T Consensus       127 ~~~l~~dv~g~~viivDdii~TG~T~~~a~~~Lk~~Ga~~I~~~~~h~~~  176 (221)
T 1o5o_A          127 YAKLPPLNDDKEVFLLDPMLATGVSSIKAIEILKENGAKKITLVALIAAP  176 (221)
T ss_dssp             EEECCCCCTTCEEEEECSEESSSHHHHHHHHHHHHTTCCEEEEECSEECH
T ss_pred             EEECCCCCCCCEEEEEHHHHHCCHHHHHHHHHHHHCCCCCEEEEEEEECH
T ss_conf             45468665687499887886377249999999986699838999987468