>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properti

Probab=98.17 E-value=2e-05 Score=49.22 Aligned_cols=126 Identities=19% Similarity=0.173 Sum_probs=76.2 Q ss_pred CCCCCCCCCCC-CCEEHHHHHCCCEEEEEEECCCCCCCCCHHHCHHHHHHHHHHHHHC--CCEEEEEEC----CCCHHHH Q ss_conf 06884036888-4023589838974999982288787410010104653112455310--110234303----5401136 Q gi|254780311|r 18 VLPDGSKAFQW-KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG--IEEVYCLSV----NDAFVMN 90 (177) Q Consensus 18 ~~Pd~tl~~~~-~~~~~~d~f~gKkVvL~~~P~AfTp~Ct~~~~~~~~~~~~~~~~~~--~~~i~~~s~----~d~~~~~ 90 (177) T Consensus 1 ~~p~f~L~d~~G~~~~~~~~-~gk~~lv~F~yt~Cp~~Cp~~-~~~l~~~~~~l~~~~~~~v~~v~ISvDP~rDtpe~L~ 78 (142) T cd02968 1 IGPDFTLTDQDGRPVTLSDL-KGKPVLVYFGYTHCPDVCPTT-LANLAQALKQLGADGGDDVQVVFISVDPERDTPEVLK 78 (142) T ss_pred CCCCEEEECCCCCEEEHHHH-CCCEEEEEEECCCCCCCCHHH-HHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCHHHHH T ss_conf 97986999199899827997-998899998746799934899-9999999998644325857999999088889999999 Q ss_pred HHHCCCCCCEEEEEEC---CCHHHHHHHHCCCCCCCC----CCCEEEEEEEEEECCCEEEEEE Q ss_conf 6522358752786103---671543332002247654----3441001599998799699999 Q gi|254780311|r 91 AWGKKLEIKNVKLLPD---GSGEFTRKMGMLVYKDNV----GFGLRSWRYGALIKDMVVESWF 146 (177) Q Consensus 91 aw~~~~~~~~~~~l~D---~~~~~~~~~g~~~~~~~~----g~g~rs~R~a~Ii~dG~I~~~~ 146 (177) T Consensus 79 ~y~~~~~-~~w~~Ltg~~~~i~~l~~~~gv~~~~~~~~~~~~~~~Hs~~~~lid~~G~i~~~~ 140 (142) T cd02968 79 AYAKAFG-PGWIGLTGTPEEIEALAKAFGVYYEKVPEDDGDYLVDHSAAIYLVDPDGKLVRYY 140 (142) T ss_pred HHHHHHC-CCCEEEECCHHHHHHHHHHCCEEEEECCCCCCCCEEECCCEEEEECCCCCEEEEE T ss_conf 9999736-5846998999999999997695899767888887887303899997998599994

HHsearch alignment for GI: 254780311 and conserved domain: cd02968