HHsearch alignment for GI: 254780311 and conserved domain: cd02970

>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins.
Probab=99.64  E-value=2.5e-15  Score=102.59  Aligned_cols=128  Identities=16%  Similarity=0.139  Sum_probs=100.4

Q ss_pred             CCCCCCCCCCC-CCEEHHHHHCCCEEEEEEECCCCCCCCCHHHCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHCCC
Q ss_conf             06884036888-40235898389749999822887874100101046531124553101102343035401136652235
Q gi|254780311|r   18 VLPDGSKAFQW-KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL   96 (177)
Q Consensus        18 ~~Pd~tl~~~~-~~~~~~d~f~gKkVvL~~~P~AfTp~Ct~~~~~~~~~~~~~~~~~~~~~i~~~s~~d~~~~~aw~~~~   96 (177)
T Consensus         1 ~APdf~L~~~~G~~v~l~~~~~~~~vvl~F~R~~~Cp~C~~-~l~~l~~~~~~~~~~gv-~vvaIs~~~~~~~~~~~~~~   78 (149)
T cd02970           1 TAPDFELPDAGGETVTLSALLGEGPVVVVFYRGFGCPFCRE-YLRALSKLLPELDALGV-ELVAVGPESPEKLEAFDKGK   78 (149)
T ss_pred             CCCCEEEECCCCCEEECHHHCCCCCEEEEEECCCCCCCCCC-CHHHHHHHHHHHHHCCC-EEEEEECCCHHHHHHHHHHC
T ss_conf             99970857899898976798099979999977899942147-19899988999987696-59999279999999999865


Q ss_pred             CCCEEEEEECCCHHHHHHHHCCCCCCCCC----------------C--CEEEEEEEEEEC-CCEEEEEEEC
Q ss_conf             87527861036715433320022476543----------------4--410015999987-9969999974
Q gi|254780311|r   97 EIKNVKLLPDGSGEFTRKMGMLVYKDNVG----------------F--GLRSWRYGALIK-DMVVESWFVE  148 (177)
Q Consensus        97 ~~~~~~~l~D~~~~~~~~~g~~~~~~~~g----------------~--g~rs~R~a~Ii~-dG~I~~~~~E  148 (177)
T Consensus        79 ~~~-f~vl~D~~~~~~~~~Gl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~fvi~~~g~I~~~h~~  148 (149)
T cd02970          79 FLP-FPVYADPDRKLYRALGLVRSLPWSNTPRALWKNAAIGFRGNDEGDGLQLPGVFVIGPDGTILFAHVD  148 (149)
T ss_pred             CCC-CEEEECCCHHHHHHCCCEEECCHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEECCCCEEEEEEEC
T ss_conf             998-3699849779999869558763666467887354335678989876746779999999989999817