>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol. The cellular location of PRX5 suggests that it may have an important antioxidant role in organelles that are major sources of reactive oxygen species (ROS), as well as a role in the control of signal transduction. PRX5 has been shown to reduce hydrogen peroxide, alkyl hydroperoxides and peroxynitrite. As with all other PRXs, the N-terminal peroxidatic cysteine of PRX5 is oxidized into a sulfenic acid intermediate upon reaction with peroxides. Human PRX5 is able to resolve this intermediate by forming an intramolecular disulfide bond with its C-terminal cysteine (the resolving cysteine), which can then be reduced by TRX, just like an atypical 2-cys PRX. This resolving cysteine, however, is not conserved in other members of the subfamily. In such cases

Probab=100.00 E-value=0 Score=304.48 Aligned_cols=150 Identities=47% Similarity=0.792 Sum_probs=139.8 Q ss_pred ECCCCCCCCCC----CCCCCEEHHHHHCCCEEEEEEECCCCCCCCCHHHCHHHHHHHHHHHHHCCCEEEEEECCCCHHHH Q ss_conf 36706884036----88840235898389749999822887874100101046531124553101102343035401136 Q gi|254780311|r 15 VATVLPDGSKA----FQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90 (177) Q Consensus 15 vGd~~Pd~tl~----~~~~~~~~~d~f~gKkVvL~~~P~AfTp~Ct~~~~~~~~~~~~~~~~~~~~~i~~~s~~d~~~~~ 90 (177) T Consensus 1 vGd~iP~~~l~~~~~~~~~~~~l~d~f~~kkvvl~~vPgAFTp~Cs~~HlP~~i~~~~~~~~kGvd~I~~isvnD~fv~~ 80 (155) T cd03013 1 VGDKLPNVTLFEYVPGPPNPVNLSELFKGKKVVIFGVPGAFTPTCSAQHLPGYVENADELKAKGVDEVICVSVNDPFVMK 80 (155) T ss_pred CCCCCCCCEEEEECCCCCEEEEHHHHHCCCEEEEEECCCCCCCCCCHHHCCHHHHHHHHHHHCCCCEEEEEEECCHHHHH T ss_conf 98878871899762999768878998499819999824667886534658547776999997699689999809999999 Q ss_pred HHHCCCCCC-EEEEEECCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCEEEEEEECCCCCCCCCCCCCCCCCHHHHH Q ss_conf 652235875-2786103671543332002247654344100159999879969999974887778777773248999999 Q gi|254780311|r 91 AWGKKLEIK-NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169 (177) Q Consensus 91 aw~~~~~~~-~~~~l~D~~~~~~~~~g~~~~~~~~g~g~rs~R~a~Ii~dG~I~~~~~E~~~~~~~~~d~~~vs~ae~iL 169 (177) T Consensus 81 AW~~~~~~~~~i~~lsD~~~~f~~~lGl~~d~~~~g~g~Rs~R~a~iv~dg~I~~~~vE~~~------~~~~vS~ae~iL 154 (155) T cd03013 81 AWGKALGAKDKIRFLADGNGEFTKALGLTLDLSAAGGGIRSKRYALIVDDGKVKYLFVEEDP------GDVEVSSAENVL 154 (155) T ss_pred HHHHHHCCCCCEEEEECCCHHHHHHHCCEECCCCCCCCCCCEEEEEEEECCEEEEEEEECCC------CCCEEECHHHHH T ss_conf 99996098773599546747999972980625678780021008999999989999982799------976556878951 Q ss_pred H Q ss_conf 9 Q gi|254780311|r 170 K 170 (177) Q Consensus 170 ~ 170 (177) T Consensus 155 k 155 (155) T cd03013 155 K 155 (155) T ss_pred C T ss_conf 9

HHsearch alignment for GI: 254780311 and conserved domain: cd03013