HHsearch results for GI: 254780311 and protein with PDBid: 3ewl_A

>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343}
Probab=98.82  E-value=8.2e-09  Score=66.36  Aligned_cols=132  Identities=11%  Similarity=0.028  Sum_probs=73.8

Q ss_pred             EECCCCCCCCCCCCC-CCEEHHHHHCCCEEEEEEECCCCCCCCCHHHCHHHHHHH---HHHHHHCCCEEEEEECCC-CHH
Q ss_conf             536706884036888-402358983897499998228878741001010465311---245531011023430354-011
Q gi|254780311|r   14 RVATVLPDGSKAFQW-KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY---DDLRCEGIEEVYCLSVND-AFV   88 (177)
Q Consensus        14 kvGd~~Pd~tl~~~~-~~~~~~d~f~gKkVvL~~~P~AfTp~Ct~~~~~~~~~~~---~~~~~~~~~~i~~~s~~d-~~~   88 (177)
                      .+|++||||++.+.+ +.++++++ +||++||+|+ +.+-|.|.. .++...+..   +.....++ .++.++.++ ...
T Consensus         2 ~~G~~apdf~~~~~~G~~~sl~~~-~Gk~~ll~f~-~~~C~~C~~-~~~~~~~~~~~~~~~~~~~v-~~~~i~~d~~~~~   77 (142)
T 3ewl_A            2 NAGMKAADFTYVTVHGDNSRMSRL-KAQYTMLFFY-DPDCSNCRK-FEKLFAEIPAFVEMVENGTL-RVLAIYPDENREE   77 (142)
T ss_dssp             CTTSBCCCCEEECTTCCEEEGGGC-CCSEEEEEEC-CSSCHHHHH-HHHHHHTCHHHHHHHHHTSE-EEEEEECSSCHHH
T ss_pred             CCCCCCCCEEEECCCCCEEEHHHH-CCCEEEEEEE-CCCCCCCHH-HHHHHHHHHHHHHHHCCCCC-EEEEEECCCCHHH
T ss_conf             999868884858899599879990-9986999854-787986378-98765324455444303433-0489966899999


Q ss_pred             HHHHHCCCCCCEE-EEEECCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEEC-CCEEEEEEECCCCCCCCCCCCCCCCCHH
Q ss_conf             3665223587527-8610367154333200224765434410015999987-9969999974887778777773248999
Q gi|254780311|r   89 MNAWGKKLEIKNV-KLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIK-DMVVESWFVEEGFSDNCATDPYEISSPE  166 (177)
Q Consensus        89 ~~aw~~~~~~~~~-~~l~D~~~~~~~~~g~~~~~~~~g~g~rs~R~a~Ii~-dG~I~~~~~E~~~~~~~~~d~~~vs~ae  166 (177)
                      ...+....+.... .+..+....+...           ++.++.+++++++ +|+|.+-                ..+++
T Consensus        78 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------y~v~~~P~~~liD~~G~Ii~~----------------~~~~~  130 (142)
T 3ewl_A           78 WATKAVYMPQGWIVGWNKAGDIRTRQL-----------YDIRATPTIYLLDGRKRVILK----------------DTSME  130 (142)
T ss_dssp             HHHHHTTSCTTCEEEECTTCHHHHTTC-----------SCCCSSSEEEEECTTCBEEEC----------------SCCHH
T ss_pred             HHHHHHHCCCCCCCCCCCCHHHHHHHH-----------EEECCCCEEEEECCCCEEEEE----------------CCCHH
T ss_conf             999999859987411234214555554-----------053244149999799989984----------------09989


Q ss_pred             HHHHHHHHHC
Q ss_conf             9999998616
Q gi|254780311|r  167 NVLKVIRESK  176 (177)
Q Consensus       167 ~iL~~Lk~~~  176 (177)
                      ++.++|++..
T Consensus       131 ~le~~L~~~~  140 (142)
T 3ewl_A          131 QLIDYLATQA  140 (142)
T ss_dssp             HHHHHHHC--
T ss_pred             HHHHHHHHHH
T ss_conf             9999999985