BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780311|ref|YP_003064724.1| hypothetical protein
CLIBASIA_00980 [Candidatus Liberibacter asiaticus str. psy62]
         (177 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780311|ref|YP_003064724.1| hypothetical protein CLIBASIA_00980 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039988|gb|ACT56784.1| hypothetical protein CLIBASIA_00980 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 177

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL
Sbjct: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY
Sbjct: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK
Sbjct: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177


>gi|315122265|ref|YP_004062754.1| hypothetical protein CKC_02585 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495667|gb|ADR52266.1| hypothetical protein CKC_02585 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 176

 Score =  291 bits (745), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 135/176 (76%), Positives = 154/176 (87%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MI F+IP V+F  RV     DGS +F+WKDV+T++LF+ K+VFL ALPGAFTPTCS+ QL
Sbjct: 1   MIDFKIPHVIFRTRVKKTALDGSSSFEWKDVSTEELFSKKKVFLCALPGAFTPTCSNSQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           PGFEKIYDDL  EGIE+VYCLSVND+FVMNAWGK L IKNVKLLPDGSGEFTRKMGMLVY
Sbjct: 61  PGFEKIYDDLISEGIEDVYCLSVNDSFVMNAWGKSLGIKNVKLLPDGSGEFTRKMGMLVY 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRYGALI DM+++ WF+E+GFSDNC TDPYEISSPENVLK IR SK
Sbjct: 121 KDNLGFGVRSWRYGALIDDMIIQHWFIEKGFSDNCPTDPYEISSPENVLKFIRASK 176


>gi|49476039|ref|YP_034080.1| hypothetical protein BH13580 [Bartonella henselae str. Houston-1]
 gi|49238847|emb|CAF28131.1| expressed protein [Bartonella henselae str. Houston-1]
          Length = 174

 Score =  254 bits (648), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 137/173 (79%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MIR  +P   FH RV      G   ++W++VN+   F GKRV LF+LPGAFTPTCS  QL
Sbjct: 1   MIRKTVPNTTFHTRVRDESIGGDNPYRWQEVNSDAYFKGKRVILFSLPGAFTPTCSTFQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+YD+ +  GI+E+YCLSVNDAFVMNAWGK   IKNVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLYDEFKKVGIDEIYCLSVNDAFVMNAWGKAQGIKNVKLIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           KDNVGFG+RSWRY A+I D V+E WF E+GFSDNCATDPYE+SSP+NVLK ++
Sbjct: 121 KDNVGFGMRSWRYAAVINDGVIEHWFEEQGFSDNCATDPYEVSSPQNVLKTLK 173


>gi|163868799|ref|YP_001610023.1| hypothetical protein Btr_1726 [Bartonella tribocorum CIP 105476]
 gi|161018470|emb|CAK02028.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 174

 Score =  253 bits (647), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 114/173 (65%), Positives = 138/173 (79%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M++  +P V FH RV      G   ++W+DV +   F GKRV LF+LPGAFTPTCS+ QL
Sbjct: 1   MVKKTVPNVTFHTRVRDESMGGDNPYRWQDVKSDAYFKGKRVILFSLPGAFTPTCSNFQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+YD+ +  GI+E+YCLSVNDAFVMNAWGK+  IKNVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLYDEFKQAGIDEIYCLSVNDAFVMNAWGKEQNIKNVKLIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           KDN+GFG+RSWRY A+I D V+E WF E GFSDNCATDPYE+SSP+NVLK ++
Sbjct: 121 KDNLGFGMRSWRYAAVINDGVIEQWFEEAGFSDNCATDPYEVSSPQNVLKALK 173


>gi|121602101|ref|YP_989434.1| putative peroxiredoxin [Bartonella bacilliformis KC583]
 gi|120614278|gb|ABM44879.1| putative peroxiredoxin [Bartonella bacilliformis KC583]
          Length = 175

 Score =  253 bits (646), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 115/175 (65%), Positives = 140/175 (80%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+R +IP V FH RV      G   ++W+DVN+   F GKRV LF+LPGAFTPTCS+ QL
Sbjct: 1   MVRRKIPNVTFHTRVRDESIGGENPYRWQDVNSDAYFKGKRVILFSLPGAFTPTCSNFQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+YDD +  GI+++YCLSVND FVMNAWGKK  IKNVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLYDDFKKIGIDDIYCLSVNDTFVMNAWGKKQGIKNVKLIPDGSGEFTRKMGMLVE 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           K N+GFG+RSWRY A+I D ++E WF EEGF+DNC TDPYE+SSP++VLKV++ S
Sbjct: 121 KTNIGFGMRSWRYAAVINDGLIEHWFEEEGFADNCGTDPYEVSSPQHVLKVLQNS 175


>gi|240850983|ref|YP_002972383.1| putative peroxiredoxin [Bartonella grahamii as4aup]
 gi|240268106|gb|ACS51694.1| putative peroxiredoxin [Bartonella grahamii as4aup]
          Length = 173

 Score =  253 bits (646), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 140/173 (80%), Gaps = 1/173 (0%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MI+  +P V FH RV   + + + +++W++VN+   F GKRV LF+LPGAFTPTCS  QL
Sbjct: 1   MIKKTVPNVTFHTRVRDEVGE-NNSYRWQEVNSDAYFKGKRVILFSLPGAFTPTCSTFQL 59

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+YD+ +  GI+E+YCLSVNDAFVMNAWGK   IKNVKL+PDGSGEFTRKMGMLV 
Sbjct: 60  PDFEKLYDEFKQAGIDEIYCLSVNDAFVMNAWGKTQNIKNVKLIPDGSGEFTRKMGMLVA 119

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           KDNVGFG+RSWRY A+I D VVE WF E GFSDNCATDPYE+SSP+NVLK ++
Sbjct: 120 KDNVGFGMRSWRYAAVINDGVVEQWFEEAGFSDNCATDPYEVSSPQNVLKALK 172


>gi|319406170|emb|CBI79807.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 174

 Score =  253 bits (645), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 114/173 (65%), Positives = 139/173 (80%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M R ++P V+FH RV      G   ++W+DVN+   F GKRV LF+LPGAFTPTCS  QL
Sbjct: 1   MFRKKVPNVIFHTRVRDESISGDNPYRWQDVNSDTYFKGKRVILFSLPGAFTPTCSTFQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+YD+ +  GI+E+YC+SVNDAFVMNAWGK   IKNVKL+PDGSGEFTR+MGMLV 
Sbjct: 61  PDFEKLYDEFKKVGIDEIYCISVNDAFVMNAWGKNQGIKNVKLIPDGSGEFTRRMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           KDNVGFG+RSWRY A+I+D V+E WF E G SDNCATDPYE+SSP+N+LKV++
Sbjct: 121 KDNVGFGMRSWRYAAVIQDGVIEQWFEEAGASDNCATDPYEVSSPQNILKVLQ 173


>gi|319407644|emb|CBI81293.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 174

 Score =  252 bits (643), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 112/173 (64%), Positives = 139/173 (80%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M R ++P V+FH RV      G   ++W+DVN+   F GKRV LF+LPGAFTPTCS  QL
Sbjct: 1   MFRKKVPNVIFHTRVRDESVSGDNPYRWQDVNSDTYFKGKRVILFSLPGAFTPTCSTFQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+YD+ +  GI+E+YC+SVNDAFVMNAWGK   IKNVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLYDEFKKVGIDEIYCVSVNDAFVMNAWGKDQGIKNVKLIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           KDN+GFG+RSWRY A+I+D ++E WF E G SDNCATDPYE+SSP+N+LK+++
Sbjct: 121 KDNIGFGMRSWRYAAVIQDGIIEQWFEEPGISDNCATDPYEVSSPQNILKILQ 173


>gi|319404663|emb|CBI78265.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
 gi|319404682|emb|CBI78284.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 174

 Score =  251 bits (640), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 112/173 (64%), Positives = 138/173 (79%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M R ++P V FH RV      G   ++W+DVN+   F GKRV LF+LPGAFTPTCS  QL
Sbjct: 1   MFRKKVPNVTFHTRVRDESVSGDNPYRWQDVNSDTYFKGKRVILFSLPGAFTPTCSTFQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+YD+ +  GI+E+YC+SVNDAFVMNAWGK   IKNVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLYDEFKKVGIDEIYCVSVNDAFVMNAWGKDQGIKNVKLIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           KDN+GFG+RSWRY A+I+D ++E WF E G SDNCATDPYE+SSP+N+LK+++
Sbjct: 121 KDNIGFGMRSWRYAAVIQDGIIEQWFEEPGISDNCATDPYEVSSPQNILKILQ 173


>gi|319409223|emb|CBI82867.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 174

 Score =  248 bits (633), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 139/173 (80%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MI+ Q+P V FH RV      G   ++W+DVN+   F GKRV LF+LPGAFTPTCS  QL
Sbjct: 1   MIKKQVPNVTFHTRVRDESVGGDNPYRWQDVNSDTYFKGKRVILFSLPGAFTPTCSTFQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+YD+ +  GI+E+YCLSVND+FVMNAWG+K  IKNVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLYDEFKKVGIDEIYCLSVNDSFVMNAWGQKQGIKNVKLIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K+N+GFG+RSWRY A+I D V+E WF E+G+SDNC TDPYE+SSP+++LK ++
Sbjct: 121 KENLGFGMRSWRYAAVINDGVIEHWFEEKGYSDNCPTDPYEVSSPQHILKALQ 173


>gi|49474601|ref|YP_032643.1| hypothetical protein BQ10800 [Bartonella quintana str. Toulouse]
 gi|49240105|emb|CAF26547.1| hypothetical protein BQ10800 [Bartonella quintana str. Toulouse]
          Length = 174

 Score =  247 bits (631), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 112/173 (64%), Positives = 136/173 (78%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MI+  +P   FH RV      G+  ++W++VN+   F GKRV LF+LPGAFTPTCS  QL
Sbjct: 1   MIKKTVPNATFHTRVRDESIGGNNPYRWQEVNSDTYFKGKRVILFSLPGAFTPTCSTFQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+YD+ +  GI+E+YCLSVNDAFVMNAW +   IKNVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLYDEFKKVGIDEIYCLSVNDAFVMNAWKEAQGIKNVKLIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           KDNVGFG+RSWRY A+I D V+E WF EEG+SDNC TDPYE+SSP+NVLK ++
Sbjct: 121 KDNVGFGMRSWRYAAVIHDGVIEKWFEEEGYSDNCTTDPYEVSSPQNVLKALK 173


>gi|319899298|ref|YP_004159393.1| hypothetical protein BARCL_1147 [Bartonella clarridgeiae 73]
 gi|319403264|emb|CBI76823.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 175

 Score =  243 bits (621), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 110/175 (62%), Positives = 137/175 (78%), Gaps = 1/175 (0%)

Query: 1   MIRFQIPQVVFHMRVATVLP-DGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQ 59
           M   ++P V FH RV       G   ++W+DVN+   F GKRV LF+LPGAFTPTCS  Q
Sbjct: 1   MFTKKVPNVTFHTRVRDESSVGGDNPYRWQDVNSDTYFKGKRVILFSLPGAFTPTCSTFQ 60

Query: 60  LPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLV 119
           LP FEK+YD+ +  GI+E+YC++VNDAFVMNAWGK   IKNVKL+PDGSGEFTR+MGMLV
Sbjct: 61  LPDFEKLYDEFKKVGIDEIYCIAVNDAFVMNAWGKNQGIKNVKLIPDGSGEFTRRMGMLV 120

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRE 174
            KDN+GFG+RSWRY A+I+D V+E WF E G SDNCATDPYE+SSP+N+LK +++
Sbjct: 121 AKDNIGFGMRSWRYAAVIQDGVIEQWFEEAGLSDNCATDPYEVSSPQNILKALQK 175


>gi|150397581|ref|YP_001328048.1| peroxiredoxin [Sinorhizobium medicae WSM419]
 gi|150029096|gb|ABR61213.1| Peroxiredoxin [Sinorhizobium medicae WSM419]
          Length = 179

 Score =  242 bits (618), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 109/176 (61%), Positives = 136/176 (77%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P V F  RV      GS  F+W+DV + D FAGKRV LF+LPGAFTPTCS +QL
Sbjct: 1   MLGRKVPAVTFRTRVRDESVGGSNPFRWQDVTSDDYFAGKRVVLFSLPGAFTPTCSTYQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+  + R  GIEE+YC+SVNDAFVMNAWGK   ++NVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLNSEFRALGIEEIYCVSVNDAFVMNAWGKSQGLENVKLIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRY A++ + VVE WF EEG+SDNC +DPY +SSP+N+L  ++  K
Sbjct: 121 KDNLGFGMRSWRYAAIVNNGVVEQWFEEEGYSDNCDSDPYGVSSPQNILAALKSRK 176


>gi|307308571|ref|ZP_07588273.1| Redoxin domain protein [Sinorhizobium meliloti BL225C]
 gi|307317349|ref|ZP_07596789.1| Redoxin domain protein [Sinorhizobium meliloti AK83]
 gi|306896938|gb|EFN27684.1| Redoxin domain protein [Sinorhizobium meliloti AK83]
 gi|306900971|gb|EFN31580.1| Redoxin domain protein [Sinorhizobium meliloti BL225C]
          Length = 179

 Score =  241 bits (616), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 109/176 (61%), Positives = 136/176 (77%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P V F  RV      GS  F+W+DV + D FAGKRV LF+LPGAFTPTCS +QL
Sbjct: 1   MLGRKVPAVTFRTRVRDESVGGSNPFRWQDVTSDDYFAGKRVVLFSLPGAFTPTCSTYQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+  + R  GI+E+YC+SVNDAFVMNAWGK   ++NVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLTSEFRTLGIDEIYCVSVNDAFVMNAWGKSQGLENVKLIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRY A+I + VVE WF EEG+SDNC +DPY +SSP+N+L  ++  K
Sbjct: 121 KDNLGFGMRSWRYAAVINNGVVEQWFEEEGYSDNCDSDPYGVSSPQNILAALKSKK 176


>gi|15966220|ref|NP_386573.1| hypothetical protein SMc01834 [Sinorhizobium meliloti 1021]
 gi|15075490|emb|CAC47046.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
          Length = 180

 Score =  241 bits (616), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 109/176 (61%), Positives = 136/176 (77%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P V F  RV      GS  F+W+DV + D FAGKRV LF+LPGAFTPTCS +QL
Sbjct: 2   MLGRKVPAVTFRTRVRDESVGGSNPFRWQDVTSDDYFAGKRVVLFSLPGAFTPTCSTYQL 61

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+  + R  GI+E+YC+SVNDAFVMNAWGK   ++NVKL+PDGSGEFTRKMGMLV 
Sbjct: 62  PDFEKLTSEFRTLGIDEIYCVSVNDAFVMNAWGKSQGLENVKLIPDGSGEFTRKMGMLVA 121

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRY A+I + VVE WF EEG+SDNC +DPY +SSP+N+L  ++  K
Sbjct: 122 KDNLGFGMRSWRYAAVINNGVVEQWFEEEGYSDNCDSDPYGVSSPQNILAALKSKK 177


>gi|307945380|ref|ZP_07660716.1| hybrid peroxiredoxin hyPrx5 [Roseibium sp. TrichSKD4]
 gi|307771253|gb|EFO30478.1| hybrid peroxiredoxin hyPrx5 [Roseibium sp. TrichSKD4]
          Length = 180

 Score =  239 bits (611), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 109/176 (61%), Positives = 133/176 (75%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+   +P V F  RV     +G   F+W+D  + D F GKRV LF+LPGAFTPTCS +QL
Sbjct: 1   MLGKNVPLVTFRTRVRDESIEGPNPFRWEDKTSDDYFKGKRVVLFSLPGAFTPTCSTYQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+Y++ + EGI+E+YC+SVNDAFVMNAW K   I NVK++PDGSGEFT KMGMLV 
Sbjct: 61  PDFEKLYEEFKAEGIDEIYCVSVNDAFVMNAWAKAQNIDNVKVIPDGSGEFTHKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRYGA+I D  VE WF EEGFSDNC TDPY  SSP+N+L  +R +K
Sbjct: 121 KDNLGFGMRSWRYGAVINDGAVELWFEEEGFSDNCETDPYGASSPQNILDTLRAAK 176


>gi|254503553|ref|ZP_05115704.1| Redoxin superfamily [Labrenzia alexandrii DFL-11]
 gi|222439624|gb|EEE46303.1| Redoxin superfamily [Labrenzia alexandrii DFL-11]
          Length = 180

 Score =  238 bits (606), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 105/176 (59%), Positives = 136/176 (77%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P V F  RV     +G   F+W D  + D F GK+V LF+LPGAFTPTCS +QL
Sbjct: 1   MLGKKVPFVTFRTRVRDESIEGPNPFRWDDKTSDDFFKGKKVVLFSLPGAFTPTCSTYQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK++DD + EG++E+YC+SVNDAFVMNAW K   +  VK++PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLFDDFKAEGVDEIYCISVNDAFVMNAWAKAQGVDKVKVIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRYGA++ D +VE WF E+GFSDNC TDPY +SSP+N+L+ ++ SK
Sbjct: 121 KDNLGFGMRSWRYGAVVTDGIVEQWFEEDGFSDNCETDPYGVSSPQNILENLKASK 176


>gi|227823035|ref|YP_002827007.1| putative peroxiredoxin y4vD-like protein [Sinorhizobium fredii
           NGR234]
 gi|227342036|gb|ACP26254.1| putative peroxiredoxin y4vD-like protein [Sinorhizobium fredii
           NGR234]
          Length = 179

 Score =  237 bits (604), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 135/176 (76%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V F  RV      G   F+W+DV+++D FAGKRV LF+LPGAFTPTCS +QL
Sbjct: 1   MFGRKVPVVTFRTRVRDEAVGGPNPFRWQDVSSEDYFAGKRVVLFSLPGAFTPTCSTYQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+  + R  GI+E+YC+SVNDAFVMNAWGK   ++NVKL+PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLTPEFRALGIDEIYCISVNDAFVMNAWGKSQGLENVKLIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRY A++ +  VE WF EEG+SDNC +DPY +SSP+N+L  ++  K
Sbjct: 121 KDNLGFGMRSWRYAAVVNNGTVEQWFEEEGYSDNCDSDPYGVSSPQNILDALKSQK 176


>gi|11612206|gb|AAG37299.1| unknown [Sinorhizobium fredii]
          Length = 188

 Score =  236 bits (603), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 108/172 (62%), Positives = 132/172 (76%)

Query: 2   IRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLP 61
           ++ +IP V F  RV      G   ++W+   T+D F+GKRV LF+LPGAFTPTCS  QLP
Sbjct: 3   VKKRIPFVAFRTRVRDETIGGPNPYRWEVRTTEDYFSGKRVVLFSLPGAFTPTCSTQQLP 62

Query: 62  GFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYK 121
            FE++YD+ R  GIE VYCLSVNDAFVMNAWGK L ++ V+L+PDGSGEFTRKMGMLV K
Sbjct: 63  DFERLYDEFRKVGIEAVYCLSVNDAFVMNAWGKALGLEKVRLIPDGSGEFTRKMGMLVAK 122

Query: 122 DNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           DN+GFG+RSWRY A++ D VVE WF EEGFSDNC +DPY  SSP N+L+ +R
Sbjct: 123 DNLGFGMRSWRYAAVVNDSVVEQWFEEEGFSDNCESDPYSASSPXNILETLR 174


>gi|118590230|ref|ZP_01547633.1| hypothetical protein SIAM614_11968 [Stappia aggregata IAM 12614]
 gi|118437202|gb|EAV43840.1| hypothetical protein SIAM614_11968 [Stappia aggregata IAM 12614]
          Length = 180

 Score =  236 bits (603), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 138/176 (78%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P V F  RV     +G   F+W+D  + D F GK+V LF+LPGAFTPTCS +QL
Sbjct: 1   MLGKKVPFVTFRTRVRDESIEGPNPFRWEDKTSDDYFKGKKVVLFSLPGAFTPTCSTYQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK++++ + EG++E+YC+SVNDAFVMNAW K   ++ VK++PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLFEEFKAEGVDEIYCISVNDAFVMNAWAKAQGVEKVKVIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRYGA++ D VVE WF EEGFSDNC +DPY +SSP+N+L+ +R +K
Sbjct: 121 KDNLGFGMRSWRYGAVVNDGVVEQWFEEEGFSDNCESDPYGVSSPQNILEKLRAAK 176


>gi|222149544|ref|YP_002550501.1| hypothetical protein Avi_3473 [Agrobacterium vitis S4]
 gi|221736526|gb|ACM37489.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 179

 Score =  236 bits (601), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/176 (59%), Positives = 136/176 (77%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           +I  ++P V F  RV      G   F+W+D+ + D F GK+V LF+LPGAFTPTCS  QL
Sbjct: 2   LIGRKVPSVTFRTRVRDEEVGGPNPFRWQDMTSDDYFKGKKVVLFSLPGAFTPTCSTFQL 61

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+Y + +  GI+++YC+SVNDAFVMNAWGK+  + NVKL+PDGSGEFTRKMGMLV 
Sbjct: 62  PDFEKLYSEFQSAGIDDIYCISVNDAFVMNAWGKQQGLANVKLIPDGSGEFTRKMGMLVS 121

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRY A+I D VVE WF EEG+SDNC +DPY +SSP+N+L+ ++E +
Sbjct: 122 KDNLGFGMRSWRYAAIINDGVVEQWFEEEGYSDNCDSDPYGVSSPQNILEKLKEKQ 177


>gi|218682204|ref|ZP_03529805.1| putative hydroperoxide reductase protein [Rhizobium etli CIAT 894]
          Length = 179

 Score =  235 bits (600), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 108/169 (63%), Positives = 130/169 (76%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P V F  RV      G   ++W+D  T D F+GKRV LF+LPGAFTP CS  QLP FE
Sbjct: 6   QVPIVTFRTRVRDESISGPNPYRWEDKTTDDYFSGKRVILFSLPGAFTPICSTFQLPDFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            +Y + +  GI+++YCLSVNDAFVMNAWGK   +KNVKL+PDGSGEFTRKMGMLV KDN+
Sbjct: 66  SLYVEFKKNGIDDIYCLSVNDAFVMNAWGKSQGLKNVKLIPDGSGEFTRKMGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFGLRSWRY A+I + VVE WF EEGF DNCATDPY +SSP+N+LK ++
Sbjct: 126 GFGLRSWRYAAVINNGVVEGWFEEEGFGDNCATDPYGVSSPQNILKCLK 174


>gi|21492746|ref|NP_659821.1| putative hydroperoxide reductase protein [Rhizobium etli CFN 42]
 gi|190894226|ref|YP_001984520.1| putative hydroperoxide reductase protein [Rhizobium etli CIAT 652]
 gi|218511102|ref|ZP_03508980.1| RNA polymerase sigma factor protein (sigma-54) [Rhizobium etli
           Brasil 5]
 gi|38503409|sp|O69777|YRP2_RHIET RecName: Full=Putative peroxiredoxin in rpoN2 3'region; AltName:
           Full=Thioredoxin reductase
 gi|21467171|gb|AAM54834.1| putative hydroperoxide reductase protein [Rhizobium etli CFN 42]
 gi|30014171|emb|CAA06680.3| atypical 2-Cys peroxiredoxin [Rhizobium etli]
 gi|190699887|gb|ACE93970.1| putative hydroperoxide reductase protein [Rhizobium etli CIAT 652]
 gi|327189264|gb|EGE56441.1| putative hydroperoxide reductase protein [Rhizobium etli CNPAF512]
          Length = 179

 Score =  235 bits (600), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 108/169 (63%), Positives = 130/169 (76%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P V F  RV      G   ++W+D  T D F+GKRV LF+LPGAFTP CS  QLP FE
Sbjct: 6   QVPIVTFRTRVRDESISGPNPYRWEDKTTDDYFSGKRVILFSLPGAFTPICSTFQLPDFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            +Y + +  GI+++YCLSVNDAFVMNAWGK   +KNVKL+PDGSGEFTRKMGMLV KDN+
Sbjct: 66  SLYVEFKKNGIDDIYCLSVNDAFVMNAWGKSQGLKNVKLIPDGSGEFTRKMGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFGLRSWRY A+I + VVE WF EEGF DNCATDPY +SSP+N+LK ++
Sbjct: 126 GFGLRSWRYAAVINNGVVEGWFEEEGFGDNCATDPYGVSSPQNILKCLK 174


>gi|260461242|ref|ZP_05809490.1| Peroxiredoxin [Mesorhizobium opportunistum WSM2075]
 gi|319785419|ref|YP_004144895.1| redoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|259032779|gb|EEW34042.1| Peroxiredoxin [Mesorhizobium opportunistum WSM2075]
 gi|317171307|gb|ADV14845.1| Redoxin domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 177

 Score =  233 bits (595), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 133/171 (77%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   ++W+   + D FAGKRV LF+LPGAFTPTCS +QLP FE
Sbjct: 6   KVPFVTFLTRVRDDSVQGPNPYRWEKRTSDDYFAGKRVILFSLPGAFTPTCSTYQLPNFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            +Y + + EGI+ +YCLSVNDAFVMNAWGK L ++ V+L+PDGSGEFTRKMGMLV KDN+
Sbjct: 66  DLYAEFKKEGIDAIYCLSVNDAFVMNAWGKSLGLQKVELIPDGSGEFTRKMGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           GFG+RSWRY AL+ + VVE WF EEGFSDNC TDPY +SSP+NVL+ ++++
Sbjct: 126 GFGMRSWRYAALVNNGVVEQWFEEEGFSDNCGTDPYGVSSPQNVLQTLKDA 176


>gi|260433928|ref|ZP_05787899.1| hybrid peroxiredoxin hyPrx5 [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417756|gb|EEX11015.1| hybrid peroxiredoxin hyPrx5 [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 182

 Score =  232 bits (592), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 132/173 (76%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V FH RV     DG   F+W+D  T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPDVTFHTRVRDDSIDGPNPFRWEDKTTADYFAGKRVILFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             Y+  + +GI+E+YC+SVND+FVMN W +   +KNVK++PDGSGEFTRKMGMLV K N+
Sbjct: 66  NNYEAFKAKGIDEIYCMSVNDSFVMNKWAQDQGLKNVKVIPDGSGEFTRKMGMLVDKANL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG+RSWRY A+I D VVE+WF E G  DNC  DPY +SSPEN++K + E+++
Sbjct: 126 GFGMRSWRYAAIINDGVVEAWFEEPGLMDNCPEDPYGVSSPENLMKHLEEAQQ 178


>gi|16519985|ref|NP_444105.1| conserved putative 21.4 kDa peroxiredoxin protein [Sinorhizobium
           fredii NGR234]
 gi|2496756|sp|Q53212|Y4VD_RHISN RecName: Full=Putative peroxiredoxin y4vD; AltName:
           Full=Thioredoxin reductase
 gi|1486441|emb|CAA92419.1| unknown [Rhizobium sp.]
 gi|2182672|gb|AAB91892.1| conserved putative 21.4 kDa peroxiredoxin protein [Sinorhizobium
           fredii NGR234]
          Length = 188

 Score =  232 bits (591), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 106/172 (61%), Positives = 132/172 (76%)

Query: 2   IRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLP 61
           ++ ++P V F  RV      G   ++W+   T+D F+GKRV LF+LPGAFTPTCS  QLP
Sbjct: 3   VKKRVPFVAFRTRVRDETIGGPNPYRWEVRTTEDYFSGKRVVLFSLPGAFTPTCSTQQLP 62

Query: 62  GFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYK 121
            FE++YD+    GIE VYCLSVNDAFVMNAWGK L ++ V+L+PDGSGEFTRKMGMLV K
Sbjct: 63  DFERLYDEFGKVGIEAVYCLSVNDAFVMNAWGKALGLEKVRLIPDGSGEFTRKMGMLVAK 122

Query: 122 DNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           DN+GFG+RSWRY A++ D VVE WF EEGFSDNC +DPY  SSP+N+L+ +R
Sbjct: 123 DNLGFGMRSWRYAAVVNDSVVEQWFEEEGFSDNCESDPYWASSPQNILETLR 174


>gi|159185196|ref|NP_355351.2| hypothetical protein Atu2399 [Agrobacterium tumefaciens str. C58]
 gi|159140462|gb|AAK88136.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 178

 Score =  231 bits (588), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 102/173 (58%), Positives = 133/173 (76%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P V F  RV      G   F+W+D+ + D F GK+V LF+LPGAFTPTCS +QL
Sbjct: 1   MLGKKVPAVTFRTRVRDEAVGGPNPFRWQDMTSDDYFKGKKVVLFSLPGAFTPTCSTYQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+  + R  G++E+YCLSVNDAFVMNAW K   ++NVK++PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLAGEFRALGVDEIYCLSVNDAFVMNAWAKGQNLENVKVIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           KDN+GFG+RSWRY A+I D +VE WF EEG+SDNC +DPY +SSP+N+L+ ++
Sbjct: 121 KDNLGFGMRSWRYAAVINDGLVEQWFEEEGYSDNCESDPYGVSSPQNILENLK 173


>gi|254466057|ref|ZP_05079468.1| hybrid peroxiredoxin hyPrx5 [Rhodobacterales bacterium Y4I]
 gi|206686965|gb|EDZ47447.1| hybrid peroxiredoxin hyPrx5 [Rhodobacterales bacterium Y4I]
          Length = 182

 Score =  231 bits (588), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 132/172 (76%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV     +G   F+W+D  T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPDVTFRTRVRDESIEGPNPFRWEDKTTADYFAGKRVVLFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K + D + EGI+ +YC+SVND+FVMNAW +  +++NV+++PDGSGEFTRKMGMLV KDN+
Sbjct: 66  KGFADFQAEGIDAIYCMSVNDSFVMNAWARDQKLENVQVIPDGSGEFTRKMGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY A+I D VVE+WF E G SDN   DPY +SSPE VLK ++E+K
Sbjct: 126 GFGNRSWRYAAIINDGVVEAWFEEPGLSDNHGEDPYGVSSPETVLKHLKEAK 177


>gi|99078567|ref|YP_611825.1| redoxin [Ruegeria sp. TM1040]
 gi|99035705|gb|ABF62563.1| Redoxin [Ruegeria sp. TM1040]
          Length = 181

 Score =  230 bits (587), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 105/170 (61%), Positives = 132/170 (77%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  RV     +G   F+W+D+ T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPQVTFRTRVRDDSIEGPNPFRWQDMTTADYFAGKRVILFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             ++D + EGI+E+YC+SVND+FVMN W +   IKNVK++PDGSGEFTRK+GMLV KDN+
Sbjct: 66  NGFEDFKAEGIDEIYCMSVNDSFVMNKWAEAQGIKNVKVIPDGSGEFTRKVGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRE 174
           GFG+RSWRY A+I D VVE+WF E G  DN A DPY  S+PEN+LK ++E
Sbjct: 126 GFGMRSWRYAAIINDGVVEAWFEEPGRDDNHAEDPYGESAPENLLKHLKE 175


>gi|218662051|ref|ZP_03517981.1| putative hydroperoxide reductase protein [Rhizobium etli IE4771]
          Length = 179

 Score =  230 bits (587), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 106/169 (62%), Positives = 128/169 (75%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P V F  R       G   ++W+D  T D F GKRV LF+LPGAFTPTCS  QLP FE
Sbjct: 6   QVPNVTFRTRARDESIPGPNPYRWEDKTTDDYFRGKRVVLFSLPGAFTPTCSTFQLPDFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             Y + + +GI+E+YC+SVNDAFVMNAWGK   +KNVKL+PDGSGEFTRKMGMLV KDN+
Sbjct: 66  NHYAEFQKKGIDEIYCISVNDAFVMNAWGKAQGLKNVKLIPDGSGEFTRKMGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFGLRSWRY A+I + VVE WF EEG +DNC TDPY +SSP+N+LK ++
Sbjct: 126 GFGLRSWRYAAVINNGVVEKWFEEEGIADNCETDPYGVSSPQNILKWLK 174


>gi|13474891|ref|NP_106461.1| peroxiredoxin 2 family protein [Mesorhizobium loti MAFF303099]
 gi|14025647|dbj|BAB52247.1| peroxiredoxin 2 family protein [Mesorhizobium loti MAFF303099]
          Length = 182

 Score =  230 bits (586), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 103/175 (58%), Positives = 133/175 (76%)

Query: 2   IRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLP 61
           ++ ++P V F  RV     +G   ++W+D  + D F GKR+ LF+LPGAFTPTCS  QLP
Sbjct: 3   VKKKVPFVTFRTRVRDDSIEGPNPYRWEDKTSDDYFRGKRIILFSLPGAFTPTCSTLQLP 62

Query: 62  GFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYK 121
            FE +YD+   EGI+ +YC+SVNDAFVMNAWGK L ++ V+L+PDGSGEFTRKMGMLV K
Sbjct: 63  DFEMLYDEFEKEGIDAIYCVSVNDAFVMNAWGKALGLQKVQLIPDGSGEFTRKMGMLVAK 122

Query: 122 DNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           DN+GFG+RSWRY A+I + VVE WF E+GF DNC  DPY +SSP+NVL+ +R +K
Sbjct: 123 DNLGFGMRSWRYAAVINNGVVEQWFEEDGFCDNCEADPYGVSSPQNVLETLRAAK 177


>gi|294678797|ref|YP_003579412.1| peroxiredoxin [Rhodobacter capsulatus SB 1003]
 gi|294477617|gb|ADE87005.1| peroxiredoxin [Rhodobacter capsulatus SB 1003]
          Length = 179

 Score =  229 bits (583), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 101/172 (58%), Positives = 131/172 (76%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V FH RV      G   ++W+D+ T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPDVTFHTRVRDESVGGPNPYRWQDMTTADYFAGKRVILFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K + +   +GI+E+YCLSVND+FVMN W K   ++NV+++PDGSGEFTR+MGMLV KDN+
Sbjct: 66  KGFPEFAAQGIDEIYCLSVNDSFVMNQWAKAQGLENVQVIPDGSGEFTRRMGMLVRKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFGLRSWRY A++ + V+E+WF E G  DNC  DPY +SSPENVL  ++ +K
Sbjct: 126 GFGLRSWRYAAIVTNGVIEAWFEEPGLMDNCPEDPYGVSSPENVLAWLKTAK 177


>gi|7469151|pir||S39907 conserved hypothetical protein 10 - Rhodobacter capsulatus
          Length = 179

 Score =  229 bits (583), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 101/172 (58%), Positives = 131/172 (76%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V FH RV      G   ++W+D+ T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPDVTFHTRVRDESVGGPNPYRWQDMTTADYFAGKRVILFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K + +   +GI+E+YCLSVND+FVMN W K   ++NV+++PDGSGEFTR+MGMLV KDN+
Sbjct: 66  KGFPEFAAQGIDEIYCLSVNDSFVMNQWAKAQGLENVQVIPDGSGEFTRRMGMLVRKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFGLRSWRY A++ + V+E+WF E G  DNC  DPY +SSPENVL  ++ +K
Sbjct: 126 GFGLRSWRYAAIVTNGVIEAWFEEPGLMDNCPEDPYGVSSPENVLAWLKTAK 177


>gi|259415030|ref|ZP_05738952.1| hybrid peroxiredoxin hyPrx5 [Silicibacter sp. TrichCH4B]
 gi|259348940|gb|EEW60694.1| hybrid peroxiredoxin hyPrx5 [Silicibacter sp. TrichCH4B]
          Length = 181

 Score =  228 bits (582), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 132/170 (77%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  RV     +G   F+W+D+ T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPQVTFRTRVRDDSIEGPNPFRWQDMTTADYFAGKRVILFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             ++D + EGI+E+YC+SVND+FVMN W +   IKNVK++PDGSGEFTRK+GMLV KDN+
Sbjct: 66  NGFEDFKAEGIDEIYCMSVNDSFVMNKWAEAQGIKNVKVIPDGSGEFTRKVGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRE 174
           GFG+RSWRY A+I D VVE++F E G  DN A DPY  SSPEN++K ++E
Sbjct: 126 GFGMRSWRYAAIINDGVVEAYFEEPGRDDNHAEDPYGESSPENLMKHLKE 175


>gi|254475602|ref|ZP_05088988.1| hybrid peroxiredoxin hyPrx5 [Ruegeria sp. R11]
 gi|214029845|gb|EEB70680.1| hybrid peroxiredoxin hyPrx5 [Ruegeria sp. R11]
          Length = 183

 Score =  228 bits (580), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 129/172 (75%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   F+W+D  T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 7   KLPDVTFRTRVRDESIGGDNPFRWEDKTTADYFAGKRVVLFSLPGAFTPTCSTYQLPGFE 66

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K Y D   EGI+ VYC+SVND+FVMNAW +   ++NV+++PDGSGEFTR++GMLV KDN+
Sbjct: 67  KGYGDFTAEGIDAVYCMSVNDSFVMNAWARAQNLENVQVIPDGSGEFTRRIGMLVAKDNL 126

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY A++ D VVE+WF E G  DN   DPY +SSPENVLK ++E+K
Sbjct: 127 GFGNRSWRYAAIVNDGVVEAWFEEPGLCDNHGEDPYGVSSPENVLKHLKEAK 178


>gi|126737672|ref|ZP_01753402.1| antioxidant, AhpC/Tsa family protein [Roseobacter sp. SK209-2-6]
 gi|126721065|gb|EBA17769.1| antioxidant, AhpC/Tsa family protein [Roseobacter sp. SK209-2-6]
          Length = 186

 Score =  228 bits (580), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/172 (59%), Positives = 130/172 (75%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P+V F  RV     +GS  F+W+D  T D FA KRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 10  KLPEVTFKTRVRDESIEGSNPFRWEDKTTADYFADKRVVLFSLPGAFTPTCSTYQLPGFE 69

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             + D   EGI+E+YC+SVND+FVMN W +   ++NVK++PDGSGEFTRKMGMLV KDN+
Sbjct: 70  NGFADFAAEGIDEIYCMSVNDSFVMNKWAEAQNLENVKVIPDGSGEFTRKMGMLVAKDNL 129

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY A++ + VVE+WF E G SDN   DPY +SSPE VLK ++E+K
Sbjct: 130 GFGARSWRYAAIVNNGVVEAWFEEPGLSDNHGEDPYGVSSPETVLKHLKEAK 181


>gi|325293749|ref|YP_004279613.1| Peroxiredoxin [Agrobacterium sp. H13-3]
 gi|325061602|gb|ADY65293.1| Peroxiredoxin [Agrobacterium sp. H13-3]
          Length = 178

 Score =  226 bits (575), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (75%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P V F  RV      G   F+W+D+ + D F GK+V LF+LPGAFTPTCS +QL
Sbjct: 1   MLGKKVPAVTFRTRVRDEAVGGPNPFRWQDMTSDDYFKGKKVVLFSLPGAFTPTCSTYQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK+  + R  G++E+YCLSVNDAFVMNAW K   ++NVK++PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLAGEFRALGVDEIYCLSVNDAFVMNAWAKGQNLENVKVIPDGSGEFTRKMGMLVA 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           KDN+GFG+RSWRY A+I D +VE WF EEG+ DN  TDPY +SSP+N+L+ ++
Sbjct: 121 KDNLGFGMRSWRYAAVINDGLVEQWFEEEGYCDNSDTDPYGVSSPQNILENLK 173


>gi|126729190|ref|ZP_01745004.1| antioxidant, AhpC/Tsa family protein [Sagittula stellata E-37]
 gi|126710180|gb|EBA09232.1| antioxidant, AhpC/Tsa family protein [Sagittula stellata E-37]
          Length = 180

 Score =  224 bits (572), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 99/171 (57%), Positives = 127/171 (74%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V FH RV     +G   F+W+D+ T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPDVTFHTRVRDDSIEGPNPFRWQDMTTADYFAGKRVILFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             +   + +GI+ +YCLSVND+FVMN W K   I+NVK++PDGSGEFTRKMGMLV+KDN+
Sbjct: 66  NNFAAFQGQGIDAIYCLSVNDSFVMNQWAKAQGIENVKVIPDGSGEFTRKMGMLVHKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           GFG RSWRY A++ D  +E+WF E G  DNC  DPY  SSPEN++  + ++
Sbjct: 126 GFGARSWRYAAIVNDGAIEAWFEEPGLMDNCPDDPYGASSPENLMAHLTQA 176


>gi|86138369|ref|ZP_01056943.1| peroxiredoxin/glutaredoxin family protein [Roseobacter sp. MED193]
 gi|85824894|gb|EAQ45095.1| peroxiredoxin/glutaredoxin family protein [Roseobacter sp. MED193]
          Length = 182

 Score =  224 bits (571), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/173 (58%), Positives = 127/173 (73%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   F+W+D  T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPDVTFKTRVRDEAVGGPNPFRWEDKTTADYFAGKRVVLFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K Y D   EGI+ +YC+SVND+FVMN W +   ++NV ++PDGSGEFTRKMGMLV KDN+
Sbjct: 66  KGYADFHAEGIDGIYCMSVNDSFVMNKWAESQNLENVGVIPDGSGEFTRKMGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY A++ D VVE+WF E G  DN   DPY +SSPENV+K ++ +K+
Sbjct: 126 GFGARSWRYAAIVNDGVVEAWFEEPGLCDNHGEDPYGVSSPENVMKHLQAAKE 178


>gi|20804163|emb|CAD31366.1| CONSERVED HYPOTHETICAL-PEROXIREDOXIN 2 FAMILY PROTEIN
           [Mesorhizobium loti R7A]
          Length = 182

 Score =  224 bits (571), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 131/175 (74%)

Query: 2   IRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLP 61
           ++ ++P V F  RV     +G   ++W+D  + D F+GKR+ LF+LPGAFTPTCS  QLP
Sbjct: 3   VKKKVPFVTFRTRVRDESIEGPNPYRWEDKTSDDYFSGKRIILFSLPGAFTPTCSTLQLP 62

Query: 62  GFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYK 121
            FE +YD+   EGI+ +YC+SVNDAFVMNAWGK L +K V+L+PDGSGEFTRKMGMLV K
Sbjct: 63  DFEMLYDEFEKEGIDAIYCVSVNDAFVMNAWGKALGLKKVQLIPDGSGEFTRKMGMLVAK 122

Query: 122 DNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           DN+GFG+RSWRY A+I + VVE  F E GF DN   DPY +SSP+NVL+ +R +K
Sbjct: 123 DNLGFGMRSWRYAAVINNGVVEQCFEENGFCDNSEADPYGVSSPQNVLETLRAAK 177


>gi|260426044|ref|ZP_05780023.1| hybrid peroxiredoxin hyPrx5 [Citreicella sp. SE45]
 gi|260420536|gb|EEX13787.1| hybrid peroxiredoxin hyPrx5 [Citreicella sp. SE45]
          Length = 180

 Score =  224 bits (570), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 99/171 (57%), Positives = 128/171 (74%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV     +G   F+W+D+ T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPDVTFRTRVRDESIEGPNPFRWQDMTTADYFAGKRVILFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             +++ +  GI+E+YCLSVND+FVMN W K   IKNVK++PDGSGEFTR+MGMLV KDN+
Sbjct: 66  NNFEEFKANGIDEIYCLSVNDSFVMNQWAKAQGIKNVKVIPDGSGEFTRRMGMLVNKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           GFG RSWRY A++ + V+E+WF E G  DNC  DPY  SSPE +L  ++++
Sbjct: 126 GFGPRSWRYAAIVNNGVIEAWFEEPGLMDNCPDDPYGESSPETLLSYLKQA 176


>gi|254292493|ref|YP_003058516.1| redoxin [Hirschia baltica ATCC 49814]
 gi|254041024|gb|ACT57819.1| Redoxin domain protein [Hirschia baltica ATCC 49814]
          Length = 172

 Score =  221 bits (562), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 100/170 (58%), Positives = 124/170 (72%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MI  Q+P+V FH RV      G   F+W+D  + D FAGK+V LF+LPGAFTPTCS +QL
Sbjct: 1   MIGRQVPKVTFHTRVRDESIGGDNPFRWEDKTSDDYFAGKKVVLFSLPGAFTPTCSTYQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FEK++ + + +G++ +YC+SVND FVMNAW K   + NV ++PDGSGEFTRKMGMLV 
Sbjct: 61  PDFEKLFPEFQAKGVDAIYCMSVNDTFVMNAWAKGQGLNNVSVIPDGSGEFTRKMGMLVN 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           KDN+GFG RSWRY A++ D  V  WF E GF DNC  DPY  SSP+NVLK
Sbjct: 121 KDNLGFGARSWRYAAIVDDGKVTKWFEEPGFEDNCGEDPYGESSPQNVLK 170


>gi|260575047|ref|ZP_05843048.1| Redoxin domain protein [Rhodobacter sp. SW2]
 gi|259022669|gb|EEW25964.1| Redoxin domain protein [Rhodobacter sp. SW2]
          Length = 182

 Score =  219 bits (557), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 125/169 (73%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   ++W+D+ T D F GKRV LFALPGAFTPTCS +QLPGFE
Sbjct: 6   RLPDVTFQTRVRDDSIAGPNPYRWQDMTTADYFGGKRVVLFALPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K +DD    GI+ +YCLSVNDAFVMN W K   +KNV+++PDGSG FTR++GMLV KDN+
Sbjct: 66  KGFDDFAALGIDAIYCLSVNDAFVMNQWAKAQGLKNVQVIPDGSGAFTRRVGMLVRKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFGLRSWRY A+++D VVE+WF E G +DN   DPY +SSP+ VL  +R
Sbjct: 126 GFGLRSWRYAAVVRDGVVEAWFEEPGLADNHEADPYGVSSPDTVLGWLR 174


>gi|114762729|ref|ZP_01442163.1| antioxidant, AhpC/Tsa family protein [Pelagibaca bermudensis
           HTCC2601]
 gi|114544639|gb|EAU47645.1| antioxidant, AhpC/Tsa family protein [Roseovarius sp. HTCC2601]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 123/169 (72%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   F+W+D+ T D FAGKRV LFALPGAFTPTCS +QLPGFE
Sbjct: 6   KLPDVTFRTRVRDEAVGGPNPFRWQDMTTADYFAGKRVVLFALPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             + D +  G++E+YCLSVND+F MN W +   I NVK++PDGSG+FTR+MGMLV KDN+
Sbjct: 66  NGFADFQAAGVDEIYCLSVNDSFTMNKWAELQGISNVKVIPDGSGDFTRRMGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY A++ D V+E+WF E G  DNC  DPY +SSPE +L  ++
Sbjct: 126 GFGARSWRYAAVVNDGVIEAWFEEPGLMDNCPDDPYGVSSPETLLAYLQ 174


>gi|163741124|ref|ZP_02148516.1| peroxiredoxin/glutaredoxin family protein [Phaeobacter
           gallaeciensis 2.10]
 gi|161385477|gb|EDQ09854.1| peroxiredoxin/glutaredoxin family protein [Phaeobacter
           gallaeciensis 2.10]
          Length = 183

 Score =  216 bits (551), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 98/172 (56%), Positives = 126/172 (73%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   F+W+D  T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 7   KLPDVTFRTRVRDESVGGPNPFRWEDKTTADYFAGKRVVLFSLPGAFTPTCSTYQLPGFE 66

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K + D + EGI+ +YC+SVND+FVMN W +   +KNV ++PDGSGEFTR++GMLV KDN+
Sbjct: 67  KGFADFQAEGIDAIYCMSVNDSFVMNKWAESQNLKNVGVIPDGSGEFTRRIGMLVAKDNL 126

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY A++ + VVE+WF E G  DN   DPY +SSPE VL+ ++ +K
Sbjct: 127 GFGNRSWRYAAIVDNGVVEAWFEEPGLCDNHGEDPYGVSSPETVLEHLKTAK 178


>gi|163736341|ref|ZP_02143760.1| peroxiredoxin/glutaredoxin family protein [Phaeobacter
           gallaeciensis BS107]
 gi|161390211|gb|EDQ14561.1| peroxiredoxin/glutaredoxin family protein [Phaeobacter
           gallaeciensis BS107]
          Length = 182

 Score =  216 bits (550), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 98/172 (56%), Positives = 126/172 (73%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   F+W+D  T D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   KLPDVTFRTRVRDESVGGPNPFRWEDKTTADYFAGKRVVLFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K + D + EGI+ +YC+SVND+FVMN W +   +KNV ++PDGSGEFTR++GMLV KDN+
Sbjct: 66  KGFADFQAEGIDAIYCMSVNDSFVMNKWAESQNLKNVGVIPDGSGEFTRRIGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY A++ + VVE+WF E G  DN   DPY +SSPE VL+ ++ +K
Sbjct: 126 GFGNRSWRYAAIVDNGVVEAWFEEPGLCDNHGEDPYGVSSPETVLEHLKTAK 177


>gi|56696971|ref|YP_167333.1| anti-oxidant AhpCTSA family protein [Ruegeria pomeroyi DSS-3]
 gi|56678708|gb|AAV95374.1| antioxidant, AhpC/Tsa family [Ruegeria pomeroyi DSS-3]
          Length = 182

 Score =  216 bits (549), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 121/166 (72%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P V+FH RV      G   ++W+D+ T   FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   SLPNVIFHTRVRDEAVGGPNPYRWQDMTTAAYFAGKRVVLFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             + D + +GI+ +YC+SVND+FVMN W +   +KNV ++PDGSGEFTRKMGMLV KDN+
Sbjct: 66  NGFADFQNQGIDAIYCMSVNDSFVMNKWAEAQGLKNVTVIPDGSGEFTRKMGMLVDKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           GFG RSWRY A++ D  +E+WF E G  DNC  DPY ++SPE VL 
Sbjct: 126 GFGFRSWRYAAIVNDGKIEAWFEEPGLMDNCPEDPYGVTSPETVLN 171


>gi|288960002|ref|YP_003450342.1| peroxiredoxin [Azospirillum sp. B510]
 gi|288912310|dbj|BAI73798.1| peroxiredoxin [Azospirillum sp. B510]
          Length = 175

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 126/170 (74%), Gaps = 1/170 (0%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV      G   F+W+DV + +LF GKRV LF+LPGAFTPTCS+ Q P FE
Sbjct: 5   KVPSVVFKTRVRDESVGGPNPFRWQDVRSDELFQGKRVVLFSLPGAFTPTCSNEQCPAFE 64

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++YDD +  G++EVYCLSVNDAFVM  WGK L +KNVKL+PDGSG FTR+MGML+ KD++
Sbjct: 65  RLYDDFKALGVDEVYCLSVNDAFVMFQWGKSLNLKNVKLIPDGSGHFTRRMGMLIDKDHL 124

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCAT-DPYEISSPENVLKVIR 173
           GFG RSWRY  ++KD VVE WF E G +D+    DPY  SSPEN+L  +R
Sbjct: 125 GFGFRSWRYAMVVKDGVVEKWFEEPGINDDGENGDPYGESSPENMLAYLR 174


>gi|77463335|ref|YP_352839.1| peroxiredoxin/glutaredoxin family protein [Rhodobacter sphaeroides
           2.4.1]
 gi|126462191|ref|YP_001043305.1| redoxin domain-containing protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|77387753|gb|ABA78938.1| peroxiredoxin/glutaredoxin family protein [Rhodobacter sphaeroides
           2.4.1]
 gi|126103855|gb|ABN76533.1| Redoxin domain protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 182

 Score =  215 bits (548), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 98/166 (59%), Positives = 124/166 (74%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   F+W+D+ T+D FAGKR  LFALPGAFTPTCS +QLPGFE
Sbjct: 6   KLPSVTFRTRVRDDSLGGPNPFRWQDMTTEDYFAGKRCVLFALPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K + D +  GI+ +YCLSVND+FVMN W K   ++NV+++PDGSGEFTR++GMLV KDN+
Sbjct: 66  KGFADFQAHGIDAIYCLSVNDSFVMNQWAKAQGLENVQVIPDGSGEFTRRVGMLVRKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           GFGLRSWRY A++KD  VE+WF E G  DN   DPY +SSP+ VL+
Sbjct: 126 GFGLRSWRYAAIVKDGRVEAWFEEPGLCDNHGEDPYGVSSPDTVLE 171


>gi|332558213|ref|ZP_08412535.1| redoxin domain-containing protein [Rhodobacter sphaeroides WS8N]
 gi|332275925|gb|EGJ21240.1| redoxin domain-containing protein [Rhodobacter sphaeroides WS8N]
          Length = 182

 Score =  215 bits (547), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 123/165 (74%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   F+W+D+ T+D FAGKR  LFALPGAFTPTCS +QLPGFE
Sbjct: 6   KLPSVTFRTRVRDDSLGGPNPFRWQDMTTEDYFAGKRCVLFALPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K + D +  GI+ +YCLSVND+FVMN W K   ++NV+++PDGSGEFTR++GMLV KDN+
Sbjct: 66  KGFADFQAHGIDAIYCLSVNDSFVMNQWAKAQGLENVQVIPDGSGEFTRRVGMLVRKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
           GFGLRSWRY A++KD  VE+WF E G  DN   DPY +SSP+ VL
Sbjct: 126 GFGLRSWRYAAIVKDGRVEAWFEEPGLCDNHGEDPYGVSSPDTVL 170


>gi|84686939|ref|ZP_01014823.1| peroxiredoxin/glutaredoxin family protein [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665136|gb|EAQ11616.1| peroxiredoxin/glutaredoxin family protein [Rhodobacterales
           bacterium HTCC2654]
          Length = 181

 Score =  214 bits (545), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 99/171 (57%), Positives = 124/171 (72%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP   F  RV      G   F+W+D+ + D FAGKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   RIPACTFKTRVRDESVGGPNPFRWQDMTSDDYFAGKRVVLFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           K + D   +GI+E+YC+SVND+FVMN W     + NVK++PDGSGEFT+ MGMLV KDN+
Sbjct: 66  KGFSDFAAQGIDEIYCMSVNDSFVMNKWAIDQGLTNVKVIPDGSGEFTKAMGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           GFG RSWRY A++ D V+E+ FVE G  DN   DPY  SSPENVLK ++E+
Sbjct: 126 GFGARSWRYAAIVNDGVIEALFVEPGMCDNHGEDPYGESSPENVLKWLKEN 176


>gi|163746220|ref|ZP_02153578.1| peroxiredoxin/glutaredoxin family protein [Oceanibulbus indolifex
           HEL-45]
 gi|161380105|gb|EDQ04516.1| peroxiredoxin/glutaredoxin family protein [Oceanibulbus indolifex
           HEL-45]
          Length = 182

 Score =  212 bits (539), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 95/173 (54%), Positives = 124/173 (71%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P V F  RV     +G+  F+W+D  ++D F GKRV LF+LPGAFTPTCS +QLPGFE
Sbjct: 6   QVPNVTFKTRVRDDSIEGNNPFRWEDKTSEDFFKGKRVVLFSLPGAFTPTCSTYQLPGFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             +   +  GI+ +YCLSVND+FVMN W +   ++N+ ++PDGSGEFTR+MGMLV KDN+
Sbjct: 66  NNFAAFQEHGIDGIYCLSVNDSFVMNKWKEMQGVENIDVIPDGSGEFTRRMGMLVAKDNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY A++ D  +E+WF E G SDN   DPY +SSPE VL+ +   KK
Sbjct: 126 GFGARSWRYAAIVNDGQIEAWFEEPGISDNHGDDPYGVSSPETVLEYLENQKK 178


>gi|221639186|ref|YP_002525448.1| redoxin domain-containing protein [Rhodobacter sphaeroides KD131]
 gi|221159967|gb|ACM00947.1| Redoxin domain protein [Rhodobacter sphaeroides KD131]
          Length = 173

 Score =  209 bits (533), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 121/162 (74%)

Query: 9   VVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           + F  RV      G   F+W+D+ T+D FAGKR  LFALPGAFTPTCS +QLPGFEK + 
Sbjct: 1   MTFRTRVRDDSLGGPNPFRWQDMTTEDYFAGKRCVLFALPGAFTPTCSTYQLPGFEKGFA 60

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
           D +  GI+ +YCLSVND+FVMN W K   ++NV+++PDGSGEFTR++GMLV KDN+GFGL
Sbjct: 61  DFQAHGIDAIYCLSVNDSFVMNQWAKAQGLENVQVIPDGSGEFTRRVGMLVRKDNLGFGL 120

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           RSWRY A++KD  VE+WF E G  DN   DPY +SSP+ VL+
Sbjct: 121 RSWRYAAIVKDGRVEAWFEEPGLCDNHGEDPYGVSSPDTVLE 162


>gi|254424374|ref|ZP_05038092.1| Redoxin superfamily [Synechococcus sp. PCC 7335]
 gi|196191863|gb|EDX86827.1| Redoxin superfamily [Synechococcus sp. PCC 7335]
          Length = 190

 Score =  209 bits (531), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 125/169 (73%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P+VVF  RV     +G   ++W+D  T+D+FAGK+V +F+LPGAFTPTCS + LP +E
Sbjct: 6   KVPKVVFKTRVRDESVEGPNPYRWQDTTTEDIFAGKKVIVFSLPGAFTPTCSSNHLPRYE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++YD+ + +G++++YC+SVNDAFVM  WGK+     VKLLPDG+GEFTRKMGMLV K N+
Sbjct: 66  ELYDEFKAQGVDDIYCISVNDAFVMFQWGKQQGASKVKLLPDGNGEFTRKMGMLVDKSNI 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG+RSWRY  L+ DM +E  F E    DNC TDP+E+S  + +L  ++
Sbjct: 126 GFGMRSWRYSMLVNDMTIEKIFSEPDMGDNCPTDPFEVSDADTMLAYLK 174


>gi|113474068|ref|YP_720129.1| redoxin [Trichodesmium erythraeum IMS101]
 gi|110165116|gb|ABG49656.1| Redoxin [Trichodesmium erythraeum IMS101]
          Length = 189

 Score =  209 bits (531), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 126/173 (72%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P VVF  RV     DG   F+W+D  TQ++F GKRV LFALPGAFTPTCS   L
Sbjct: 1   MVIDKVPDVVFKTRVRDESVDGPNPFRWQDKTTQEIFGGKRVVLFALPGAFTPTCSSTHL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P +E++Y++ + +GI+E+ CLSVNDAFVM  WGK+   KNV LLPDG+GEF+RKMGMLV 
Sbjct: 61  PRYEELYNEFKGQGIDEIICLSVNDAFVMFQWGKQQGSKNVFLLPDGNGEFSRKMGMLVE 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K N+GFG+RSWRY  ++ D  +E  FVEEGF+DN   DP+E+S  + VL  ++
Sbjct: 121 KSNLGFGMRSWRYAMVVNDCTIEKMFVEEGFADNYGDDPFEVSDADTVLAFLK 173


>gi|113954203|ref|YP_729907.1| peroxiredoxin [Synechococcus sp. CC9311]
 gi|113881554|gb|ABI46512.1| peroxiredoxin 2 family protein [Synechococcus sp. CC9311]
          Length = 192

 Score =  206 bits (525), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 126/171 (73%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P VVFH RV      G+  F WKD ++ ++F  K+V LF+LPGAFTPTCS + LP +E
Sbjct: 9   QVPDVVFHTRVRDESVGGTNPFVWKDRSSAEIFHNKKVVLFSLPGAFTPTCSSNHLPRYE 68

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++YD+ R +G+++V CLSVNDAFVM  WGK + +KN+ LLPDG+GEFTRKMGMLV KDN+
Sbjct: 69  ELYDEFRSQGVDQVICLSVNDAFVMFQWGKHIGVKNIFLLPDGNGEFTRKMGMLVSKDNL 128

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           GFG+RSWRY  L+ +  +E  F+E GF+D C  DP+E+S  + ++  ++ S
Sbjct: 129 GFGMRSWRYSMLVDNGTIEKIFIEPGFADCCPDDPFEVSDADTMIAYLKGS 179


>gi|119510642|ref|ZP_01629771.1| membrane protein [Nodularia spumigena CCY9414]
 gi|119464693|gb|EAW45601.1| membrane protein [Nodularia spumigena CCY9414]
          Length = 176

 Score =  206 bits (525), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 92/171 (53%), Positives = 124/171 (72%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV      G   F+W+D  TQD+FAGKR+ +F+LPGAFTPTCS   LP +E
Sbjct: 6   KVPNVVFKTRVRDESIGGPNPFRWEDRTTQDVFAGKRIVVFSLPGAFTPTCSTSHLPRYE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++YD  +  G+++V C+SVNDAFVM  WGK+    NVKLLPDG+GEFTRKMGMLV K N+
Sbjct: 66  ELYDQFKALGVDDVVCVSVNDAFVMFQWGKQQGATNVKLLPDGNGEFTRKMGMLVDKSNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           GFGLRSWRY  ++ D  +E  F+E G+ DNC TDP+E+S  + +L  ++++
Sbjct: 126 GFGLRSWRYSMVVNDGKIEKIFIEAGYEDNCPTDPFEVSDADTMLNYLKQA 176


>gi|77164827|ref|YP_343352.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant
           [Nitrosococcus oceani ATCC 19707]
 gi|254433852|ref|ZP_05047360.1| Redoxin superfamily [Nitrosococcus oceani AFC27]
 gi|76883141|gb|ABA57822.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant
           [Nitrosococcus oceani ATCC 19707]
 gi|207090185|gb|EDZ67456.1| Redoxin superfamily [Nitrosococcus oceani AFC27]
          Length = 190

 Score =  206 bits (525), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 87/168 (51%), Positives = 125/168 (74%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P   F  RV     +GS  ++W+D+ ++++FAGK+V +F+LPGAFTPTCS + LP +E+
Sbjct: 7   VPDATFKTRVRDESLEGSNPYRWQDITSKEIFAGKKVIVFSLPGAFTPTCSSNHLPRYEE 66

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +YD+ +  GI+E+YC+SVNDAFVM  W + +E K VK+LPDG+GEFTRKMGMLV K N+G
Sbjct: 67  LYDEFKAMGIDEIYCISVNDAFVMFQWSRHMEAKKVKMLPDGNGEFTRKMGMLVDKSNLG 126

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG+R+WRY  L+ D  +E  FVE  FSDNC TDP+++S  + +L  ++
Sbjct: 127 FGMRAWRYSMLVDDGKIEELFVEPDFSDNCPTDPFQVSDADTMLAALK 174


>gi|67923152|ref|ZP_00516641.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Crocosphaera watsonii WH 8501]
 gi|67854994|gb|EAM50264.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Crocosphaera watsonii WH 8501]
          Length = 190

 Score =  206 bits (524), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 92/168 (54%), Positives = 124/168 (73%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P VVF  RV      G   F+W+DV T+++F GK+V +F+LPGAFTPTCS + LP +E+
Sbjct: 7   VPSVVFKTRVRDESVPGPNPFRWQDVTTEEIFKGKKVIVFSLPGAFTPTCSSNHLPRYEE 66

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +Y++ +  G++++ C+SVNDAFVM  WGK+ E KNV LLPDG+GEFTRKMGMLV K N+G
Sbjct: 67  LYEEFKGLGVDQIICVSVNDAFVMFQWGKQQEAKNVSLLPDGNGEFTRKMGMLVEKSNLG 126

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG+RSWRY  L+ D  VE  FVE  FSDNC TDP+E+S  + +L  ++
Sbjct: 127 FGMRSWRYSMLVNDCKVEKMFVEPDFSDNCPTDPFEVSDADTMLAYLK 174


>gi|254415214|ref|ZP_05028976.1| Redoxin superfamily [Microcoleus chthonoplastes PCC 7420]
 gi|196178020|gb|EDX73022.1| Redoxin superfamily [Microcoleus chthonoplastes PCC 7420]
          Length = 190

 Score =  206 bits (524), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 91/169 (53%), Positives = 124/169 (73%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P  VF  RV      GS  ++W+D  TQ++F GK+V +F+LPGAFTPTCS + LP +E
Sbjct: 6   RVPDAVFKTRVRDESVGGSNPYRWQDRTTQEIFGGKKVVVFSLPGAFTPTCSSNHLPRYE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++YD+ + +GI+E+ CLSVNDAFVM  WGK+   KNV LLPDG+GEFTRKMGMLV K N+
Sbjct: 66  ELYDEFKAQGIDEIICLSVNDAFVMFQWGKQQGAKNVLLLPDGNGEFTRKMGMLVDKSNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG+RSWRY  L+ D  +E +F E G+SDNC  DP+E+S  + +L  ++
Sbjct: 126 GFGMRSWRYSMLVNDGKIEKFFAEPGYSDNCPDDPFEVSDADTMLASLK 174


>gi|254282280|ref|ZP_04957248.1| hybrid peroxiredoxin hyPrx5 [gamma proteobacterium NOR51-B]
 gi|219678483|gb|EED34832.1| hybrid peroxiredoxin hyPrx5 [gamma proteobacterium NOR51-B]
          Length = 189

 Score =  205 bits (522), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 124/173 (71%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M    +P V F  RV     +G   F+W+D  +QD+F GK+V LF+LPGAFTPTCS + L
Sbjct: 1   MHPISVPNVTFKTRVRDESVEGDNPFRWEDQTSQDIFGGKKVVLFSLPGAFTPTCSSNHL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P ++++Y++ + EG++EV C+SVNDAFVM  WGK++  KN+ LLPDG+ EFTRKMGMLV 
Sbjct: 61  PRYDELYEEFKKEGVDEVICISVNDAFVMYKWGKEIGNKNIFLLPDGNAEFTRKMGMLVD 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K N+GFG+RSWRY ALI D  +E  F E G+ DNC TDP+E+S  + +L  +R
Sbjct: 121 KSNLGFGMRSWRYSALINDGKIEKVFAEAGYDDNCPTDPFEVSDADTMLAHLR 173


>gi|284929048|ref|YP_003421570.1| peroxiredoxin [cyanobacterium UCYN-A]
 gi|284809507|gb|ADB95212.1| peroxiredoxin [cyanobacterium UCYN-A]
          Length = 190

 Score =  205 bits (521), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 92/171 (53%), Positives = 125/171 (73%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P VVF  RV      G   ++W+D+ T+++F GK+V +F+LPGAFTPTCS + LP +E+
Sbjct: 7   VPSVVFKTRVRDESVPGPNPYRWQDLTTEEIFKGKKVVVFSLPGAFTPTCSSNHLPRYEE 66

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +Y++ +  G++ + CLSVNDAFVM  WGK+ E KNV LLPDGSGEFTRKMGMLV K N+G
Sbjct: 67  LYNEFKASGVDTIICLSVNDAFVMFQWGKQQEAKNVFLLPDGSGEFTRKMGMLVDKSNLG 126

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           FG+RSWRY  L+ +  VE  FVE GFSDNC +DP+E+S  + +L  ++  K
Sbjct: 127 FGMRSWRYSMLVDNCKVEKIFVESGFSDNCPSDPFEVSDADTMLAYLKGDK 177


>gi|282896789|ref|ZP_06304795.1| Glutaredoxin-like protein region protein [Raphidiopsis brookii D9]
 gi|281198198|gb|EFA73088.1| Glutaredoxin-like protein region protein [Raphidiopsis brookii D9]
          Length = 177

 Score =  205 bits (521), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 124/171 (72%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P VVF  RV   L  GS  F+W+D  T+ LFAGKRV +F+LPGAFTPTCS   LP +E+
Sbjct: 7   VPDVVFKTRVRDELIGGSNPFRWQDRTTEQLFAGKRVVVFSLPGAFTPTCSTSHLPRYEE 66

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +YD+ +  G++EV C+SVNDAFVM  WGK+   + V LLPDG+GEFTRKMGMLV K N+G
Sbjct: 67  LYDEFKSLGVDEVICVSVNDAFVMYQWGKQQGAQKVFLLPDGNGEFTRKMGMLVDKSNLG 126

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           FG+RSWRY  ++ +  +E  F+E G+ DNC TDP+E+S  + +LK ++  K
Sbjct: 127 FGMRSWRYSMVVNNCQIEKIFIEPGYEDNCPTDPFEVSDADTMLKYLQSVK 177


>gi|282900385|ref|ZP_06308335.1| Glutaredoxin-like protein region protein [Cylindrospermopsis
           raciborskii CS-505]
 gi|281194698|gb|EFA69645.1| Glutaredoxin-like protein region protein [Cylindrospermopsis
           raciborskii CS-505]
          Length = 177

 Score =  205 bits (521), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 94/171 (54%), Positives = 123/171 (71%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P VVF  RV   L  G   F+W+D  TQ LFAGKRV +F+LPGAFTPTCS   LP +E+
Sbjct: 7   VPDVVFKTRVRDELIGGPNPFRWQDRTTQQLFAGKRVVVFSLPGAFTPTCSTSHLPRYEE 66

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +YD+ +  G++EV C+SVNDAFVM  WGK+   + V LLPDG+GEFTRKMGMLV K N+G
Sbjct: 67  LYDEFKSLGVDEVICVSVNDAFVMYQWGKQQGAQKVFLLPDGNGEFTRKMGMLVDKSNLG 126

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           FG+RSWRY  ++ +  +E  FVE G+ DNC TDP+E+S  + +LK ++  K
Sbjct: 127 FGMRSWRYSMVVNNCQIEKIFVEPGYEDNCPTDPFEVSDADTMLKYLQSVK 177


>gi|300113884|ref|YP_003760459.1| redoxin domain-containing protein [Nitrosococcus watsonii C-113]
 gi|299539821|gb|ADJ28138.1| Redoxin domain protein [Nitrosococcus watsonii C-113]
          Length = 190

 Score =  204 bits (520), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 123/167 (73%)

Query: 7   PQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKI 66
           P   F  RV     +GS  ++W+D+ ++++F GK+V +F+LPGAFTPTCS + LP +E++
Sbjct: 8   PDATFKTRVRDESIEGSNPYRWQDITSKEIFTGKKVIVFSLPGAFTPTCSSNHLPRYEEL 67

Query: 67  YDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           YD+ +  GI+E+YCLSVNDAFVM  W + +E K VK+LPDG+GEFTRKMGMLV K N+GF
Sbjct: 68  YDEFKAMGIDEIYCLSVNDAFVMFQWSRHIEAKKVKMLPDGNGEFTRKMGMLVDKSNLGF 127

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           G+R+WRY  L+ D  +E  FVE  FSDNC TDP+++S  + +L  ++
Sbjct: 128 GMRAWRYSMLVDDGKIEELFVEPDFSDNCPTDPFQVSDADTMLAALK 174


>gi|254430351|ref|ZP_05044054.1| hybrid peroxiredoxin hyPrx5 [Cyanobium sp. PCC 7001]
 gi|197624804|gb|EDY37363.1| hybrid peroxiredoxin hyPrx5 [Cyanobium sp. PCC 7001]
          Length = 190

 Score =  204 bits (520), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 121/169 (71%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   ++W+D+ T+D+FAGKRV +F+LPGAFTPTCS + LP +E
Sbjct: 6   RVPSVTFKTRVRDTSVPGPNPYRWQDLTTEDIFAGKRVVVFSLPGAFTPTCSSNHLPRYE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y+D R EGI+++ CLSVNDAFVM  WG+ +    V LLPDG+GEFTRKMGMLV K N+
Sbjct: 66  ELYEDFRAEGIDQIICLSVNDAFVMFQWGRHVGADKVFLLPDGNGEFTRKMGMLVDKSNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFGLRSWRY  L+ D  +E  FVE  F DNC  DP+E+S  + +L  +R
Sbjct: 126 GFGLRSWRYSMLVNDGRIEKIFVEPDFGDNCPLDPFEVSDADTMLAYLR 174


>gi|262199801|ref|YP_003271010.1| redoxin [Haliangium ochraceum DSM 14365]
 gi|262083148|gb|ACY19117.1| Redoxin domain protein [Haliangium ochraceum DSM 14365]
          Length = 189

 Score =  203 bits (517), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 95/177 (53%), Positives = 122/177 (68%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M R  +P V F  RV      G   F+W+DV + DLF GKR+  FALPGAFTPTCS   L
Sbjct: 13  MDRNTVPNVTFKTRVRDESVGGENPFRWQDVTSDDLFKGKRIAFFALPGAFTPTCSSTHL 72

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           PG+E+ YD+ R  GI+EV CLSVNDAF M  W K L +K V +LPDG+G+FTR+MGMLV 
Sbjct: 73  PGYEQHYDEFRELGIDEVICLSVNDAFTMFQWAKHLGVKKVFMLPDGNGDFTRRMGMLVR 132

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           K N+GFG RSWRY  ++ D  +E  F+EEG  D+C TDP+ +S  + +LK ++E+KK
Sbjct: 133 KTNLGFGDRSWRYSMVVDDGKIEKMFIEEGGMDDCPTDPFAVSDADTMLKYLKENKK 189


>gi|119384118|ref|YP_915174.1| redoxin domain-containing protein [Paracoccus denitrificans PD1222]
 gi|119373885|gb|ABL69478.1| Redoxin domain protein [Paracoccus denitrificans PD1222]
          Length = 188

 Score =  203 bits (517), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P+V F  RV      G   ++W+ V T D F GKRV LF+LPGAFTPTCS +QLPGFEK
Sbjct: 13  LPEVTFQTRVRDESVGGPNPYRWQPVTTADYFKGKRVVLFSLPGAFTPTCSTYQLPGFEK 72

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
              ++   GI+ +YC+SVND+FVMN W K   + NVK++PDGSG FT K+GMLV KDN+G
Sbjct: 73  AAGEMAELGIDAIYCMSVNDSFVMNQWAKAQNLSNVKVIPDGSGAFTEKVGMLVRKDNLG 132

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG RSWRY A++ D  +E+WF E G  D+C  DPY  SSPE+VL  +R
Sbjct: 133 FGARSWRYAAIVDDGRIEAWFEEPGRCDDCPEDPYGASSPESVLDWLR 180


>gi|172038039|ref|YP_001804540.1| peroxiredoxin [Cyanothece sp. ATCC 51142]
 gi|171699493|gb|ACB52474.1| peroxiredoxin [Cyanothece sp. ATCC 51142]
          Length = 190

 Score =  203 bits (516), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 89/168 (52%), Positives = 123/168 (73%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P VVF  RV      G   ++W+D+ ++++F GK+V +F+LPGAFTPTCS + LP +E+
Sbjct: 7   VPSVVFKTRVRDESVPGPNPYRWQDLTSEEIFKGKKVIVFSLPGAFTPTCSSNHLPRYEE 66

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +YD+ +  G++EV C+SVNDAF M  WGK+ E KNV LLPDG+GEFTRKMGMLV K N+G
Sbjct: 67  LYDEFKALGVDEVICISVNDAFTMFQWGKQQEAKNVFLLPDGNGEFTRKMGMLVDKSNLG 126

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG+RSWRY  L+ D  +E  FVE G+ DNC TDP+E+S  + +L  ++
Sbjct: 127 FGMRSWRYSMLVNDCKIEKMFVEPGYEDNCPTDPFEVSDADTMLAYLK 174


>gi|126654766|ref|ZP_01726300.1| membrane protein [Cyanothece sp. CCY0110]
 gi|126623501|gb|EAZ94205.1| membrane protein [Cyanothece sp. CCY0110]
          Length = 190

 Score =  203 bits (516), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 125/168 (74%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P VVF  RV      G   ++W+D+ ++++F GK+V +F+LPGAFTPTCS + LP +E+
Sbjct: 7   VPNVVFKTRVRDESVPGPNPYRWQDLTSEEIFKGKKVIVFSLPGAFTPTCSSNHLPRYEE 66

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +YD+ +  G+++V C+SVNDAFVM  WG++ E KNV LLPDG+GEFTRKMGMLV K N+G
Sbjct: 67  LYDEFKALGVDQVICISVNDAFVMFQWGRQQEAKNVFLLPDGNGEFTRKMGMLVDKSNLG 126

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG+RSWRY  L+ D  +E  FVE G++DNC TDP+E+S  + +L  ++
Sbjct: 127 FGMRSWRYSMLVNDCKIEKMFVEPGYNDNCPTDPFEVSDADTMLAYLK 174


>gi|254481709|ref|ZP_05094952.1| Redoxin superfamily protein [marine gamma proteobacterium HTCC2148]
 gi|214037838|gb|EEB78502.1| Redoxin superfamily protein [marine gamma proteobacterium HTCC2148]
          Length = 201

 Score =  201 bits (511), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 122/169 (72%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   ++W+D  T DLFAGKRV +F+LPGAFTPTCS + LP +E
Sbjct: 17  KLPNVTFKTRVHDESVPGPNPYRWEDKCTDDLFAGKRVVVFSLPGAFTPTCSSNHLPRYE 76

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            ++++ + +G++ + C+SVNDAFVM  WGK++  +NV LLPDG+GEFTRKMGMLV K NV
Sbjct: 77  ALFEEFKTQGVDSIICVSVNDAFVMFQWGKQIGNENVALLPDGNGEFTRKMGMLVDKSNV 136

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG+RSWRY  L+ D  +E  FVE  F+DNC TDP+E+S  + +L  I+
Sbjct: 137 GFGMRSWRYSMLVNDRKIEKMFVEPDFADNCPTDPFEVSDADTMLAYIK 185


>gi|170077415|ref|YP_001734053.1| AhpC/TSA family protein [Synechococcus sp. PCC 7002]
 gi|169885084|gb|ACA98797.1| AhpC/TSA family protein [Synechococcus sp. PCC 7002]
          Length = 187

 Score =  201 bits (510), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 123/169 (72%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV     +G   ++W+D  T D+F GK+V LF+LPGAFTPTCS + LP +E
Sbjct: 3   RVPDVVFKTRVRDESVEGPNPYRWEDKTTADIFGGKKVVLFSLPGAFTPTCSSNHLPRYE 62

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y + + +G++E+ CLSVNDAFVM  WGK++    V LLPDG+GEFTRKMGMLV K N+
Sbjct: 63  ELYSEFQAQGVDEIICLSVNDAFVMFKWGKEIGADKVFLLPDGNGEFTRKMGMLVEKSNL 122

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG+RSWRY  L++D  ++  FVE  FSDNC TDP+E+S  + +L  I+
Sbjct: 123 GFGMRSWRYSMLVEDGEIKKMFVEPDFSDNCPTDPFEVSDADTMLAYIK 171


>gi|284054377|ref|ZP_06384587.1| peroxiredoxin, putative [Arthrospira platensis str. Paraca]
 gi|291570822|dbj|BAI93094.1| putative peroxiredoxin [Arthrospira platensis NIES-39]
          Length = 174

 Score =  199 bits (507), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/173 (52%), Positives = 123/173 (71%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P VVF  RV      G   F+W+D  TQ++F GKRV +F+LPGAFTPTCS   L
Sbjct: 1   MVIEKVPDVVFKTRVRDESVGGPNPFRWQDRTTQEIFGGKRVVVFSLPGAFTPTCSSTHL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P +E++YD+++ +GI+E+ C+SVNDAFVM  WGK+     V LLPDG+GEFTRKMGMLV 
Sbjct: 61  PRYEELYDEIKAQGIDEIVCVSVNDAFVMFQWGKQQGADKVFLLPDGNGEFTRKMGMLVD 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K N+GFG+RSWRY  ++ D  +E  FVE  F DNC TDP+E+S  + +L  ++
Sbjct: 121 KSNLGFGMRSWRYSMVVNDGKIEKIFVEPDFGDNCPTDPFEVSDADTMLAYLK 173


>gi|209524930|ref|ZP_03273475.1| Redoxin domain protein [Arthrospira maxima CS-328]
 gi|209494579|gb|EDZ94889.1| Redoxin domain protein [Arthrospira maxima CS-328]
          Length = 174

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/173 (52%), Positives = 124/173 (71%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+  ++P VVF  RV      G   F+W+D  TQ++F GKRV +F+LPGAFTPTCS   L
Sbjct: 1   MVIEKVPDVVFKTRVRDESVGGPNPFRWQDRTTQEIFGGKRVVVFSLPGAFTPTCSSTHL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P +E++YD+++ +GI+E+ C+SVNDAFVM  WGK+   + V LLPDG+GEFTRKMGMLV 
Sbjct: 61  PRYEELYDEIKGQGIDEIVCVSVNDAFVMFQWGKQQGAEKVFLLPDGNGEFTRKMGMLVD 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K N+GFG+RSWRY  ++ D  +E  FVE  F DNC TDP+E+S  + +L  ++
Sbjct: 121 KSNLGFGMRSWRYSMVVNDGKIEKIFVEPDFGDNCPTDPFEVSDADTMLAYLK 173


>gi|220907016|ref|YP_002482327.1| Peroxiredoxin [Cyanothece sp. PCC 7425]
 gi|219863627|gb|ACL43966.1| Peroxiredoxin [Cyanothece sp. PCC 7425]
          Length = 190

 Score =  198 bits (504), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 124/172 (72%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      G   ++W+D+ T+D+F GK+V +F+LPGAFTPTCS + LP +E
Sbjct: 6   RVPNVTFKTRVRDESVPGPNPYRWQDLTTEDIFKGKKVVVFSLPGAFTPTCSSNHLPRYE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y++ + +G++++ C+SVNDAFVM  WGK +  KNV LLPDG+GEFTRKMGMLV K N+
Sbjct: 66  ELYEEFQAQGVDQIICISVNDAFVMFQWGKHIGAKNVFLLPDGNGEFTRKMGMLVDKSNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG+RSWRY  L+ D  +E  F+E  F DNC  DP+E+S  + +L  ++ S+
Sbjct: 126 GFGMRSWRYSMLVDDCKIEKIFIESEFGDNCPIDPFEVSDADTMLAYLKGSE 177


>gi|152997888|ref|YP_001342723.1| peroxiredoxin [Marinomonas sp. MWYL1]
 gi|150838812|gb|ABR72788.1| Peroxiredoxin [Marinomonas sp. MWYL1]
          Length = 174

 Score =  198 bits (503), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 87/171 (50%), Positives = 122/171 (71%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P VVF  RV     +GS  F+WKDV T DLF  K+V +F+LPGAFTPTCS   LP +E
Sbjct: 4   NVPNVVFKTRVRNDALEGSNPFEWKDVTTADLFNNKKVVVFSLPGAFTPTCSTSHLPRYE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y++ + +G++ V C+SVNDAFVM  WGK    KNV LLPDG+G+FTR+MGMLV KDN+
Sbjct: 64  ELYEEFKAQGVDAVICISVNDAFVMFQWGKSQNAKNVFLLPDGNGDFTRQMGMLVKKDNL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           GFG+RSWRY  L+++  ++  F E GF D+  +DP+E+S  + +L  ++ +
Sbjct: 124 GFGMRSWRYSMLVENGEIKKMFSEAGFQDDAPSDPFEVSDADTMLNYLKSN 174


>gi|148552945|ref|YP_001260527.1| redoxin domain-containing protein [Sphingomonas wittichii RW1]
 gi|148498135|gb|ABQ66389.1| Redoxin domain protein [Sphingomonas wittichii RW1]
          Length = 184

 Score =  196 bits (497), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 121/176 (68%), Gaps = 1/176 (0%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MI   +P V    RV      G   F+W+DV+T +LFAG+RV +FALPGAFTPTCS  Q 
Sbjct: 1   MIGRTVPNVTLKTRVRDESVGGPNPFRWQDVHTGELFAGRRVVVFALPGAFTPTCSTEQC 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P +E+ YD+LR  G +EVYCLSVNDAFVM  W K+L ++  ++LPDGSG+FTR+MGML+ 
Sbjct: 61  PAYERSYDELRARGADEVYCLSVNDAFVMYQWAKQLGVEKTRMLPDGSGDFTRRMGMLIN 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA-TDPYEISSPENVLKVIRES 175
           KD++GFG RSWRY  ++ D  +  WF E G +D  A  DPY  S+P+ VL  + E+
Sbjct: 121 KDHLGFGDRSWRYAMVVDDGRITGWFEEPGINDVGADDDPYGESAPDKVLAWLHEN 176


>gi|158336812|ref|YP_001517986.1| peroxiredoxin [Acaryochloris marina MBIC11017]
 gi|158307053|gb|ABW28670.1| peroxiredoxin, putative [Acaryochloris marina MBIC11017]
          Length = 190

 Score =  195 bits (495), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 120/169 (71%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV      G   ++W+D  TQD+F GKRV LF+LPGAFTPTCS   LP +E
Sbjct: 8   RVPDVVFKTRVRDESVPGPNPYRWQDKTTQDIFGGKRVVLFSLPGAFTPTCSSTHLPRYE 67

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++++++ +G++E+ CLSVNDAFVM  WGK      V LLPDG+GEFTRKMGMLV K N+
Sbjct: 68  ELHEEIKAQGVDEIICLSVNDAFVMFQWGKHQGADKVFLLPDGNGEFTRKMGMLVDKSNL 127

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG+RSWRY  ++ +  +E  F+E  + DNC TDP+E+S  + +L  ++
Sbjct: 128 GFGMRSWRYSMVVNNGQIEKMFIEADYGDNCPTDPFEVSDADTMLAYLK 176


>gi|298491760|ref|YP_003721937.1| redoxin domain-containing protein ['Nostoc azollae' 0708]
 gi|298233678|gb|ADI64814.1| Redoxin domain protein ['Nostoc azollae' 0708]
          Length = 176

 Score =  195 bits (495), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 119/168 (70%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P VVF  RV          F+W+D  T++LFAGKRV +F+LPGAFTPTCS   LP +E+
Sbjct: 7   VPSVVFKTRVRDESIGRPNPFRWQDRTTEELFAGKRVVVFSLPGAFTPTCSTSHLPPYEE 66

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +Y + +  G++ V C+SVNDAFVM  WGK+   +NV LLPDG+GEFTRKMGMLV K N+G
Sbjct: 67  LYKEFQALGVDSVICISVNDAFVMYQWGKQQGAENVFLLPDGNGEFTRKMGMLVDKSNLG 126

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG+RSWRY  ++ D  +E  F+E G  DNC +DP+E+S  + +LK ++
Sbjct: 127 FGMRSWRYSMVVNDGKIEKMFIEPGLDDNCPSDPFEVSDADTMLKYLK 174


>gi|87121427|ref|ZP_01077316.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant
           [Marinomonas sp. MED121]
 gi|86163270|gb|EAQ64546.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant
           [Marinomonas sp. MED121]
          Length = 194

 Score =  193 bits (491), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 120/174 (68%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++R  +P+V F  RV      G   F+WKD+ + D+F GK V +F+LPGAFTPTCS   L
Sbjct: 20  LMRNTVPEVTFKTRVRNDALGGPNPFEWKDLTSDDVFKGKNVVVFSLPGAFTPTCSTSHL 79

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FE++YD+ + +G++ V C+SVNDAFVM  WGK    +NV LLPDG+G+FTR+MGMLV 
Sbjct: 80  PRFEELYDEFKAQGVDAVVCISVNDAFVMFQWGKSQNAQNVFLLPDGNGDFTRQMGMLVK 139

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRE 174
           KDN+GFG+RSWRY   +++  +   F E GF D+   DP+E+S  + +L  +++
Sbjct: 140 KDNLGFGMRSWRYAMYVENGEITKMFSEAGFQDDAPADPFEVSDADTMLNYLKQ 193


>gi|167621848|ref|YP_001676633.1| redoxin domain-containing protein [Caulobacter sp. K31]
 gi|167351589|gb|ABZ74319.1| Redoxin domain protein [Caulobacter sp. K31]
          Length = 179

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 88/173 (50%), Positives = 122/173 (70%), Gaps = 1/173 (0%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+   +P VVF  RV      G   F+W+D+ ++++F G+RV +F LPGAFTPTCS+ Q 
Sbjct: 1   MLGRPVPDVVFKTRVRDESIGGENPFRWQDLRSEEIFRGRRVLVFGLPGAFTPTCSNEQT 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FE+ YD  R  G++++YCL+VNDAFVM+ W  KLEI+ V+ LPDGSG FTR+MGMLV 
Sbjct: 61  PEFERQYDAFRQIGLDDIYCLAVNDAFVMHQWALKLEIEKVRFLPDGSGHFTRRMGMLVD 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDN-CATDPYEISSPENVLKVI 172
           KD++GFG RSWRY  +++D V+  WF E G +D     DPY+++ PE VL+ +
Sbjct: 121 KDHLGFGYRSWRYVMVVEDGVIVRWFEEPGINDQGVDDDPYDVTRPERVLEAL 173


>gi|88705713|ref|ZP_01103423.1| peroxirdoxin [Congregibacter litoralis KT71]
 gi|88700226|gb|EAQ97335.1| peroxirdoxin [Congregibacter litoralis KT71]
          Length = 188

 Score =  192 bits (489), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 84/172 (48%), Positives = 122/172 (70%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P+  F  RV      G   F+W++  T D+F GK+V +F+LPGAFTPTCS + LP ++
Sbjct: 4   QVPEATFKTRVRDESVGGDNPFRWEEKTTADIFGGKKVVVFSLPGAFTPTCSSNHLPRYD 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y++ + +G++EV C+SVNDAFVM  WG++   KN+ LLPDG+GEFTRKMGMLV K N+
Sbjct: 64  ELYEEFKAQGVDEVICVSVNDAFVMFKWGQEQGNKNIFLLPDGNGEFTRKMGMLVDKSNI 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG+RSWRY  L+ D  +E  F E G+ DN  TDP+E+S  + +L  ++ ++
Sbjct: 124 GFGMRSWRYSMLVNDGNIEKLFSEAGYCDNGETDPFEVSDADTMLAYLKGTE 175


>gi|33863456|ref|NP_895016.1| alkyl hydroperoxide reductase/thiol specific antioxidant
           [Prochlorococcus marinus str. MIT 9313]
 gi|33640905|emb|CAE21361.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9313]
          Length = 190

 Score =  192 bits (488), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 86/169 (50%), Positives = 119/169 (70%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P V F  RV      GS  F+W+D+ + ++F G++V + ALPGAFTPTCS + LP +E
Sbjct: 6   NVPDVTFKTRVRDESVPGSNPFRWQDLTSAEIFKGRKVVVLALPGAFTPTCSSNHLPRYE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++ +L  +G++++ CLSVNDAFVM  W K L  KN+ +LPDG+GEFTRKMGMLV K N+
Sbjct: 66  ELHAELVAQGVDQIVCLSVNDAFVMFQWSKHLGTKNIFMLPDGNGEFTRKMGMLVEKSNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFGLRSWRY  L+ D  +E  FVE GFSDN   DP+E+S  + +L  ++
Sbjct: 126 GFGLRSWRYSMLVNDCNIEKMFVEPGFSDNADGDPFEVSDADTMLAYMK 174


>gi|307826313|ref|ZP_07656519.1| Redoxin domain protein [Methylobacter tundripaludum SV96]
 gi|307732611|gb|EFO03482.1| Redoxin domain protein [Methylobacter tundripaludum SV96]
          Length = 175

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/171 (50%), Positives = 118/171 (69%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P V+F  RV      G   F+W+DV+T D+F   ++ + ALPGA+TPTCS   LPGFE 
Sbjct: 5   VPDVIFKTRVRDESIGGDNPFRWQDVSTDDIFKRTKIVILALPGAYTPTCSSKHLPGFEA 64

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
            Y DL  +G++EVYC+SVNDAFVM  WGK L IK VK+LPDG+G+FT+ MGMLV K+NVG
Sbjct: 65  KYQDLIEQGVDEVYCVSVNDAFVMYQWGKHLGIKQVKMLPDGNGDFTQAMGMLVKKENVG 124

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           FG RSWRY  +++D  +   F E G  DNC  DP+ +S  + +L  ++++K
Sbjct: 125 FGSRSWRYSMIVEDKKIIKLFSEPGKVDNCPDDPFTVSDADTLLDYLKQNK 175


>gi|332974952|gb|EGK11864.1| peroxiredoxin [Psychrobacter sp. 1501(2011)]
          Length = 175

 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 87/172 (50%), Positives = 120/172 (69%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P V F  RV      G   F+W D+ T +LFA K+V +F+LPGAFTPTCS   LP +E
Sbjct: 4   HVPDVTFKTRVRDESIGGENPFKWYDLTTDELFANKKVVVFSLPGAFTPTCSTSHLPRYE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y++ +  G++EV C+SVNDAFVM  WG K   +NV LLPDG+GEFTRKMGMLV K N+
Sbjct: 64  ELYNEFKALGVDEVVCVSVNDAFVMYQWGLKQGRENVFLLPDGNGEFTRKMGMLVDKSNL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG+RSWRY   +++  ++  F+E GF DNC TDP+E+S  + +L+ ++  K
Sbjct: 124 GFGMRSWRYSMYVENKEIKKVFMEPGFDDNCPTDPFEVSDADTMLEYLKSQK 175


>gi|94496864|ref|ZP_01303438.1| peroxiredoxin/glutaredoxin family protein [Sphingomonas sp. SKA58]
 gi|94423540|gb|EAT08567.1| peroxiredoxin/glutaredoxin family protein [Sphingomonas sp. SKA58]
          Length = 179

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 122/178 (68%), Gaps = 1/178 (0%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M+   IP V    RV     +G   F+W++V+T DLFAGKR  +F+LPGAFTPTCS  Q 
Sbjct: 1   MLGRSIPDVTLKTRVRDDSVEGPNPFRWQEVSTGDLFAGKRSVVFSLPGAFTPTCSTEQC 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P FE+    LR  G ++VYC+SVNDAFVM  WGK+L IK+VKLLPDGSG+FTR+MGMLV 
Sbjct: 61  PAFEQSSAALRAAGADDVYCVSVNDAFVMYQWGKQLGIKSVKLLPDGSGDFTRRMGMLVK 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA-TDPYEISSPENVLKVIRESKK 177
           KD++GFG RSWRY  ++ D  + +WF E G +D     DPY  +SPE VL  + ++ +
Sbjct: 121 KDHLGFGERSWRYAMVVDDGRIVAWFEEPGINDAGEDDDPYGETSPEPVLAWLADNPR 178


>gi|148653170|ref|YP_001280263.1| redoxin domain-containing protein [Psychrobacter sp. PRwf-1]
 gi|148572254|gb|ABQ94313.1| Redoxin domain protein [Psychrobacter sp. PRwf-1]
          Length = 175

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 87/172 (50%), Positives = 119/172 (69%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P V F  RV      G   F+W D+ T +LFA K+V +F+LPGAFTPTCS   LP +E
Sbjct: 4   HVPDVTFKTRVRDESIGGENPFKWYDLTTDELFANKKVVVFSLPGAFTPTCSTSHLPRYE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y++ +  G++EV C+SVNDAFVM  WG K   +NV LLPDG+GEFTRKMGMLV K N+
Sbjct: 64  ELYNEFKALGVDEVVCVSVNDAFVMYQWGLKQGRENVFLLPDGNGEFTRKMGMLVDKSNL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG+RSWRY   + +  ++  F+E GF DNC TDP+E+S  + +L+ ++  K
Sbjct: 124 GFGMRSWRYSMYVDNKEIKQVFMEPGFDDNCPTDPFEVSDADTMLEYLKSQK 175


>gi|16330368|ref|NP_441096.1| membrane protein [Synechocystis sp. PCC 6803]
 gi|3915480|sp|P73728|Y1621_SYNY3 RecName: Full=Putative peroxiredoxin sll1621; AltName:
           Full=Thioredoxin reductase
 gi|1652858|dbj|BAA17776.1| membrane protein [Synechocystis sp. PCC 6803]
          Length = 189

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 119/173 (68%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P VVF  RV      G   ++W+D  T+ +F GK+V LF+LPGAFTPTCS + L
Sbjct: 1   MTPERVPSVVFKTRVRDESVPGPNPYRWEDKTTEQIFGGKKVVLFSLPGAFTPTCSSNHL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P +E+++++ +  G++++ CLSVNDAFVM  WGK++    VKLLPDG+GEFTRKMGMLV 
Sbjct: 61  PRYEQLFEEFQALGVDDIICLSVNDAFVMFQWGKQIGADKVKLLPDGNGEFTRKMGMLVE 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K N+GFG+RSWRY   + D  +E  F+E  F DNC  DP+E S  + +L  ++
Sbjct: 121 KSNLGFGMRSWRYSMFVNDGKIEKMFIEPEFGDNCPVDPFECSDADTMLAYLK 173


>gi|124022540|ref|YP_001016847.1| peroxiredoxin [Prochlorococcus marinus str. MIT 9303]
 gi|123962826|gb|ABM77582.1| Peroxiredoxin [Prochlorococcus marinus str. MIT 9303]
          Length = 190

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 118/169 (69%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P V F  RV      G   F+W+D+ + ++F G++V + ALPGAFTPTCS + LP +E
Sbjct: 6   SVPDVTFKTRVRDESVPGPNPFRWQDLTSAEIFKGRKVVVLALPGAFTPTCSSNHLPRYE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++ +L  +G++++ CLSVNDAFVM  W K L  KN+ +LPDG+GEFTRKMGMLV K N+
Sbjct: 66  ELHTELVAQGVDQIICLSVNDAFVMFQWRKHLGTKNIFMLPDGNGEFTRKMGMLVEKSNL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFGLRSWRY  L+ D  +E  FVE GFSDN   DP+E+S  + +L  ++
Sbjct: 126 GFGLRSWRYSMLVNDCNIEKMFVEPGFSDNADVDPFEVSDADTMLAYMK 174


>gi|254516591|ref|ZP_05128650.1| hybrid peroxiredoxin hyPrx5 [gamma proteobacterium NOR5-3]
 gi|219675014|gb|EED31381.1| hybrid peroxiredoxin hyPrx5 [gamma proteobacterium NOR5-3]
          Length = 188

 Score =  190 bits (482), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 82/172 (47%), Positives = 120/172 (69%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P   F  RV      G   ++W++  T D+F GK+V +F+LPGAFTPTCS + LP ++
Sbjct: 4   HVPDATFKTRVRDESVGGDNPYRWEEKTTADIFGGKKVVVFSLPGAFTPTCSSNHLPRYD 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y++ + +G++E+ C+SVNDAFVM  WG+    KN+ LLPDG+GEFTRKMGMLV K N+
Sbjct: 64  ELYEEFKAQGVDEIVCVSVNDAFVMFKWGQDQGNKNIFLLPDGNGEFTRKMGMLVDKSNI 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG+RSWRY  L+ D V+E  F E G+ DN  TDP+E+S  + +L  ++ ++
Sbjct: 124 GFGMRSWRYSMLVNDGVIEKLFSEAGYCDNGETDPFEVSDADTMLAYLKGTE 175


>gi|326794996|ref|YP_004312816.1| redoxin [Marinomonas mediterranea MMB-1]
 gi|326545760|gb|ADZ90980.1| Redoxin domain protein [Marinomonas mediterranea MMB-1]
          Length = 174

 Score =  190 bits (482), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 116/169 (68%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P VVF  R+      G   F+WKDV T DLF  K V +F+LPGAFTPTCS   LP +E
Sbjct: 4   NVPHVVFKTRIRNEALGGPNPFEWKDVTTDDLFKDKNVVVFSLPGAFTPTCSTSHLPRYE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y++ + +GI+ V C+SVNDAFVM  WGK    +NV LLPDG+G+FTR+MGMLV KDN+
Sbjct: 64  ELYEEFKGQGIDAVICISVNDAFVMFQWGKSQNAQNVFLLPDGNGDFTRQMGMLVKKDNL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG+RSWRY   +++  ++  F E G+ DN   DP+E+S  + VL  ++
Sbjct: 124 GFGMRSWRYAMHVENGEIKKMFSEAGYQDNAPEDPFEVSDADTVLNYLK 172


>gi|167627867|ref|YP_001678367.1| peroxiredoxin, AhpC-TSA family protein [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|167597868|gb|ABZ87866.1| peroxiredoxin, AhpC-TSA family protein [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
          Length = 174

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 116/168 (69%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      GS  F+W+DV + D+F  KRV +F+LPGAFTPTCS +QLPGFE
Sbjct: 4   RVPNVTFKTRVRDESIGGSNPFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLPGFE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
                 +  GI+E+Y LSVND+FVMN W + L++KN+K +PDG+GEFT+ + MLV K N+
Sbjct: 64  NNAARFKELGIDEIYVLSVNDSFVMNKWIQALDVKNIKPIPDGNGEFTQALDMLVDKSNL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  ++ +  +E  FVE G  DN   DPY  SSPEN+LK +
Sbjct: 124 GFGKRSWRYAMIVNNHEIEKMFVEPGKRDNAEDDPYGESSPENLLKYL 171


>gi|241668425|ref|ZP_04756003.1| peroxiredoxin, AhpC-TSA family protein [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254876958|ref|ZP_05249668.1| AhpC/Tsa family protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842979|gb|EET21393.1| AhpC/Tsa family protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 174

 Score =  189 bits (479), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 115/168 (68%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      GS  F+W+DV + D+F  KRV +F+LPGAFTPTCS +QLPGFE
Sbjct: 4   RVPNVTFKTRVRDESIGGSNPFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLPGFE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
                 +  GI+E+Y LSVND+FVMN W + L++KN+K +PDG+GEFT  + MLV K N+
Sbjct: 64  NNAARFKELGIDEIYVLSVNDSFVMNKWIQALDVKNIKPIPDGNGEFTEALDMLVDKSNL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  ++ +  +E  FVE G  DN   DPY  SSPEN+LK +
Sbjct: 124 GFGKRSWRYAMIVNNHEIEKMFVEPGKRDNAEDDPYGESSPENLLKYL 171


>gi|85704849|ref|ZP_01035950.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant
           [Roseovarius sp. 217]
 gi|85670667|gb|EAQ25527.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant
           [Roseovarius sp. 217]
          Length = 180

 Score =  187 bits (475), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (66%), Gaps = 2/177 (1%)

Query: 1   MIRFQ--IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDH 58
           ++R Q  IP   FH R+     +G   F+WK + + D+F G+R+ LFALPGAFTP CSD 
Sbjct: 4   IMRLQTIIPDATFHTRIRNDALEGPNPFEWKVLTSADIFPGQRIVLFALPGAFTPACSDR 63

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGML 118
            LPG+E+ Y+  R  GI+ V CLSVNDAFVM+ W    +I NV +LPDG+GEFTRKMGML
Sbjct: 64  HLPGYEQHYEAFRRAGIDRVICLSVNDAFVMHQWATSRDINNVFMLPDGNGEFTRKMGML 123

Query: 119 VYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           V + + G GLRSWRY  L++D V+++ F E GF DN    P ++S  + +L  + +S
Sbjct: 124 VDRSSNGMGLRSWRYSMLVEDGVIKNLFAEPGFRDNPDGVPVKVSGADTMLAYLSQS 180


>gi|330721674|gb|EGG99683.1| Peroxiredoxin family protein/glutaredoxin [gamma proteobacterium
           IMCC2047]
          Length = 174

 Score =  187 bits (474), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 114/168 (67%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IP VVF  RV      G   F+WKD++T ++F  K V LF+LPGAFTPTCS   LP +E+
Sbjct: 5   IPNVVFKTRVRNEALGGPNPFEWKDLSTDEIFKNKNVVLFSLPGAFTPTCSTSHLPRYEE 64

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +Y++ + +G++ V CLSVNDAFVM  WGK      V LLPDG+ EFTRKMGMLV K N+G
Sbjct: 65  LYEEFQAQGVDAVICLSVNDAFVMYQWGKSQNADKVFLLPDGNAEFTRKMGMLVDKSNLG 124

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG RSWRY   +++  ++  F+E G+ DNC  DP+E+S  + +L  ++
Sbjct: 125 FGQRSWRYSMYVENGEIKQRFIEPGYEDNCPIDPFEVSDADTMLNYLK 172


>gi|187931815|ref|YP_001891800.1| peroxiredoxin, AhpC-TSA family protein [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|187712724|gb|ACD31021.1| peroxiredoxin, AhpC-TSA family protein [Francisella tularensis
           subsp. mediasiatica FSC147]
          Length = 174

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 117/172 (68%), Gaps = 1/172 (0%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      GS +F+W+DV + D+F  KRV +F+LPGAFTPTCS +QLPGFE
Sbjct: 4   KVPNVTFKTRVRDESIGGSNSFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLPGFE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
                 +  GI+E+Y LSVND+FVMN W +   I+N+K +PDG+GEFT  + MLV K N+
Sbjct: 64  NNAARFKELGIDEIYVLSVNDSFVMNKWIQVQGIQNIKPIPDGNGEFTEALDMLVDKSNI 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY  ++ +  +E  FVE G  DN   DPY  SSPEN+LK + ESK
Sbjct: 124 GFGKRSWRYAMIVNNGEIEKMFVEPGKRDNADNDPYGESSPENLLKYL-ESK 174


>gi|93006717|ref|YP_581154.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Psychrobacter cryohalolentis K5]
 gi|92394395|gb|ABE75670.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Psychrobacter cryohalolentis K5]
          Length = 175

 Score =  185 bits (470), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 114/171 (66%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            IP + F  RV      G   F W D+ T +LFA K+V +F+LPGAFTPTCS   LP +E
Sbjct: 4   HIPDMTFKTRVRDDSIGGDNPFTWYDLTTDELFANKKVVVFSLPGAFTPTCSTSHLPRYE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            +Y++ +  GI+E+ C+SVNDAFVM  WG K   +NV LLPDG+GEFTRKMGMLV K NV
Sbjct: 64  ALYNEFKALGIDEIVCISVNDAFVMYQWGLKQNRENVFLLPDGNGEFTRKMGMLVDKSNV 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           GFG+RSWRY  ++ +  V+  F E  F DNC  DP+E+S  + +L  ++ +
Sbjct: 124 GFGMRSWRYSMVVDNKEVKKVFKEADFGDNCPIDPFEVSDADTMLAYLKSN 174


>gi|56707687|ref|YP_169583.1| AhpC/TSA family protein [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110670158|ref|YP_666715.1| AhpC/TSA family protein [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118497550|ref|YP_898600.1| AhpC/TSA family protein [Francisella tularensis subsp. novicida
           U112]
 gi|134301967|ref|YP_001121936.1| AhpC/TSA family protein [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|195536246|ref|ZP_03079253.1| antioxidant, AhpC/TSA family protein [Francisella tularensis subsp.
           novicida FTE]
 gi|208779349|ref|ZP_03246695.1| antioxidant, AhpC/TSA family protein [Francisella novicida FTG]
 gi|224456756|ref|ZP_03665229.1| AhpC/TSA family protein [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254370195|ref|ZP_04986201.1| peroxiredoxin [Francisella tularensis subsp. tularensis FSC033]
 gi|254372911|ref|ZP_04988400.1| AhpC/TSA family protein [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254374365|ref|ZP_04989847.1| peroxiredoxin [Francisella novicida GA99-3548]
 gi|254874499|ref|ZP_05247209.1| peroxiredoxin [Francisella tularensis subsp. tularensis MA00-2987]
 gi|56604179|emb|CAG45190.1| AhpC/TSA family protein [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110320491|emb|CAL08573.1| AhpC/TSA family protein [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118423456|gb|ABK89846.1| peroxiredoxin, AhpC-TSA family protein [Francisella novicida U112]
 gi|134049744|gb|ABO46815.1| AhpC/TSA family protein [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151568439|gb|EDN34093.1| peroxiredoxin [Francisella tularensis subsp. tularensis FSC033]
 gi|151570638|gb|EDN36292.1| AhpC/TSA family protein [Francisella novicida GA99-3549]
 gi|151572085|gb|EDN37739.1| peroxiredoxin [Francisella novicida GA99-3548]
 gi|194372723|gb|EDX27434.1| antioxidant, AhpC/TSA family protein [Francisella tularensis subsp.
           novicida FTE]
 gi|208745149|gb|EDZ91447.1| antioxidant, AhpC/TSA family protein [Francisella novicida FTG]
 gi|254840498|gb|EET18934.1| peroxiredoxin [Francisella tularensis subsp. tularensis MA00-2987]
 gi|282158851|gb|ADA78242.1| AhpC/TSA family protein [Francisella tularensis subsp. tularensis
           NE061598]
 gi|332678249|gb|AEE87378.1| Expressed protein [Francisella cf. novicida Fx1]
          Length = 174

 Score =  184 bits (468), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 116/172 (67%), Gaps = 1/172 (0%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      GS  F+W+DV + D+F  KRV +F+LPGAFTPTCS +QLPGFE
Sbjct: 4   KVPNVTFKTRVRDESIGGSNPFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLPGFE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
                 +  GI+E+Y LSVND+FVMN W +   I+N+K +PDG+GEFT  + MLV K N+
Sbjct: 64  NNAARFKELGIDEIYVLSVNDSFVMNKWIQVQGIQNIKPIPDGNGEFTEALDMLVDKSNI 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY  ++ +  +E  FVE G  DN   DPY  SSPEN+LK + ESK
Sbjct: 124 GFGKRSWRYAMIVNNGEIEKMFVEPGKRDNADNDPYGESSPENLLKYL-ESK 174


>gi|332184112|gb|AEE26366.1| Expressed protein [Francisella cf. novicida 3523]
          Length = 174

 Score =  184 bits (467), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 116/172 (67%), Gaps = 1/172 (0%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      GS  F+W+DV + D+F  KRV +F+LPGAFTPTCS +QLPGFE
Sbjct: 4   KVPNVTFKTRVRDESIGGSNPFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLPGFE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
                 +  GI+E+Y LSVND+FVMN W +   I+N+K +PDG+GEFT  + MLV K N+
Sbjct: 64  NNAARFKELGIDEIYVLSVNDSFVMNKWIQVQGIQNIKPIPDGNGEFTEALDMLVDKSNI 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY  ++ +  +E  FVE G  DN   DPY  SSPEN+LK + ESK
Sbjct: 124 GFGKRSWRYAMIVNNGEIEKMFVEPGKRDNANDDPYGESSPENLLKYL-ESK 174


>gi|57339780|gb|AAW49877.1| hypothetical protein FTT0557 [synthetic construct]
          Length = 209

 Score =  184 bits (467), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 116/172 (67%), Gaps = 1/172 (0%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      GS  F+W+DV + D+F  KRV +F+LPGAFTPTCS +QLPGFE
Sbjct: 30  KVPNVTFKTRVRDESIGGSNPFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLPGFE 89

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
                 +  GI+E+Y LSVND+FVMN W +   I+N+K +PDG+GEFT  + MLV K N+
Sbjct: 90  NNAARFKELGIDEIYVLSVNDSFVMNKWIQVQGIQNIKPIPDGNGEFTEALDMLVDKSNI 149

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY  ++ +  +E  FVE G  DN   DPY  SSPEN+LK + ESK
Sbjct: 150 GFGKRSWRYAMIVNNGEIEKMFVEPGKRDNADNDPYGESSPENLLKYL-ESK 200


>gi|89256354|ref|YP_513716.1| AhpC/TSA family protein [Francisella tularensis subsp. holarctica
           LVS]
 gi|115314799|ref|YP_763522.1| AhpC/TSA family protein [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156502437|ref|YP_001428502.1| AhpC/TSA family protein [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010811|ref|ZP_02275742.1| hybrid peroxiredoxin hyPrx5 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254367691|ref|ZP_04983712.1| ahpC/TSA family protein [Francisella tularensis subsp. holarctica
           257]
 gi|254369328|ref|ZP_04985340.1| AhpC/TSA family protein [Francisella tularensis subsp. holarctica
           FSC022]
 gi|290954170|ref|ZP_06558791.1| AhpC/TSA family protein [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295312413|ref|ZP_06803191.1| AhpC/TSA family protein [Francisella tularensis subsp. holarctica
           URFT1]
 gi|89144185|emb|CAJ79454.1| AhpC/TSA family protein [Francisella tularensis subsp. holarctica
           LVS]
 gi|115129698|gb|ABI82885.1| peroxiredoxin [Francisella tularensis subsp. holarctica OSU18]
 gi|134253502|gb|EBA52596.1| ahpC/TSA family protein [Francisella tularensis subsp. holarctica
           257]
 gi|156253040|gb|ABU61546.1| AhpC/Tsa family, antioxidant protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|157122278|gb|EDO66418.1| AhpC/TSA family protein [Francisella tularensis subsp. holarctica
           FSC022]
          Length = 174

 Score =  184 bits (466), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 116/172 (67%), Gaps = 1/172 (0%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV      GS  F+W+DV + D+F  KRV +F+LPGAFTPTCS +QLPGFE
Sbjct: 4   KVPNVTFKTRVRDEGIGGSNPFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLPGFE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
                 +  GI+E+Y LSVND+FVMN W +   I+N+K +PDG+GEFT  + MLV K N+
Sbjct: 64  NNAARFKELGIDEIYVLSVNDSFVMNKWIQVQGIQNIKPIPDGNGEFTEALDMLVDKSNI 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY  ++ +  +E  FVE G  DN   DPY  SSPEN+LK + ESK
Sbjct: 124 GFGKRSWRYAMIVNNGEIEKMFVEPGKRDNADNDPYGESSPENLLKYL-ESK 174


>gi|119475977|ref|ZP_01616329.1| membrane protein [marine gamma proteobacterium HTCC2143]
 gi|119450604|gb|EAW31838.1| membrane protein [marine gamma proteobacterium HTCC2143]
          Length = 175

 Score =  182 bits (463), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/170 (48%), Positives = 115/170 (67%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P VVF  RV     D    F+W+D +T D+F GK + + ALPGAFTPTCS   LPG+E
Sbjct: 4   QVPDVVFKTRVRDESVDHENPFRWEDKSTADIFGGKNIVVLALPGAFTPTCSGTHLPGYE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
              + ++ +G+++VYCLSVNDAF M  W K+L I+ VK+LPDG+GEF+R MGMLV K+N+
Sbjct: 64  NNIEAIKAKGVDDVYCLSVNDAFSMFQWAKQLGIEKVKMLPDGNGEFSRLMGMLVKKENL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRE 174
           GFG RSWRY   + D  +++ F E G  DNC  DP+ +S  + +L  + +
Sbjct: 124 GFGDRSWRYSMHVIDGDIKALFAEPGLMDNCPEDPFGVSDADTMLDYLNQ 173


>gi|84516550|ref|ZP_01003909.1| alkyl hydroperoxide reductase/thiol-specific antioxidant
           [Loktanella vestfoldensis SKA53]
 gi|84509586|gb|EAQ06044.1| alkyl hydroperoxide reductase/thiol-specific antioxidant
           [Loktanella vestfoldensis SKA53]
          Length = 181

 Score =  181 bits (460), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/177 (46%), Positives = 113/177 (63%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M    +P  VFH RV      G   F+WK ++T D+FAGKRV +FALPGAFTP CS+  L
Sbjct: 1   MTPQSVPDAVFHTRVRNPDLAGDNPFEWKQLSTSDVFAGKRVVVFALPGAFTPACSESHL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           PG+E++YD    +G++ V C++VNDAFVM  W K   I+ V +LPDG+GEFTRKMGMLV 
Sbjct: 61  PGYERLYDAFVAQGVDSVVCMAVNDAFVMFQWAKSQNIQRVFMLPDGNGEFTRKMGMLVD 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           +   G G+RSWRY  L+++  ++  F E G  DN    P  +SS E +L  ++   +
Sbjct: 121 RSAQGMGMRSWRYSMLVENGDIKKLFAEPGLRDNPPGVPMSVSSAETMLDYLQHHHQ 177


>gi|119505297|ref|ZP_01627372.1| membrane protein [marine gamma proteobacterium HTCC2080]
 gi|119458988|gb|EAW40088.1| membrane protein [marine gamma proteobacterium HTCC2080]
          Length = 175

 Score =  180 bits (457), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 116/172 (67%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P+  F  RV      G   F+W+ +++  +F G+ V LF+LPGAFTPTCS   LP +E
Sbjct: 4   SVPKTSFQTRVRDESIGGENPFRWETLSSDAIFKGRTVALFSLPGAFTPTCSTSHLPRYE 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++ ++    G++EV CLSVNDAFVM  WG++   + V+LLPDG+GEFTRKMGMLV K N+
Sbjct: 64  ELCEEFYAAGVDEVVCLSVNDAFVMYKWGREQGAEKVRLLPDGNGEFTRKMGMLVDKSNL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG+RSWRY  L++D V+E  F E GF+DN   DP+ +S  + +L  ++  +
Sbjct: 124 GFGMRSWRYSMLVRDGVIEKLFEEPGFADNFEEDPFTVSDADTLLGYVKAGQ 175


>gi|149202432|ref|ZP_01879405.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant
           [Roseovarius sp. TM1035]
 gi|149144530|gb|EDM32561.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant
           [Roseovarius sp. TM1035]
          Length = 176

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 81/170 (47%), Positives = 110/170 (64%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P V+FH RV     +G   F+WKDV+T D+FAGKRV +F LPGAFT  CS+  LPG+E+
Sbjct: 6   VPDVIFHTRVRNPALEGDNPFEWKDVSTADIFAGKRVVVFGLPGAFTAACSESHLPGYER 65

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +YDD    GI+ V C +VNDAFVM  WGK   I+   +LPDG+G+F   +GMLV +   G
Sbjct: 66  LYDDFLAAGIDRVICTAVNDAFVMFQWGKAQGIEKTMMLPDGNGDFAAGLGMLVDRSRQG 125

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
            G RSWRY  +++D  + + F E G  DN A  P ++S  E +L  IR++
Sbjct: 126 MGKRSWRYSMVVEDGSITALFAEPGLQDNPAGVPVKLSDAETLLAHIRQA 175


>gi|325116054|emb|CBZ51608.1| Peroxiredoxin-2E-1, related [Neospora caninum Liverpool]
          Length = 267

 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 84/162 (51%), Positives = 111/162 (68%), Gaps = 2/162 (1%)

Query: 14  RVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE 73
           RV T  P+G K   W D+ +  +F  KRV +F+LPGAFTPTCS   LP FEK Y+ +   
Sbjct: 102 RVRTAAPNGEK--TWADLESDAMFKNKRVVVFSLPGAFTPTCSSRHLPDFEKEYESILSL 159

Query: 74  GIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
           G++EVYCLSVND+FVMNAW   L +KNVK++PDG+G FT +MGMLV K N+GFG RSWRY
Sbjct: 160 GVDEVYCLSVNDSFVMNAWASSLNVKNVKMIPDGNGCFTSRMGMLVDKTNLGFGPRSWRY 219

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
             +++D ++E   VE    D+   DP+  S   +VLK +RE+
Sbjct: 220 AMVVRDGIIEKLMVEPEKRDDAEDDPFVASDVGSVLKYLREA 261


>gi|237839983|ref|XP_002369289.1| peroxiredoxin family protein/glutaredoxin, putative [Toxoplasma
           gondii ME49]
 gi|209976408|gb|ACJ04161.1| putative antioxidant protein [Toxoplasma gondii]
 gi|211966953|gb|EEB02149.1| peroxiredoxin family protein/glutaredoxin, putative [Toxoplasma
           gondii ME49]
          Length = 292

 Score =  176 bits (447), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 113/169 (66%), Gaps = 4/169 (2%)

Query: 7   PQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKI 66
           P+ V+ +R A   P+G     W ++ +  +F  KRV +F+LPGAFTPTCS   LP F+K 
Sbjct: 122 PECVWKVRAAA--PEG--GMTWAELESTTMFKNKRVVIFSLPGAFTPTCSSRHLPDFDKE 177

Query: 67  YDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           YD +R  GI+EVYCLSVND FVMNAW   L +K+VK++PDG+G FT KMGMLV K N+GF
Sbjct: 178 YDAIRALGIDEVYCLSVNDTFVMNAWASSLNVKHVKMIPDGNGCFTSKMGMLVDKTNLGF 237

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           G RSWRY  ++++  +E   VE    D+   DP+  S   +VLK +R+S
Sbjct: 238 GPRSWRYAMVVRNGTIEKLLVEPEKRDDAEDDPFVASDVASVLKYLRDS 286


>gi|221484670|gb|EEE22964.1| peroxiredoxin family protein, putative [Toxoplasma gondii GT1]
          Length = 292

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 113/169 (66%), Gaps = 4/169 (2%)

Query: 7   PQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKI 66
           P+ V+ +R A   P+G     W ++ +  +F  KRV +F+LPGAFTPTCS   LP F+K 
Sbjct: 122 PECVWKVRAAA--PEG--GMTWAELESTTMFKNKRVVIFSLPGAFTPTCSSRHLPDFDKE 177

Query: 67  YDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           YD +R  GI+EVYCLSVND FVMNAW   L +K+VK++PDG+G FT KMGMLV K N+GF
Sbjct: 178 YDAIRALGIDEVYCLSVNDTFVMNAWASSLNVKHVKMIPDGNGCFTSKMGMLVDKTNLGF 237

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           G RSWRY  ++++  +E   VE    D+   DP+  S   +VLK +R+S
Sbjct: 238 GPRSWRYAMVVRNGTIEKLLVEPEKRDDAEDDPFVASDVASVLKYLRDS 286


>gi|83952991|ref|ZP_00961716.1| hypothetical protein ISM_00005 [Roseovarius nubinhibens ISM]
 gi|83835620|gb|EAP74924.1| hypothetical protein ISM_00005 [Roseovarius nubinhibens ISM]
          Length = 182

 Score =  174 bits (440), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 84/173 (48%), Positives = 118/173 (68%), Gaps = 4/173 (2%)

Query: 4   FQIPQVVFHMR---VATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           +++ +V+F +R    A+     S   +W +  T D F  +RV LF+LPGAFTPTCS  QL
Sbjct: 5   YKLDKVIFKLREGDKASSHNQCSIGGRWIEKTTDDFFKNRRVVLFSLPGAFTPTCSSLQL 64

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           PGFE   +  +  GI+E+YC SVNDA+ MNAW +K+ IKNVKL+PDG+G FT++MGML+ 
Sbjct: 65  PGFENYCERFKKLGIDEIYCCSVNDAYTMNAWAEKMRIKNVKLIPDGNGYFTKQMGMLIS 124

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA-TDPYEISSPENVLKVI 172
           KD++GFG RSWRY A+I D +VE W+ E G ++  +  DPY  + PE  L+ +
Sbjct: 125 KDHLGFGNRSWRYMAVITDGIVEKWWEEPGINNEGSDDDPYTETMPEKCLEYL 177


>gi|261380511|ref|ZP_05985084.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria subflava
           NJ9703]
 gi|284796764|gb|EFC52111.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria subflava
           NJ9703]
          Length = 245

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 80/168 (47%), Positives = 110/168 (65%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVFH RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFHTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEEADNIYMIPDGNGEFTEGMGMLVDKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK I
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKYI 164


>gi|75911177|ref|YP_325473.1| glutaredoxin-like protein region [Anabaena variabilis ATCC 29413]
 gi|75704902|gb|ABA24578.1| Glutaredoxin-like region [Anabaena variabilis ATCC 29413]
          Length = 251

 Score =  169 bits (429), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 110/168 (65%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W +V T DLFAGK V +F+LPGAFTPTCS   LPG+ 
Sbjct: 9   RVPQVTFRTR---------QNNEWVNVTTDDLFAGKTVAVFSLPGAFTPTCSSTHLPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++E+ C+SVNDAFVMN W K  E +N+ L+PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAKVFKENGVDEIVCISVNDAFVMNEWAKTQEAENITLIPDGNGEFTEGMGMLVDKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD V+E  F+E     +   DP+E+S  + +LK I
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----DVPGDPFEVSDAQTMLKYI 163


>gi|17229033|ref|NP_485581.1| peroxiredoxin 2 family protein/glutaredoxin [Nostoc sp. PCC 7120]
 gi|17135361|dbj|BAB77907.1| peroxiredoxin 2 family protein/glutaredoxin [Nostoc sp. PCC 7120]
          Length = 251

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 110/168 (65%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W +V T DLFAGK V +F+LPGAFTPTCS   LPG+ 
Sbjct: 9   RVPQVTFRTR---------QNNEWVNVTTDDLFAGKTVAVFSLPGAFTPTCSSTHLPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++E+ C+SVNDAFVMN W K  E +N+ L+PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAKVFKDNGVDEIVCISVNDAFVMNEWAKTQEAENITLIPDGNGEFTEGMGMLVDKTDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD V+E  F+E     +   DP+E+S  + +LK I
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----DVPGDPFEVSDAQTMLKHI 163


>gi|255019855|ref|ZP_05291931.1| Glutaredoxin-family domain protein [Acidithiobacillus caldus ATCC
           51756]
 gi|254970784|gb|EET28270.1| Glutaredoxin-family domain protein [Acidithiobacillus caldus ATCC
           51756]
          Length = 247

 Score =  167 bits (424), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 114/167 (68%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQVVF  R         +  QW+D+++++LF+G+ V +FALPGAFTPTCS   LP + +
Sbjct: 11  VPQVVFRTR---------ENNQWRDISSKELFSGRTVVVFALPGAFTPTCSSSHLPRYNE 61

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +    R  G++E+ C+SVNDAFVM AW K+L ++NV+L+PDG+ EFT  MGMLV K ++G
Sbjct: 62  LGPTFRENGVDEILCISVNDAFVMEAWAKELAVENVRLIPDGNAEFTAGMGMLVDKSDLG 121

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L++D ++E  F+E     +   DP+E+S  + +L+ +
Sbjct: 122 FGRRSWRYSMLVRDGIIEKMFIEP----DKPGDPFEVSDADTMLRYL 164


>gi|319638530|ref|ZP_07993292.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria mucosa C102]
 gi|317400279|gb|EFV80938.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria mucosa C102]
          Length = 245

 Score =  166 bits (421), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEEADNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK I
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKYI 164


>gi|241759891|ref|ZP_04757991.1| hybrid peroxiredoxin hyPrx5 [Neisseria flavescens SK114]
 gi|241319899|gb|EER56295.1| hybrid peroxiredoxin hyPrx5 [Neisseria flavescens SK114]
          Length = 245

 Score =  166 bits (421), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEEADNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK I
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFI 164


>gi|261363686|ref|ZP_05976569.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria mucosa ATCC
           25996]
 gi|288568239|gb|EFC89799.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria mucosa ATCC
           25996]
          Length = 245

 Score =  166 bits (421), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEEADNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK I
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFI 164


>gi|330447084|ref|ZP_08310734.1| ahpC/TSA family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491275|dbj|GAA05231.1| ahpC/TSA family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 242

 Score =  166 bits (421), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 109/172 (63%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV FH R         K  QW DV T++LFA K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFHTR---------KGDQWVDVTTEELFANKTVVVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++++ C+SVND FVMNAW    E +N+  +PDG+GEFT+ MGMLV KD++G
Sbjct: 61  LATVFAENGVDDILCVSVNDTFVMNAWKADQEAENITFIPDGNGEFTKGMGMLVEKDDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  F+E    +    DP+ +S  + +LK I   +K
Sbjct: 121 FGARSWRYSMLVKNGVVEKMFIE----NEEPGDPFNVSDADTMLKYIAPEQK 168


>gi|90580867|ref|ZP_01236669.1| Putative peroxiredoxin/glutaredoxin family protein [Vibrio angustum
           S14]
 gi|90437938|gb|EAS63127.1| Putative peroxiredoxin/glutaredoxin family protein [Vibrio angustum
           S14]
          Length = 242

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 110/172 (63%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV FH R         K  QW DV T+DLFA K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFHTR---------KGDQWVDVTTEDLFANKTVVVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++++ C+SVND FVMNAW    + +N+  +PDG+GEFT+ MGMLV KD++G
Sbjct: 61  LAPVFAENGVDDILCVSVNDTFVMNAWKADQDAENITFIPDGNGEFTKGMGMLVEKDDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  FVE    +    DP+++S  + +LK I   +K
Sbjct: 121 FGARSWRYSMLVKNGVVEKMFVE----NEEPGDPFKVSDADTMLKYIAPEQK 168


>gi|298368686|ref|ZP_06980004.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria sp. oral taxon
           014 str. F0314]
 gi|298282689|gb|EFI24176.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria sp. oral taxon
           014 str. F0314]
          Length = 245

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK I
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFI 164


>gi|225075624|ref|ZP_03718823.1| hypothetical protein NEIFLAOT_00640 [Neisseria flavescens
           NRL30031/H210]
 gi|224953046|gb|EEG34255.1| hypothetical protein NEIFLAOT_00640 [Neisseria flavescens
           NRL30031/H210]
          Length = 245

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK I
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFI 164


>gi|255067095|ref|ZP_05318950.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria sicca ATCC
           29256]
 gi|255048691|gb|EET44155.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria sicca ATCC
           29256]
          Length = 245

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEEADNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D V+E  F+E         DP+++S  + +LK I
Sbjct: 121 GFGKRSWRYSMLVNDGVIEKMFIEP----EEPGDPFKVSDADTMLKFI 164


>gi|269213565|ref|ZP_05982274.2| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria cinerea ATCC
           14685]
 gi|269145974|gb|EEZ72392.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria cinerea ATCC
           14685]
          Length = 263

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 28  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 78

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 79  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 138

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK +
Sbjct: 139 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 182


>gi|121634748|ref|YP_974993.1| putative redoxin [Neisseria meningitidis FAM18]
 gi|261401133|ref|ZP_05987258.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria lactamica ATCC
           23970]
 gi|296314762|ref|ZP_06864703.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria polysaccharea
           ATCC 43768]
 gi|313668611|ref|YP_004048895.1| redoxin [Neisseria lactamica ST-640]
 gi|120866454|emb|CAM10200.1| putative redoxin [Neisseria meningitidis FAM18]
 gi|269208910|gb|EEZ75365.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria lactamica ATCC
           23970]
 gi|296838405|gb|EFH22343.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria polysaccharea
           ATCC 43768]
 gi|313006073|emb|CBN87534.1| putative redoxin [Neisseria lactamica 020-06]
 gi|325132171|gb|EGC54867.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           M6190]
 gi|325144262|gb|EGC66567.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           M01-240013]
 gi|325206223|gb|ADZ01676.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           M04-240196]
          Length = 245

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK +
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 164


>gi|161869858|ref|YP_001599027.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria meningitidis
           053442]
 gi|161595411|gb|ABX73071.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria meningitidis
           053442]
          Length = 245

 Score =  166 bits (419), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK +
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 164


>gi|325134137|gb|EGC56789.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           M13399]
 gi|325138103|gb|EGC60676.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           ES14902]
 gi|325142222|gb|EGC64641.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           961-5945]
 gi|325198179|gb|ADY93635.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           G2136]
 gi|325204018|gb|ADY99471.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           M01-240355]
          Length = 243

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 59  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 162


>gi|325202266|gb|ADY97720.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           M01-240149]
          Length = 243

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 59  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 162


>gi|325207981|gb|ADZ03433.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           NZ-05/33]
          Length = 245

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK +
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 164


>gi|149197342|ref|ZP_01874393.1| putative peroxiredoxin/glutaredoxin family protein [Lentisphaera
           araneosa HTCC2155]
 gi|149139360|gb|EDM27762.1| putative peroxiredoxin/glutaredoxin family protein [Lentisphaera
           araneosa HTCC2155]
          Length = 244

 Score =  165 bits (418), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 109/173 (63%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P V F  RV            WKD++T ++F  K V +FALPGAFTPTCS   LP + 
Sbjct: 9   NVPSVTFRTRVNN---------DWKDLSTGEIFKNKTVVVFALPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++   L+  G++++YCLSVND+FVMNAW    +  N+KLLPDG+GEF+  MG+LV KD++
Sbjct: 60  QLAPVLKANGVDDIYCLSVNDSFVMNAWAADQDSANIKLLPDGNGEFSDGMGLLVDKDDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD V+E  F+E     +   DP+E+S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----DKPGDPFEVSDADTMLNYINPQAK 168


>gi|218245355|ref|YP_002370726.1| glutaredoxin-family domain-containing protein [Cyanothece sp. PCC
           8801]
 gi|257058391|ref|YP_003136279.1| glutaredoxin-family domain protein [Cyanothece sp. PCC 8802]
 gi|218165833|gb|ACK64570.1| glutaredoxin-family domain protein [Cyanothece sp. PCC 8801]
 gi|256588557|gb|ACU99443.1| glutaredoxin-family domain protein [Cyanothece sp. PCC 8802]
          Length = 243

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 106/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  R         K  +W DV T +LFAGK V +F+LPGAFTPTCS   LPG+ 
Sbjct: 9   KVPNVTFRTR---------KNNEWVDVTTDELFAGKTVVVFSLPGAFTPTCSSTHLPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + CLSVND FVMN W K  E  NV L+PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPVFKENGVDSIICLSVNDTFVMNEWAKDQEADNVILIPDGNGEFTEGMGMLVDKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD  VE  F+E         DP+E+S  E +LK I  + K
Sbjct: 120 GFGKRSWRYSMLVKDGFVEKMFIEP----EVPGDPFEVSDAETMLKYINPNAK 168


>gi|15676839|ref|NP_273984.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria meningitidis
           MC58]
 gi|218768030|ref|YP_002342542.1| putative redoxin [Neisseria meningitidis Z2491]
 gi|304387750|ref|ZP_07369930.1| peroxiredoxin/glutaredoxin family protein [Neisseria meningitidis
           ATCC 13091]
 gi|7226184|gb|AAF41352.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria meningitidis
           MC58]
 gi|121052038|emb|CAM08347.1| putative redoxin [Neisseria meningitidis Z2491]
 gi|254671332|emb|CBA08742.1| putative peroxiredoxin/glutaredoxin family protein [Neisseria
           meningitidis alpha153]
 gi|261392706|emb|CAX50279.1| putative peroxiredoxin (thioredoxin reductase) [Neisseria
           meningitidis 8013]
 gi|304338226|gb|EFM04356.1| peroxiredoxin/glutaredoxin family protein [Neisseria meningitidis
           ATCC 13091]
 gi|308389615|gb|ADO31935.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria meningitidis
           alpha710]
 gi|325136118|gb|EGC58727.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           M0579]
          Length = 245

 Score =  164 bits (416), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +L+ +
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLQFV 164


>gi|325130089|gb|EGC52875.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           OX99.30304]
          Length = 243

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 59  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +L+ +
Sbjct: 119 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLQFV 162


>gi|89075200|ref|ZP_01161631.1| Putative peroxiredoxin/glutaredoxin family protein [Photobacterium
           sp. SKA34]
 gi|89049022|gb|EAR54589.1| Putative peroxiredoxin/glutaredoxin family protein [Photobacterium
           sp. SKA34]
          Length = 242

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 80/172 (46%), Positives = 109/172 (63%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV FH R         K  QW DV T+DLFA K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFHTR---------KGDQWVDVTTEDLFANKTVVVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++++ C+SVND FVMNAW    + +N+  +PDG+GEFT+ M MLV KD++G
Sbjct: 61  LASVFAENGVDDILCVSVNDTFVMNAWKADQDAENITFIPDGNGEFTKGMDMLVEKDDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  FVE    +    DP+++S  + +LK I   +K
Sbjct: 121 FGARSWRYSMLVKNGVVEKMFVE----NEEPGDPFKVSDADTMLKYIAPEQK 168


>gi|254804829|ref|YP_003083050.1| putative peroxiredoxin/glutaredoxin family protein [Neisseria
           meningitidis alpha14]
 gi|254668371|emb|CBA05455.1| putative peroxiredoxin/glutaredoxin family protein [Neisseria
           meningitidis alpha14]
          Length = 245

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +L+ +
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EELGDPFKVSDADTMLQFV 164


>gi|325128095|gb|EGC50990.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           N1568]
          Length = 243

 Score =  164 bits (415), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 108/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 59  ELSGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 162


>gi|162449175|ref|YP_001611542.1| putative peroxiredoxin 2 family protein/glutaredoxin [Sorangium
           cellulosum 'So ce 56']
 gi|161159757|emb|CAN91062.1| putative peroxiredoxin 2 family protein/glutaredoxin [Sorangium
           cellulosum 'So ce 56']
          Length = 240

 Score =  164 bits (414), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 79/173 (45%), Positives = 113/173 (65%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  RV     DG    QWKDV T+D+FAGK+V +FALPGAFTPTCS   +P + 
Sbjct: 9   RVPDVTFRTRV-----DG----QWKDVTTKDVFAGKKVVVFALPGAFTPTCSSSHVPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++ ++ +  G++ + C+SVNDAFVM+ W K  E   ++ LPDG+GEF+ KMGMLV K N+
Sbjct: 60  ELAEEFKRRGVDTIACVSVNDAFVMDEWCKAQEADKIQFLPDGNGEFSEKMGMLVDKANL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+ D V++  F+E         DP+++S  + +LK +  S +
Sbjct: 120 GFGKRSWRYSMLVDDGVIKKMFIEP----EVEGDPFDVSDADTMLKYLDPSSE 168


>gi|309380091|emb|CBX21502.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria lactamica
           Y92-1009]
          Length = 245

 Score =  164 bits (414), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 109/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ +YC+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAIYCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ + VVE  F+E         DP+++S  + +LK +
Sbjct: 121 GFGKRSWRYSMLVNNGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 164


>gi|198282677|ref|YP_002218998.1| glutaredoxin-family domain-containing protein [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218666302|ref|YP_002424870.1| AhpC/TSA family/glutaredoxin domain protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247198|gb|ACH82791.1| glutaredoxin-family domain protein [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518515|gb|ACK79101.1| AhpC/TSA family/glutaredoxin domain protein [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 247

 Score =  163 bits (413), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 109/167 (65%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQ VF  R            QW+DV+T +LF GK V +F+LPGA+TPTCS   LP + +
Sbjct: 11  VPQAVFRTRDDN---------QWRDVSTDELFQGKTVIVFSLPGAYTPTCSSSHLPRYNE 61

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +    R  G++++ C+SVNDAFVM+AW K+L ++N+ L+PDG+GEFT  MGMLV K  +G
Sbjct: 62  LAPTFRENGVDDILCMSVNDAFVMDAWAKELAVENIHLIPDGNGEFTEGMGMLVDKSELG 121

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L+K+ ++E  F+E     +   DP+E+S  + +L  I
Sbjct: 122 FGKRSWRYSMLVKNGIIEKMFIEP----DKPGDPFEVSDADTMLHYI 164


>gi|294670157|ref|ZP_06735082.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria elongata
           subsp. glycolytica ATCC 29315]
 gi|291308084|gb|EFE49327.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria elongata
           subsp. glycolytica ATCC 29315]
          Length = 432

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 110/175 (62%), Gaps = 13/175 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++  ++P VVFH R             W DV+T DLF GK V +F+LPGAFTPTCS   L
Sbjct: 20  LVGTKVPSVVFHTRQGDA---------WVDVSTDDLFKGKTVAVFSLPGAFTPTCSSTHL 70

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  +    G++ + C+SVND FVMNAW    E +N+ ++PDG+GEFTR MGMLV 
Sbjct: 71  PRYNELAKEFFKRGVDSILCVSVNDTFVMNAWLADQEAENITVVPDGNGEFTRGMGMLVS 130

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           KD +GFG RSWRY  L+KD V+E  FVE    D    DP+E+S  + +LK I  S
Sbjct: 131 KDQLGFGDRSWRYSMLVKDGVIEKAFVEP-VKDG---DPFEVSDADTMLKSIDPS 181


>gi|329118725|ref|ZP_08247425.1| antioxidant [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465160|gb|EGF11445.1| antioxidant [Neisseria bacilliformis ATCC BAA-1200]
          Length = 250

 Score =  163 bits (412), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/168 (48%), Positives = 108/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVFH R         +   W DV+T DLF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 15  KVPSVVFHTR---------QGDAWVDVSTDDLFKGKTVVVFSLPGAFTPTCSSTHLPRYN 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  +    G++ + C+SVND FVMNAW    E +N+ ++PDG+GEFTR MGMLV K+ +
Sbjct: 66  ELAKEFFKRGVDSILCVSVNDTFVMNAWLADQEAENITVVPDGNGEFTRGMGMLVSKEGL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VVE  FVE    D    DP+E+S  + +LK I
Sbjct: 126 GFGDRSWRYSMLVKDGVVEKAFVEP-VKDG---DPFEVSDADTMLKYI 169


>gi|315127365|ref|YP_004069368.1| peroxiredoxin/glutaredoxin protein [Pseudoalteromonas sp. SM9913]
 gi|315015879|gb|ADT69217.1| peroxiredoxin/glutaredoxin protein [Pseudoalteromonas sp. SM9913]
          Length = 242

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 109/171 (63%), Gaps = 13/171 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IP V F  R         +  +WK V T D+F GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPNVTFATR---------QNDEWKSVTTDDIFKGKTVVVFSLPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +   L+  G++++ C+SVND FVMNAW +  E +N+ LLPDG+GEFT  MGMLV K+++G
Sbjct: 61  LAGVLKQNGVDDIVCVSVNDTFVMNAWAEHQEAQNITLLPDGNGEFTDGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           FG RSWRY  L+KD VVE  F+E     +   DP+E+S  + +L  I  ++
Sbjct: 121 FGKRSWRYSMLVKDGVVEKMFIEP----DLPGDPFEVSDADTMLDYINPTQ 167


>gi|77359709|ref|YP_339284.1| peroxiredoxin/glutaredoxin protein [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874620|emb|CAI85841.1| putative peroxiredoxin/glutaredoxin family protein
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 242

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (63%), Gaps = 13/168 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IP V F  R         +  +WK V T D+F GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPSVTFATR---------QNDEWKSVTTDDIFKGKTVVVFSLPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +   L+  G++E+ CLSVND FVMNAW +  E +N+ LLPDG+GEFT  MGMLV K+++G
Sbjct: 61  LAGVLKQNGVDEIVCLSVNDTFVMNAWAEHQEAQNITLLPDGNGEFTDGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG RSWRY  L+KD V++  F+E     +   DP+E+S  + +L  I 
Sbjct: 121 FGKRSWRYSMLVKDGVIDKMFIEP----DLPGDPFEVSDADTMLDYIN 164


>gi|186684761|ref|YP_001867957.1| glutaredoxin family protein [Nostoc punctiforme PCC 73102]
 gi|186467213|gb|ACC83014.1| Glutaredoxin-family domain protein [Nostoc punctiforme PCC 73102]
          Length = 244

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 107/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V FH R         K  QW DV T  LFA K V +F+LPGA+TPTCS   LPG+ 
Sbjct: 9   RVPNVTFHTR---------KDNQWVDVTTDQLFANKTVVVFSLPGAYTPTCSSTHLPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++ C+SVNDAFVMN W K  E +N+ L+PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAGIFKENGVDDIICISVNDAFVMNEWSKDQEAENITLIPDGNGEFTEGMGMLVDKSDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L++D V+   F+E     +   DP+++S  E +L+ I
Sbjct: 120 GFGKRSWRYSMLVRDGVINQMFIEP----DEPGDPFKVSDAETMLRYI 163


>gi|294787996|ref|ZP_06753240.1| antioxidant, AhpC/TSA family/glutaredoxin [Simonsiella muelleri
           ATCC 29453]
 gi|294484289|gb|EFG31972.1| antioxidant, AhpC/TSA family/glutaredoxin [Simonsiella muelleri
           ATCC 29453]
          Length = 249

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 110/168 (65%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVFH R         K   W DV+T DLF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 15  KVPSVVFHTR---------KDDAWVDVSTDDLFKGKTVAVFSLPGAFTPTCSSTHLPRYN 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  + +  G++++ C+SVND FVMNAW    E +N+ ++PDG+GEF++ MGMLV K+ +
Sbjct: 66  ELASEFKKRGVDDIVCVSVNDTFVMNAWLADQEAENITVVPDGNGEFSKGMGMLVSKEQL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD V+E  F+E    D    DP+E+S  + +LK I
Sbjct: 126 GFGDRSWRYSMLVKDGVIEKMFIEP-VKDG---DPFEVSDADTMLKHI 169


>gi|269103974|ref|ZP_06156671.1| peroxiredoxin family protein/glutaredoxin [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163872|gb|EEZ42368.1| peroxiredoxin family protein/glutaredoxin [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 242

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 109/172 (63%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV FH R         +  QW DV T DLFA K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFHTR---------QGDQWVDVTTNDLFANKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++++ C+SVND FVMNAW    E +N+  +PDG+GEFT+ MGMLV K+++G
Sbjct: 61  LASVFAENGVDDILCVSVNDTFVMNAWKADQEAENIIFVPDGNGEFTQGMGMLVEKEDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ V+E  F+E    +    DP+++S  + +LK I   +K
Sbjct: 121 FGPRSWRYSMLVKNGVIEKMFIE----NEEPGDPFKVSDADTMLKYIAPEQK 168


>gi|59801322|ref|YP_208034.1| putative peroxiredoxin family protein/glutaredoxin [Neisseria
           gonorrhoeae FA 1090]
 gi|194098439|ref|YP_002001498.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           NCCP11945]
 gi|239998839|ref|ZP_04718763.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           35/02]
 gi|240014246|ref|ZP_04721159.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           DGI18]
 gi|240016682|ref|ZP_04723222.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           FA6140]
 gi|240080871|ref|ZP_04725414.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           FA19]
 gi|240112765|ref|ZP_04727255.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           MS11]
 gi|240115515|ref|ZP_04729577.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           PID18]
 gi|240117811|ref|ZP_04731873.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           PID1]
 gi|240121809|ref|ZP_04734771.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           PID24-1]
 gi|240123366|ref|ZP_04736322.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           PID332]
 gi|240125614|ref|ZP_04738500.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           SK-92-679]
 gi|254493624|ref|ZP_05106795.1| redoxin [Neisseria gonorrhoeae 1291]
 gi|260440673|ref|ZP_05794489.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           DGI2]
 gi|268594681|ref|ZP_06128848.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           35/02]
 gi|268596989|ref|ZP_06131156.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           FA19]
 gi|268598832|ref|ZP_06132999.1| peroxiredoxin 2 family protein [Neisseria gonorrhoeae MS11]
 gi|268601189|ref|ZP_06135356.1| peroxiredoxin 2 family protein [Neisseria gonorrhoeae PID18]
 gi|268603510|ref|ZP_06137677.1| redoxin [Neisseria gonorrhoeae PID1]
 gi|268681990|ref|ZP_06148852.1| redoxin [Neisseria gonorrhoeae PID332]
 gi|268684202|ref|ZP_06151064.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           SK-92-679]
 gi|291043983|ref|ZP_06569699.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           DGI2]
 gi|293399182|ref|ZP_06643347.1| hybrid peroxiredoxin hyPrx5 [Neisseria gonorrhoeae F62]
 gi|59718217|gb|AAW89622.1| putative peroxiredoxin family protein/glutaredoxin [Neisseria
           gonorrhoeae FA 1090]
 gi|193933729|gb|ACF29553.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           NCCP11945]
 gi|226512664|gb|EEH62009.1| redoxin [Neisseria gonorrhoeae 1291]
 gi|268548070|gb|EEZ43488.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           35/02]
 gi|268550777|gb|EEZ45796.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           FA19]
 gi|268582963|gb|EEZ47639.1| peroxiredoxin 2 family protein [Neisseria gonorrhoeae MS11]
 gi|268585320|gb|EEZ49996.1| peroxiredoxin 2 family protein [Neisseria gonorrhoeae PID18]
 gi|268587641|gb|EEZ52317.1| redoxin [Neisseria gonorrhoeae PID1]
 gi|268622274|gb|EEZ54674.1| redoxin [Neisseria gonorrhoeae PID332]
 gi|268624486|gb|EEZ56886.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           SK-92-679]
 gi|291012446|gb|EFE04435.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           DGI2]
 gi|291610596|gb|EFF39706.1| hybrid peroxiredoxin hyPrx5 [Neisseria gonorrhoeae F62]
 gi|317164126|gb|ADV07667.1| putative peroxiredoxin family protein/glutaredoxin [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 245

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 108/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ + C+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAICCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK +
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 164


>gi|240128070|ref|ZP_04740731.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae
           SK-93-1035]
 gi|268686458|ref|ZP_06153320.1| redoxin [Neisseria gonorrhoeae SK-93-1035]
 gi|268626742|gb|EEZ59142.1| redoxin [Neisseria gonorrhoeae SK-93-1035]
          Length = 245

 Score =  161 bits (408), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 108/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ + C+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAICCVSVNDTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +LK +
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLKFV 164


>gi|110835493|ref|YP_694352.1| peroxiredoxin family protein/glutaredoxin [Alcanivorax borkumensis
           SK2]
 gi|110648604|emb|CAL18080.1| peroxiredoxin family protein/glutaredoxin, putative [Alcanivorax
           borkumensis SK2]
          Length = 245

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 78/167 (46%), Positives = 105/167 (62%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P V F  R         +  +WKDV T D+F GK V +FALPGAFTPTCS   LP + +
Sbjct: 10  VPAVTFRTR---------EGNEWKDVTTDDVFKGKTVVVFALPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +   L+  G++++ CLSVND FVMNAW       N+  +PDG+GEFT KMGMLV K ++G
Sbjct: 61  LAPVLKANGVDDIVCLSVNDGFVMNAWAGDQAAGNIHFIPDGNGEFTDKMGMLVNKQDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L+KD V++  F+E     +   DP+E+S  + +LK I
Sbjct: 121 FGPRSWRYSMLVKDGVIDRMFIEP----DKPGDPFEVSDADTMLKYI 163


>gi|219125318|ref|XP_002182930.1| peroxiredoxin [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405724|gb|EEC45666.1| peroxiredoxin [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 233

 Score =  161 bits (407), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 108/182 (59%), Gaps = 13/182 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P+V F  R + V  +    F WK   T D F GKRV +FA+PGAFTPTCS   LPG+E
Sbjct: 49  RVPEVTFLTR-SRVESNDPNPFDWKLRTTDDYFKGKRVVVFAIPGAFTPTCSSTHLPGYE 107

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK-----------LEIKNVKLLPDGSGEFTR 113
             YD +R +G+++VYCLSVNDAFVM  WG             L    VKL+PDG+  FTR
Sbjct: 108 AAYDKIRQQGVDDVYCLSVNDAFVMRQWGLHQGLTEDKTVGGLGFTKVKLIPDGAAAFTR 167

Query: 114 KMGMLVYKD-NVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            MGM    D   GFG RSWRY  ++ D V+E  FVE+    N   DP+E+S  + +L  +
Sbjct: 168 GMGMSTLWDVERGFGERSWRYSMVVNDGVIEKLFVEQPLLQNSGPDPFEVSDADTMLAYL 227

Query: 173 RE 174
           ++
Sbjct: 228 QQ 229


>gi|218439464|ref|YP_002377793.1| glutaredoxin-family domain protein [Cyanothece sp. PCC 7424]
 gi|218172192|gb|ACK70925.1| glutaredoxin-family domain protein [Cyanothece sp. PCC 7424]
          Length = 245

 Score =  160 bits (406), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 105/173 (60%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F +RV           +W D  T DLFAGK V +F+LPGAFTPTCS   LPG+ 
Sbjct: 9   KVPDAKFRLRVNN---------EWVDKTTDDLFAGKTVVVFSLPGAFTPTCSSTHLPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            +    +  G++++ C+SVNDAFVMN W K L   NV L+PDG+GEF+  MGMLV K ++
Sbjct: 60  DLAPVFKDNGVDDILCISVNDAFVMNEWAKDLNANNVTLIPDGNGEFSEGMGMLVDKSDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD  +E  F+E         DP+++S  + +L  I  S K
Sbjct: 120 GFGKRSWRYSMLVKDKTIEKMFIEP----EEPGDPFKVSDADTMLNYINPSAK 168


>gi|262393092|ref|YP_003284946.1| peroxiredoxin family protein/glutaredoxin [Vibrio sp. Ex25]
 gi|262336686|gb|ACY50481.1| peroxiredoxin family protein/glutaredoxin [Vibrio sp. Ex25]
          Length = 242

 Score =  160 bits (406), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 109/173 (63%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+PQV F +R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   QVPQVTFPVR---------QGDSWMNVTTDELFKGKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ C+SVND FVMNAW +  E +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 60  ELFPVFKEHGVDEIICVSVNDTFVMNAWKQDQEAENITFIPDGNGEFTDGMGMLVDKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VVE  F+E     N   DP+++S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLNYIAPDYK 168


>gi|89092171|ref|ZP_01165126.1| putative peroxiredoxin/glutaredoxin family protein [Oceanospirillum
           sp. MED92]
 gi|89083906|gb|EAR63123.1| putative peroxiredoxin/glutaredoxin family protein [Oceanospirillum
           sp. MED92]
          Length = 244

 Score =  160 bits (405), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 104/169 (61%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            IPQV FH R         +   W DV ++ LF GK V +FALPGAFTPTCS   LP + 
Sbjct: 9   NIPQVTFHTR---------QGNDWVDVTSEQLFKGKTVIVFALPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++E+ CLSVND FVMNAW +  + +NV  LPDG+GEF+  MGMLV KD +
Sbjct: 60  ELAPVFAANGVDEIICLSVNDTFVMNAWAEDQKAENVTFLPDGNGEFSEAMGMLVDKDEL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+KD V++  ++E     +   DP+++S  + +L  I 
Sbjct: 120 GFGKRSWRYSMLVKDGVIDKMYIEP----DLPGDPFQVSDADTMLDYIN 164


>gi|316985348|gb|EFV64297.1| hybrid peroxiredoxin hyPrx5 [Neisseria meningitidis H44/76]
 gi|319410279|emb|CBY90621.1| putative peroxiredoxin (thioredoxin reductase) [Neisseria
           meningitidis WUE 2594]
 gi|325140164|gb|EGC62691.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           CU385]
          Length = 245

 Score =  160 bits (405), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 108/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ + C+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELFGAFKENGVDAICCVSVNDTFVMNAWSAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +L+ +
Sbjct: 121 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLQFV 164


>gi|325200369|gb|ADY95824.1| antioxidant, AhpC/TSA family/glutaredoxin [Neisseria meningitidis
           H44/76]
          Length = 243

 Score =  160 bits (405), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 108/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVF  RV            WKDV+T DLF GK+V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPSVVFRTRVGDT---------WKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++ + C+SVND FVMNAW  + E  N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 59  ELFGAFKENGVDAICCVSVNDTFVMNAWSAEEESDNIYMIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+ D VVE  F+E         DP+++S  + +L+ +
Sbjct: 119 GFGKRSWRYSMLVNDGVVEKMFIEP----EEPGDPFKVSDADTMLQFV 162


>gi|269964455|ref|ZP_06178696.1| peroxiredoxin family protein/glutaredoxin [Vibrio alginolyticus
           40B]
 gi|269830793|gb|EEZ85011.1| peroxiredoxin family protein/glutaredoxin [Vibrio alginolyticus
           40B]
          Length = 242

 Score =  160 bits (405), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 109/173 (63%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+PQV F +R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   QVPQVTFPVR---------QGDSWVNVTTDELFKGKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ C+SVND FVMNAW +  E +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 60  ELFPVFKEHGVDEIICVSVNDTFVMNAWKQDQEAENITFIPDGNGEFTDGMGMLVDKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VVE  F+E     N   DP+++S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLNYIAPDYK 168


>gi|332534704|ref|ZP_08410533.1| peroxiredoxin family protein/glutaredoxin [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332035854|gb|EGI72337.1| peroxiredoxin family protein/glutaredoxin [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 242

 Score =  160 bits (405), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 107/168 (63%), Gaps = 13/168 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P V F  R         +  +WK V T ++F GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPSVTFATR---------QNNEWKSVTTDEIFKGKTVVVFSLPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +   L+  G++E+ CLSVND FVMNAW +  E +N+ LLPDG+GEFT  MGMLV K+++G
Sbjct: 61  LAGVLKQNGVDEIVCLSVNDTFVMNAWAEHQEAQNITLLPDGNGEFTDGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG RSWRY  L+KD V++  F+E     +   DP+E+S  + +L  I 
Sbjct: 121 FGKRSWRYSMLVKDGVIDKMFIEP----DLPGDPFEVSDADTMLDYIN 164


>gi|121604698|ref|YP_982027.1| glutaredoxin family protein [Polaromonas naphthalenivorans CJ2]
 gi|120593667|gb|ABM37106.1| Glutaredoxin-family domain protein [Polaromonas naphthalenivorans
           CJ2]
          Length = 259

 Score =  160 bits (404), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 110/176 (62%), Gaps = 19/176 (10%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQ  F  R         +  +W DV + +LF GK V +F+LPGA+TPTCS   LP + 
Sbjct: 22  HVPQATFKTR---------QNDKWVDVTSAELFDGKTVVVFSLPGAYTPTCSSTHLPRYN 72

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++ + L+  G++EV C+SVNDAFVMN WG+  E +N+ L+PDG+GEFT  MGMLV K ++
Sbjct: 73  ELANTLKAHGVDEVVCISVNDAFVMNEWGQAQEAENLTLIPDGNGEFTEGMGMLVDKSSL 132

Query: 125 GFGLRSWRYGALIKDMVVESWFVE---EGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+K+ ++E  F+E   EG       DP+E+S  + +L  I    K
Sbjct: 133 GFGKRSWRYSMLVKNGIIEKMFIEPEKEG-------DPFEVSDADTMLNYIAPGAK 181


>gi|90407070|ref|ZP_01215259.1| glutaredoxin [Psychromonas sp. CNPT3]
 gi|90311792|gb|EAS39888.1| glutaredoxin [Psychromonas sp. CNPT3]
          Length = 243

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 107/169 (63%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP V F  R         +   W +++T+ LFAGK V +FALPGAFTPTCS   LP + 
Sbjct: 9   KIPNVTFPTR---------QGDAWVNLSTEQLFAGKTVVVFALPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++   L+  G++++ CL+VND FVMNAW    E  N+ ++PDGSGEFT+ MGMLV K ++
Sbjct: 60  ELAGVLKENGVDDIICLAVNDTFVMNAWLADQEAANITVVPDGSGEFTQGMGMLVDKSDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+KD V+E  F+E     N   DP+E+S  + +L  I 
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----NQPGDPFEVSDADTMLNYIN 164


>gi|238794892|ref|ZP_04638491.1| Hybrid peroxiredoxin hyPrx5 [Yersinia intermedia ATCC 29909]
 gi|238725767|gb|EEQ17322.1| Hybrid peroxiredoxin hyPrx5 [Yersinia intermedia ATCC 29909]
          Length = 243

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IPQV FH R         +  QW DV T DLF+ K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPQVTFHTR---------QGDQWVDVTTDDLFSNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELAGVFKQHGVDSILCVSVNDTFVMNAWKADQHAENITFVPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|288941053|ref|YP_003443293.1| Redoxin domain-containing protein [Allochromatium vinosum DSM 180]
 gi|288896425|gb|ADC62261.1| Redoxin domain protein [Allochromatium vinosum DSM 180]
          Length = 244

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 106/172 (61%), Gaps = 13/172 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP V FH R         +  +W DV T +LFAGK V +F+LPGAFTPTCS   +P + 
Sbjct: 9   RIPSVTFHTR---------RGHEWVDVTTDELFAGKTVVVFSLPGAFTPTCSSSHVPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ V C+SVND FVMN W K     N+  +PDG+GEFT  MGMLV KD +
Sbjct: 60  QLVPAFKELGVDSVVCVSVNDTFVMNEWQKAQNADNLIFVPDGNGEFTEGMGMLVDKDAI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           GFG RSWRY  L++D VVE  F+E         DPYE+S+ + +L+ +  +K
Sbjct: 120 GFGKRSWRYSMLVRDGVVEKMFIEP----EVEGDPYEVSNADTMLEYLAPNK 167


>gi|91227291|ref|ZP_01261716.1| peroxiredoxin family protein/glutaredoxin [Vibrio alginolyticus
           12G01]
 gi|91188685|gb|EAS74974.1| peroxiredoxin family protein/glutaredoxin [Vibrio alginolyticus
           12G01]
          Length = 242

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 109/173 (63%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+PQV F +R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   QVPQVTFPVR---------QGDSWVNVTTDELFKGKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ C+SVND FVMNAW +  E +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 60  ELFPVFKEHGVDEIICVSVNDTFVMNAWKQDQEAENITFIPDGNGEFTDGMGMLVDKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VVE  F+E     N   DP+++S  + +L  +    K
Sbjct: 120 GFGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLNYLAPDYK 168


>gi|119487340|ref|ZP_01621091.1| Glutaredoxin-like region protein [Lyngbya sp. PCC 8106]
 gi|119455895|gb|EAW37030.1| Glutaredoxin-like region protein [Lyngbya sp. PCC 8106]
          Length = 244

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/169 (45%), Positives = 108/169 (63%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  R         +   W DV++ +LFAGK V +FALPGAFTPTCS   LPG+ 
Sbjct: 9   RVPDVTFRTR---------QNNDWVDVSSGELFAGKTVIVFALPGAFTPTCSSAHLPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + CLSVNDAFVMN W K  + +NV L+PDG+GEF+ ++GMLV K ++
Sbjct: 60  ELAPVFKQNGVDHIICLSVNDAFVMNEWAKDQKAENVMLIPDGNGEFSEQVGMLVDKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+KD V++  F+E     +   DP+E+S  E +L  I 
Sbjct: 120 GFGKRSWRYSMLVKDGVIDKMFIEP----DVPGDPFEVSDAETMLNYIN 164


>gi|325267621|ref|ZP_08134273.1| peroxiredoxin [Kingella denitrificans ATCC 33394]
 gi|324980971|gb|EGC16631.1| peroxiredoxin [Kingella denitrificans ATCC 33394]
          Length = 250

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P VVFH R         K   W DV+T DLF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 15  NVPSVVFHTR---------KDDAWVDVSTDDLFKGKTVAVFSLPGAFTPTCSSTHLPRYN 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  + +  G++ + C+SVND FVMNAW    E +N+ ++PDG+GEFT+ MGMLV K+ +
Sbjct: 66  ELAAEFKKRGVDSIVCISVNDTFVMNAWLADQEAENIIVVPDGNGEFTKGMGMLVSKEQL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD  +E  F+E    D    DP+E+S  + +LK I
Sbjct: 126 GFGDRSWRYSMLVKDGKIEKMFIEP-VKDG---DPFEVSDADTMLKYI 169


>gi|22124236|ref|NP_667659.1| peroxiredoxin family protein [Yersinia pestis KIM 10]
 gi|45442886|ref|NP_994425.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51594477|ref|YP_068668.1| peroxiredoxin/glutaredoxin family protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108806104|ref|YP_650020.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Antiqua]
 gi|108810217|ref|YP_645984.1| peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Nepal516]
 gi|145600775|ref|YP_001164851.1| peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Pestoides F]
 gi|150261121|ref|ZP_01917849.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           CA88-4125]
 gi|153949361|ref|YP_001399136.1| hybrid peroxiredoxin hyPrx5 [Yersinia pseudotuberculosis IP 31758]
 gi|162419256|ref|YP_001604753.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis Angola]
 gi|165928382|ref|ZP_02224214.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936984|ref|ZP_02225550.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166009504|ref|ZP_02230402.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213757|ref|ZP_02239792.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401355|ref|ZP_02306855.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420978|ref|ZP_02312731.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425931|ref|ZP_02317684.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167467890|ref|ZP_02332594.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis FV-1]
 gi|170026287|ref|YP_001722792.1| glutaredoxin family protein [Yersinia pseudotuberculosis YPIII]
 gi|186893469|ref|YP_001870581.1| glutaredoxin family protein [Yersinia pseudotuberculosis PB1/+]
 gi|218930916|ref|YP_002348791.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           CO92]
 gi|229839612|ref|ZP_04459771.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229841697|ref|ZP_04461853.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229896701|ref|ZP_04511866.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Pestoides A]
 gi|229904749|ref|ZP_04519860.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Nepal516]
 gi|270488732|ref|ZP_06205806.1| glutaredoxin [Yersinia pestis KIM D27]
 gi|294505566|ref|YP_003569628.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Z176003]
 gi|21957000|gb|AAM83910.1|AE013631_6 peroxiredoxin family protein [Yersinia pestis KIM 10]
 gi|45437753|gb|AAS63302.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51587759|emb|CAH19359.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|108773865|gb|ABG16384.1| peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Nepal516]
 gi|108778017|gb|ABG12075.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Antiqua]
 gi|115349527|emb|CAL22501.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           CO92]
 gi|145212471|gb|ABP41878.1| peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Pestoides F]
 gi|149290529|gb|EDM40606.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           CA88-4125]
 gi|152960856|gb|ABS48317.1| hybrid peroxiredoxin hyPrx5 [Yersinia pseudotuberculosis IP 31758]
 gi|162352071|gb|ABX86019.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis Angola]
 gi|165915226|gb|EDR33837.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165919612|gb|EDR36945.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991426|gb|EDR43727.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205159|gb|EDR49639.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961107|gb|EDR57128.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049380|gb|EDR60788.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055079|gb|EDR64878.1| hybrid peroxiredoxin hyPrx5 [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|169752821|gb|ACA70339.1| glutaredoxin-family domain protein [Yersinia pseudotuberculosis
           YPIII]
 gi|186696495|gb|ACC87124.1| glutaredoxin-family domain protein [Yersinia pseudotuberculosis
           PB1/+]
 gi|229678867|gb|EEO74972.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Nepal516]
 gi|229691036|gb|EEO83089.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229695978|gb|EEO86025.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229700308|gb|EEO88342.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Pestoides A]
 gi|262363633|gb|ACY60354.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           D106004]
 gi|262367563|gb|ACY64120.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           D182038]
 gi|270337236|gb|EFA48013.1| glutaredoxin [Yersinia pestis KIM D27]
 gi|294356025|gb|ADE66366.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           Z176003]
 gi|320013486|gb|ADV97057.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 243

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV T DLF+ K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KVPQVTFHTR---------QGDQWIDVTTDDLFSNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELAGVFKQHGVDSILCVSVNDTFVMNAWKSDQHAENITFVPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|166369019|ref|YP_001661292.1| putative peroxiredoxin [Microcystis aeruginosa NIES-843]
 gi|166091392|dbj|BAG06100.1| putative peroxiredoxin [Microcystis aeruginosa NIES-843]
          Length = 243

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 109/174 (62%), Gaps = 14/174 (8%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R         +  QW ++ +++LF GK V LFALPGAFTPTCS   LPG+ 
Sbjct: 9   RVPDVTFPVR---------QNNQWVNITSEELFKGKTVVLFALPGAFTPTCSTSHLPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    R  G++ + CLSVND FVMN W K  E  NV L+PDG+GEF+  MGMLV K ++
Sbjct: 60  ELAPVFRENGVDSIVCLSVNDTFVMNEWAKDQECDNVVLIPDGNGEFSAGMGMLVDKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR-ESKK 177
           GFG RSWRY  L+KD V+E  F+E         DP+++S  E +L  I  E+KK
Sbjct: 120 GFGQRSWRYSMLVKDGVIEKMFIEP----EEPGDPFKVSDAETMLNYINPEAKK 169


>gi|114321611|ref|YP_743294.1| glutaredoxin family protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228005|gb|ABI57804.1| Glutaredoxin-family domain protein [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 248

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 108/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P+VVF  R         K  +W DV+++DLF G+ V +F+LPGAFTPTCS   LP F 
Sbjct: 9   RVPEVVFRTR---------KDGEWVDVDSRDLFNGRTVAVFSLPGAFTPTCSSTHLPRFN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++E+ C+SVNDAFVMN W +    +N+ L+PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPVFFENGVDEIVCISVNDAFVMNEWARDQHAENITLIPDGNGEFTEGMGMLVDKTDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD V+E  F+E         DP+E+S  + +L+ I
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----QKPGDPFEVSDADTMLRYI 163


>gi|119469938|ref|ZP_01612743.1| putative peroxiredoxin/glutaredoxin family protein [Alteromonadales
           bacterium TW-7]
 gi|119446648|gb|EAW27921.1| putative peroxiredoxin/glutaredoxin family protein [Alteromonadales
           bacterium TW-7]
          Length = 242

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IP V F  R         +  +WK V T ++F G+ V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPNVTFATR---------QNDEWKSVTTDEIFKGRTVAVFSLPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +    +  G++E+ CLSVND FVMNAW +  E +N+ LLPDG+GEFT  MGMLV K+++G
Sbjct: 61  LAGVFKQNGVDEIVCLSVNDTFVMNAWAEHQEAQNITLLPDGNGEFTDGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           FG RSWRY  L+KD V+E  F+E     +   DP+E+S  + +L  I 
Sbjct: 121 FGKRSWRYSMLVKDGVIEKMFIEP----DLPGDPFEVSDADTMLDYIN 164


>gi|238022705|ref|ZP_04603131.1| hypothetical protein GCWU000324_02614 [Kingella oralis ATCC 51147]
 gi|237865908|gb|EEP67044.1| hypothetical protein GCWU000324_02614 [Kingella oralis ATCC 51147]
          Length = 250

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 107/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P VVFH R         +   W DV+T DLF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 15  NVPSVVFHTR---------QDDAWVDVSTDDLFKGKTVAVFSLPGAFTPTCSSTHLPRYN 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  + +  G++ + C+SVND FVMNAW    E +N+ ++PDG+GEFT+ MGMLV K+ +
Sbjct: 66  ELAAEFKKRGVDSIVCISVNDTFVMNAWLADQEAENITVVPDGNGEFTKGMGMLVSKEQL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD  +E  F+E    D    DP+E+S  + +LK I
Sbjct: 126 GFGDRSWRYSMLVKDGKIEKMFIEP-VKDG---DPFEVSDADTMLKYI 169


>gi|307151746|ref|YP_003887130.1| glutaredoxin-family domain-containing protein [Cyanothece sp. PCC
           7822]
 gi|306981974|gb|ADN13855.1| glutaredoxin-family domain protein [Cyanothece sp. PCC 7822]
          Length = 244

 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 104/173 (60%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F +RV           QW D  T DLFAGK V +F+LPGAFTPTCS   LPG+ 
Sbjct: 9   KVPDAKFRLRVNE---------QWVDKTTDDLFAGKTVVVFSLPGAFTPTCSSTHLPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            +    +  G++++ C+SVND FVMN W K L   N+ L+PDG+ EFT  MGMLV K ++
Sbjct: 60  DLAAVFKENGVDDIICISVNDTFVMNEWAKDLNANNITLIPDGNAEFTEGMGMLVDKSDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD V+E  F+E         DP+++S  + +L  I  + K
Sbjct: 120 GFGKRSWRYSMLVKDKVIEKMFIEP----EEPGDPFKVSDADTMLNYINPNAK 168


>gi|114320380|ref|YP_742063.1| glutaredoxin family protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226774|gb|ABI56573.1| Glutaredoxin-family domain protein [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 248

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 108/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P+VVF  R         K  +W DV+++DLF G+ V +F+LPGAFTPTCS   LP F 
Sbjct: 9   RVPEVVFRTR---------KDGEWVDVDSRDLFNGRTVAVFSLPGAFTPTCSSTHLPRFN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++E+ C+SVNDAFVMN W +    +N+ L+PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPVFFENGVDEIVCISVNDAFVMNEWARDQHAENITLIPDGNGEFTEGMGMLVDKTDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD V+E  F+E         DP+E+S  + +L+ I
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----QKPGDPFEVSDADTMLRYI 163


>gi|261856755|ref|YP_003264038.1| redoxin [Halothiobacillus neapolitanus c2]
 gi|261837224|gb|ACX96991.1| Redoxin domain protein [Halothiobacillus neapolitanus c2]
          Length = 245

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/165 (46%), Positives = 103/165 (62%), Gaps = 13/165 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F MR         +  QW DV T DLF GK V +F+LPGAFTPTCS   +P F 
Sbjct: 9   RVPNVTFRMR---------ENNQWVDVTTDDLFKGKTVAVFSLPGAFTPTCSSSHVPRFN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++E+ CLSVND FVMN W      ++++ +PDG+GEF+  MGMLV K+N+
Sbjct: 60  ELAPVFFKHGVDEILCLSVNDTFVMNEWAADQNAEHIRFIPDGNGEFSEGMGMLVDKENL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
           GFG RSWRY  L+KD V+E  F+E     N   DPYE+S  + +L
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----NVEGDPYEVSDADTML 160


>gi|209696120|ref|YP_002264050.1| hybrid peroxiredoxin (thioredoxin reductase) [Aliivibrio
           salmonicida LFI1238]
 gi|208010073|emb|CAQ80397.1| hybrid peroxiredoxin (thioredoxin reductase) [Aliivibrio
           salmonicida LFI1238]
          Length = 242

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 107/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQV F  R         K   W +V T++LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   SVPQVTFPTR---------KGDAWVNVTTEELFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y   +  G++E+ C+SVND FVMNAW    E +N+  +PDG+G+FT  MGMLV K+++
Sbjct: 60  ELYSVFKDNGVDEIVCVSVNDTFVMNAWKADQEAENITFIPDGNGDFTDGMGMLVEKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+K+ +VE  F+EE    N   DP+++S  + +L  +    K
Sbjct: 120 GFGKRSWRYSMLVKNGIVEKMFIEE----NVPGDPFKVSDADTMLNYLAPEHK 168


>gi|331006543|ref|ZP_08329837.1| putative peroxiredoxin family protein/glutaredoxin [gamma
           proteobacterium IMCC1989]
 gi|330419651|gb|EGG94023.1| putative peroxiredoxin family protein/glutaredoxin [gamma
           proteobacterium IMCC1989]
          Length = 244

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 102/169 (60%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P V F  R         +  QW DV + D+F GK V LFALPGAFTPTCS   LP + 
Sbjct: 9   QVPNVTFRTR---------QGDQWVDVTSDDIFKGKNVVLFALPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++      EG++ + CLSVND FVMN+W       N+  +PDG+GEF+  MGMLV K+++
Sbjct: 60  ELAPVFNAEGVDSIVCLSVNDTFVMNSWAADQHADNITFIPDGNGEFSDGMGMLVGKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+KD V+E  F+E     +   DP+++S  + +L  I 
Sbjct: 120 GFGNRSWRYSMLVKDGVIEKMFIEA----DVPGDPFDVSDADTMLNHIN 164


>gi|225025427|ref|ZP_03714619.1| hypothetical protein EIKCOROL_02325 [Eikenella corrodens ATCC
           23834]
 gi|224941711|gb|EEG22920.1| hypothetical protein EIKCOROL_02325 [Eikenella corrodens ATCC
           23834]
          Length = 251

 Score =  158 bits (400), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 78/175 (44%), Positives = 107/175 (61%), Gaps = 19/175 (10%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++  Q+P V FH RVA           WKDV T +LF GK+V +FALPGAFTPTCS   L
Sbjct: 11  LVGQQVPNVTFHTRVAD---------SWKDVTTDELFKGKKVVVFALPGAFTPTCSSSHL 61

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++    +  GI+++ C+SVND FVMNAW    E  N+ ++PDG+ EFTR MGM V 
Sbjct: 62  PRYNELASAFKENGIDDILCVSVNDTFVMNAWAADEEAHNITMIPDGNCEFTRGMGMEVN 121

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVE---EGFSDNCATDPYEISSPENVLKVI 172
           ++ +GFG RSWRY  L+ D  +   F+E   EG       DP+E+S  + +LK +
Sbjct: 122 EEAIGFGPRSWRYSMLVDDGKIVEAFIEPIKEG-------DPFEVSDADTMLKFV 169


>gi|319942947|ref|ZP_08017230.1| antioxidant [Lautropia mirabilis ATCC 51599]
 gi|319743489|gb|EFV95893.1| antioxidant [Lautropia mirabilis ATCC 51599]
          Length = 246

 Score =  158 bits (400), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 108/168 (64%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P VVFH R             W DV+T +LFAGKRV +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPAVVFHTRSGDA---------WVDVSTDELFAGKRVVVFSLPGAFTPTCSSSHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  GI+ + C+SVND FVMNAW    E +N+ ++PDG+GEFT  MGMLV K+++
Sbjct: 61  ELAPVFKKLGIDSILCVSVNDTFVMNAWKDDQEAENIGVIPDGNGEFTAGMGMLVDKNDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L++D  V+  F+E     +   DP+E+S  + +LK +
Sbjct: 121 GFGKRSWRYSMLVEDGTVKKMFIEP----DKPGDPFEVSDADTMLKYL 164


>gi|293393504|ref|ZP_06637814.1| peroxiredoxin [Serratia odorifera DSM 4582]
 gi|291423839|gb|EFE97058.1| peroxiredoxin [Serratia odorifera DSM 4582]
          Length = 243

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV T DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KVPQVTFHTR---------QGDQWIDVTTDDLFKNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++ +  +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELSNVFKQHGVDGILCVSVNDTFVMNAWKADQHAENITFVPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|238760133|ref|ZP_04621281.1| Hybrid peroxiredoxin hyPrx5 [Yersinia aldovae ATCC 35236]
 gi|238701631|gb|EEP94200.1| Hybrid peroxiredoxin hyPrx5 [Yersinia aldovae ATCC 35236]
          Length = 243

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IPQV FH R         +  QW DV T +LF+ K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPQVTFHTR---------QGDQWVDVTTDELFSNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELAGVFKQHGVDSILCVSVNDTFVMNAWKSDQHAENITFIPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|270265158|ref|ZP_06193420.1| hypothetical protein SOD_l00080 [Serratia odorifera 4Rx13]
 gi|270040792|gb|EFA13894.1| hypothetical protein SOD_l00080 [Serratia odorifera 4Rx13]
          Length = 243

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 104/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV T DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KVPQVTFHTR---------QGDQWIDVTTNDLFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELSSVFKQHGVDSILCVSVNDTFVMNAWKADQHAENITFVPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|152978074|ref|YP_001343703.1| glutaredoxin family protein [Actinobacillus succinogenes 130Z]
 gi|150839797|gb|ABR73768.1| glutaredoxin-family domain protein [Actinobacillus succinogenes
           130Z]
          Length = 240

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 108/169 (63%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IPQV FH R         +   W DV T +LF  K V LF+LPGAFTPTCS   LP + 
Sbjct: 7   KIPQVTFHTR---------QGDAWVDVTTSELFDNKTVVLFSLPGAFTPTCSSTHLPRYN 57

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  + +  G++++ C+SVND FVMNAW    E +N+ ++PDG+GEFT  MGMLV K+ +
Sbjct: 58  ELACEFKALGVDDIICMSVNDTFVMNAWKADQEAENITVIPDGNGEFTEGMGMLVDKEEL 117

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+++ VVE  FVE     N   DP+++S  + ++K ++
Sbjct: 118 GFGKRSWRYSMLVRNGVVEKMFVEP----NEPGDPFKVSDADTMIKYLK 162


>gi|157373008|ref|YP_001480997.1| glutaredoxin family protein [Serratia proteamaculans 568]
 gi|157324772|gb|ABV43869.1| glutaredoxin-family domain protein [Serratia proteamaculans 568]
          Length = 243

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 104/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV T DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KVPQVTFHTR---------QGDQWIDVTTNDLFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELSSVFKQHGVDNILCVSVNDTFVMNAWKADQHAENITFVPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|159026585|emb|CAO86518.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 243

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 81/174 (46%), Positives = 109/174 (62%), Gaps = 14/174 (8%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R         +  QW ++ +++LF GK V LFALPGAFTPTCS   LPG+ 
Sbjct: 9   RVPDVTFPVR---------QNNQWVNITSEELFKGKTVVLFALPGAFTPTCSTSHLPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    R  G++ + CLSVND FVMN W K  E  NV L+PDG+GEF+  MGMLV K ++
Sbjct: 60  ELAPVFRENGVDTIVCLSVNDTFVMNEWAKDQECDNVVLIPDGNGEFSAGMGMLVDKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR-ESKK 177
           GFG RSWRY  L+KD V+E  F+E         DP+++S  E +L  I  E+KK
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----EEPGDPFKVSDAETMLHYINPEAKK 169


>gi|90413602|ref|ZP_01221592.1| Putative peroxiredoxin/glutaredoxin family protein [Photobacterium
           profundum 3TCK]
 gi|90325375|gb|EAS41864.1| Putative peroxiredoxin/glutaredoxin family protein [Photobacterium
           profundum 3TCK]
          Length = 242

 Score =  157 bits (397), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV FH R         +   W DV T++LFA K V LF+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFHTR---------QGDAWVDVTTEELFANKTVVLFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++E+ C+SVND FVMNAW    E +N+  +PDG+GEF++ M MLV K+++G
Sbjct: 61  LASVFAEHGVDEIVCVSVNDTFVMNAWKADQEAENITFIPDGNGEFSKGMNMLVDKEDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  FVE+        DP+++S  + +L  +  + K
Sbjct: 121 FGPRSWRYSMLVKNGVVEKMFVEQ----EEPGDPFKVSDADTMLNYVAPNHK 168


>gi|54307493|ref|YP_128513.1| putative peroxiredoxin/glutaredoxin family protein [Photobacterium
           profundum SS9]
 gi|46911913|emb|CAG18711.1| Putative peroxiredoxin/glutaredoxin family protein [Photobacterium
           profundum SS9]
          Length = 242

 Score =  157 bits (397), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 107/172 (62%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV FH R         +   W DV T++LFA K V LF+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFHTR---------QGDAWVDVTTEELFANKTVVLFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++E+ C+SVND FVMNAW    E +N+  +PDG+GEF++ M MLV K+++G
Sbjct: 61  LASVFAEHGVDEIVCVSVNDTFVMNAWKADQEAENITFIPDGNGEFSKGMDMLVDKEDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  FVE+        DP+++S  + +L  I  + K
Sbjct: 121 FGPRSWRYSMLVKNGVVEKMFVEQ----EEPGDPFKVSDADTMLNYIAPNHK 168


>gi|332968831|gb|EGK07878.1| peroxiredoxin [Kingella kingae ATCC 23330]
          Length = 248

 Score =  157 bits (397), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 107/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P VVFH R         +   W DV+T DLF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 15  NVPAVVFHTR---------QDDAWVDVSTDDLFKGKTVAVFSLPGAFTPTCSSTHLPRYN 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  + +  G++ + C+SVND FVMNAW    E +N+ ++PDG+GEFT+ MGMLV K+ +
Sbjct: 66  ELAAEFKKRGVDSIVCISVNDTFVMNAWLADQEAENIIVVPDGNGEFTKGMGMLVSKEAL 125

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD  +E  F+E    D    DP+E+S  + +LK I
Sbjct: 126 GFGDRSWRYSMLVKDGKIEKMFIEP-VKDG---DPFEVSDADTMLKYI 169


>gi|28899527|ref|NP_799132.1| peroxiredoxin family protein/glutaredoxin [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153839012|ref|ZP_01991679.1| AhpC/TSA family/glutaredoxin domain protein [Vibrio
           parahaemolyticus AQ3810]
 gi|260364786|ref|ZP_05777369.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus K5030]
 gi|260879396|ref|ZP_05891751.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus AN-5034]
 gi|260896904|ref|ZP_05905400.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [Vibrio
           parahaemolyticus Peru-466]
 gi|260903204|ref|ZP_05911599.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus AQ4037]
 gi|28807763|dbj|BAC61016.1| peroxiredoxin family protein/glutaredoxin [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|149747519|gb|EDM58459.1| AhpC/TSA family/glutaredoxin domain protein [Vibrio
           parahaemolyticus AQ3810]
 gi|308086746|gb|EFO36441.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [Vibrio
           parahaemolyticus Peru-466]
 gi|308089693|gb|EFO39388.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus AN-5034]
 gi|308108455|gb|EFO45995.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus AQ4037]
 gi|308114488|gb|EFO52028.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus K5030]
          Length = 242

 Score =  157 bits (396), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQV F  R         +   W +V + DLF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   NVPQVTFPTR---------QGDTWVNVTSDDLFKGKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ C+SVNDAFVMNAW    E +++  +PDG+GEFT  MGMLV K+++
Sbjct: 60  ELFPVFKEHGVDEILCISVNDAFVMNAWKHDQEAEHITFIPDGNGEFTDGMGMLVDKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD V+E  F+E     N   DP+++S  + +L  I
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----NEPGDPFKVSDADTMLNYI 163


>gi|238785777|ref|ZP_04629749.1| Hybrid peroxiredoxin hyPrx5 [Yersinia bercovieri ATCC 43970]
 gi|238713311|gb|EEQ05351.1| Hybrid peroxiredoxin hyPrx5 [Yersinia bercovieri ATCC 43970]
          Length = 243

 Score =  157 bits (396), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 104/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IPQV FH R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPQVTFHTR---------QGDQWIDVTTDELFNNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELAGVFKQHGVDSILCVSVNDTFVMNAWKADQSAENITFIPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|238764504|ref|ZP_04625452.1| Hybrid peroxiredoxin hyPrx5 [Yersinia kristensenii ATCC 33638]
 gi|238697316|gb|EEP90085.1| Hybrid peroxiredoxin hyPrx5 [Yersinia kristensenii ATCC 33638]
          Length = 243

 Score =  157 bits (396), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 104/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IPQV FH R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPQVTFHTR---------QGDQWVDVTTDELFNNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELASVFKQHGVDNILCVSVNDTFVMNAWKADQHAENITFIPDGNGEFTKGMDMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|262273431|ref|ZP_06051245.1| peroxiredoxin family protein/glutaredoxin [Grimontia hollisae CIP
           101886]
 gi|262222409|gb|EEY73720.1| peroxiredoxin family protein/glutaredoxin [Grimontia hollisae CIP
           101886]
          Length = 243

 Score =  156 bits (395), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 106/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  R         +  QW +V T +LFAGK V +F+LPGAFTPTCS   LP + 
Sbjct: 10  KVPSVTFPTR---------QGDQWVNVTTDELFAGKTVVVFSLPGAFTPTCSSTHLPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++Y   + +G++++ C+SVND FVMNAW    +  N+  +PDG+  FTR MGM V KD++
Sbjct: 61  ELYPVFKEQGVDDILCISVNDTFVMNAWKADQKADNITFIPDGNAAFTRGMGMAVAKDDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD V+E  F+E     N   DP+++S  + +L  I    K
Sbjct: 121 GFGERSWRYSMLVKDGVIEKMFIEP----NEPGDPFKVSDADTMLNYIAPDHK 169


>gi|238798323|ref|ZP_04641807.1| Hybrid peroxiredoxin hyPrx5 [Yersinia mollaretii ATCC 43969]
 gi|238717870|gb|EEQ09702.1| Hybrid peroxiredoxin hyPrx5 [Yersinia mollaretii ATCC 43969]
          Length = 243

 Score =  156 bits (395), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 104/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KVPQVTFHTR---------QGDQWIDVTTDELFNNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELASVFKQHGVDSILCVSVNDTFVMNAWKADQSAENITFIPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|303250984|ref|ZP_07337173.1| hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307253131|ref|ZP_07535012.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|302650201|gb|EFL80368.1| hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306859425|gb|EFM91457.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 244

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 108/172 (62%), Gaps = 13/172 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNVTFHTR---------QGDAWVDVTTAELFDNKTVIVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  + +  G++++ C+SVND FVMNAW   LE +NV ++PDG+GEFT  MGMLV 
Sbjct: 57  PRYNELACEFKAAGVDDIICMSVNDTFVMNAWKADLESENVTVIPDGNGEFTEGMGMLVG 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           K+++GFG RSWRY  L+K+ VVE  F+E         DP+++S  + ++K +
Sbjct: 117 KEDLGFGKRSWRYSMLVKNGVVEKMFIEP----QEPGDPFKVSDADTMMKYL 164


>gi|318603887|emb|CBY25385.1| peroxiredoxin family protein/glutaredoxin [Yersinia enterocolitica
           subsp. palearctica Y11]
          Length = 243

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 104/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KVPQVTFHTR---------QGDQWVDVTTDELFNNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELAGVFKQHGVDSILCVSVNDTFVMNAWKADQHAENITFIPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|332159755|ref|YP_004296332.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325663985|gb|ADZ40629.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 243

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 104/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KVPQVAFHTR---------QGDQWVDVTTDELFNNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELAGVFKQHGVDSILCVSVNDTFVMNAWKADQHAENITFIPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|238754706|ref|ZP_04616058.1| Hybrid peroxiredoxin hyPrx5 [Yersinia ruckeri ATCC 29473]
 gi|238707014|gb|EEP99379.1| Hybrid peroxiredoxin hyPrx5 [Yersinia ruckeri ATCC 29473]
          Length = 243

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 103/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV T  LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KVPQVTFHTR---------QGDQWVDVTTDKLFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELSSVFKQHGVDSILCVSVNDTFVMNAWKADQHAENITFIPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|78484484|ref|YP_390409.1| glutaredoxin-like region [Thiomicrospira crunogena XCL-2]
 gi|78362770|gb|ABB40735.1| Glutaredoxin-like region [Thiomicrospira crunogena XCL-2]
          Length = 247

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 106/172 (61%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P VV+  R         +  +W +V + D+F G+ V +F+LPGAFTPTCS   LP + +
Sbjct: 13  VPSVVWPTR---------QNNEWVNVKSDDIFKGRTVVVFSLPGAFTPTCSSSHLPRYNE 63

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++E+ CLSVND FVMN W K  E  NV L+PDG+GEFT  MGMLV K ++G
Sbjct: 64  LAPVFFENGVDEIVCLSVNDTFVMNEWAKDQECTNVTLIPDGNGEFTDGMGMLVDKSDLG 123

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+E+S  + +LK I  + +
Sbjct: 124 FGKRSWRYSMLVKDGVVEKMFIEP----NVPGDPFEVSDADTMLKYINPNAQ 171


>gi|73538279|ref|YP_298646.1| glutaredoxin-like region [Ralstonia eutropha JMP134]
 gi|72121616|gb|AAZ63802.1| Glutaredoxin-like region [Ralstonia eutropha JMP134]
          Length = 243

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 106/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP V F +R         +  +WK V + DLF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RIPNVAFRIR---------QDNEWKTVTSGDLFNGKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++E+ C+SVND FVMN W K  E +N+ ++PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPAFAKHGVDEILCVSVNDTFVMNEWAKDQESQNITMIPDGNGEFTEGMGMLVDKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L++D VVE  F+E     N   DP+++S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVRDGVVEKMFIEP----NEPGDPFKVSDADTMLNHIAPDAK 168


>gi|238750870|ref|ZP_04612368.1| Hybrid peroxiredoxin hyPrx5 [Yersinia rohdei ATCC 43380]
 gi|238711014|gb|EEQ03234.1| Hybrid peroxiredoxin hyPrx5 [Yersinia rohdei ATCC 43380]
          Length = 243

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP V FH R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPPVTFHTR---------QGDQWIDVTTDELFNNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++ +  + +G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELANVFKQQGVDSILCVSVNDTFVMNAWKADQHAENITFIPDGNGEFTKSMDMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|123440531|ref|YP_001004525.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122087492|emb|CAL10273.1| putative peroxiredoxin/glutaredoxin family protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 243

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 104/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KVPQVTFHTR---------QGDQWVDVTTDELFNNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELAGVFKQHGVDSILCVSVNDTFVMNAWKADQHAENITFIPDGNGEFTKGMDMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|300714761|ref|YP_003739564.1| peroxiredoxin/glutaredoxin family protein [Erwinia billingiae
           Eb661]
 gi|299060597|emb|CAX57704.1| Putative peroxiredoxin/glutaredoxin family protein [Erwinia
           billingiae Eb661]
          Length = 243

 Score =  155 bits (393), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 102/167 (61%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV FH R         +   W DV T +LF  K V LF+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFHTR---------QGDNWVDVTTDELFKDKTVILFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + D  +  G++ + C+SVND FVMNAW       N+  +PDG+G+FTR M MLV K ++G
Sbjct: 61  LSDVFKKHGVDSILCVSVNDTFVMNAWKADQHASNITFIPDGNGDFTRGMEMLVEKADLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +L+ +
Sbjct: 121 FGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLRYL 163


>gi|259906841|ref|YP_002647197.1| peroxiredoxin/glutaredoxin family protein [Erwinia pyrifoliae
           Ep1/96]
 gi|224962463|emb|CAX53918.1| peroxiredoxin/glutaredoxin family protein [Erwinia pyrifoliae
           Ep1/96]
 gi|283476633|emb|CAY72461.1| putative peroxiredoxin/glutaredoxin family protein [Erwinia
           pyrifoliae DSM 12163]
          Length = 243

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/167 (44%), Positives = 103/167 (61%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFHTR---------QGDSWIDVTTDELFKDKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + D  +  G++ + C+SVND FVMNAW      +++  +PDG+GEFTR M MLV K ++G
Sbjct: 61  LSDVFKQHGVDSILCISVNDTFVMNAWKADQRAEHITFIPDGNGEFTRGMEMLVEKADLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +L+ +
Sbjct: 121 FGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLRYV 163


>gi|300866476|ref|ZP_07111167.1| peroxiredoxin 2 family protein/glutaredoxin [Oscillatoria sp. PCC
           6506]
 gi|300335520|emb|CBN56327.1| peroxiredoxin 2 family protein/glutaredoxin [Oscillatoria sp. PCC
           6506]
          Length = 244

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/169 (42%), Positives = 103/169 (60%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V FH R            +W  V T +LF+GK V +F+LPGAFTPTCS   +PG+ 
Sbjct: 9   RVPSVTFHTRTDN---------EWVKVTTDELFSGKTVIVFSLPGAFTPTCSSTHVPGYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++ C+SVND FVMN W K  E  N+ ++PDG+GEFT  MG+LV K ++
Sbjct: 60  QLAKTFKENGVDDIICISVNDTFVMNEWAKAQESTNITMIPDGNGEFTEGMGLLVDKVDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+KD  +E  F+E         DP+++S  E +L  I 
Sbjct: 120 GFGKRSWRYSMLVKDGTIEKMFIEP----EEPGDPFKVSDAETMLNYIN 164


>gi|251787777|ref|YP_003002498.1| glutaredoxin-family domain-containing protein [Dickeya zeae
           Ech1591]
 gi|247536398|gb|ACT05019.1| glutaredoxin-family domain protein [Dickeya zeae Ech1591]
          Length = 243

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP V FH R         +  QW DV T++LF+ K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPSVTFHTR---------QGDQWVDVTTEELFSNKTVVVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ V C+SVND FVMNAW    + +N+  +PDG+GEFTR M MLV K ++
Sbjct: 60  ELAAVFKQFGVDAVLCVSVNDTFVMNAWKADQDAENITFIPDGNGEFTRAMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L++  +VE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRHGMVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|317494781|ref|ZP_07953193.1| glutaredoxin-family domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316917383|gb|EFV38730.1| glutaredoxin-family domain-containing protein [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 244

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IPQV FH R         +  QW DV T DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPQVTFHTR---------QGDQWIDVTTDDLFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++      +G++ + C+SVND FVMNAW    + +++  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELAPIFHEKGVDSILCVSVNDTFVMNAWKADQKAEHITFVPDGNGEFTKGMNMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|323494829|ref|ZP_08099926.1| peroxiredoxin family protein/glutaredoxin [Vibrio brasiliensis LMG
           20546]
 gi|323310937|gb|EGA64104.1| peroxiredoxin family protein/glutaredoxin [Vibrio brasiliensis LMG
           20546]
          Length = 242

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 107/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQV F  R         +   W +V + +LF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   NVPQVTFPTR---------QGDAWVNVTSDELFNGKTVLVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ C+SVND FVMNAW +  E +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 60  ELFPVFKEHGVDEILCVSVNDTFVMNAWKQDQEAENITFIPDGNGEFTDGMGMLVDKNDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VVE  F+E     N   DP+++S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLAHIAPDYK 168


>gi|260774717|ref|ZP_05883621.1| peroxiredoxin family protein/glutaredoxin [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260609373|gb|EEX35524.1| peroxiredoxin family protein/glutaredoxin [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 242

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 105/173 (60%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQV F  R         +   W  V + +LF GK V LF+LPGAFTPTCS   LP + 
Sbjct: 9   NVPQVTFPTR---------QGDAWVSVTSDELFKGKTVILFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ C+SVND FVMNAW    E  N+  LPDG+GEFT  MG+LV K+++
Sbjct: 60  ELFPVFQDHGVDEIICVSVNDTFVMNAWKNDQEADNITFLPDGNGEFTDGMGLLVDKNDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VVE  F+E     N   DP+++S  + +L  I  + K
Sbjct: 120 GFGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLNYIAPNYK 168


>gi|34497491|ref|NP_901706.1| peroxiredoxin/glutaredoxin family protein [Chromobacterium
           violaceum ATCC 12472]
 gi|34103346|gb|AAQ59708.1| probable peroxiredoxin/glutaredoxin family protein [Chromobacterium
           violaceum ATCC 12472]
          Length = 243

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 106/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R         +  +WK+V T +LF GK V LF+LPGAFTPTCS   LP F 
Sbjct: 9   RVPNVTFRIR---------ENNEWKNVTTAELFDGKTVALFSLPGAFTPTCSSTHLPRFN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++ + C+SVND FVMN W K  E +N+ ++PDG+G+FT  MGMLV K ++
Sbjct: 60  ELAPAFFANGVDAILCVSVNDTFVMNEWAKDQEAQNIVMIPDGNGDFTEGMGMLVDKQDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VV+  FVE         DP+++S  + +L  I  S K
Sbjct: 120 GFGKRSWRYSMLVKDGVVDKMFVEP----QEPGDPFKVSDADTLLNYINPSAK 168


>gi|149189165|ref|ZP_01867452.1| peroxiredoxin family protein/glutaredoxin [Vibrio shilonii AK1]
 gi|148836919|gb|EDL53869.1| peroxiredoxin family protein/glutaredoxin [Vibrio shilonii AK1]
          Length = 242

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 105/167 (62%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F  R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFPTR---------QGDAWVNVTTDELFKGKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++E+ C+SVND FVMNAW    E +N+  +PDG+G+FT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDEILCVSVNDTFVMNAWKNDQEAENITFIPDGNGDFTEGMGMLVEKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L+KD +VE  F+E     N   DP+++S  + +L  I
Sbjct: 121 FGKRSWRYSMLVKDGIVEKMFIEP----NEPGDPFKVSDADTMLGYI 163


>gi|301155319|emb|CBW14785.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 241

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDQWVDVTTSELFDNKTVVVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  E  NVK +PDG+G FT  MGMLV KD++
Sbjct: 59  ELAPVFKQHGVDDILVVSVNDTFVMNAWKEAEEAHNVKFIPDGNGTFTEGMGMLVGKDDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK I
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYI 162


>gi|88858154|ref|ZP_01132796.1| putative peroxiredoxin/glutaredoxin family protein
           [Pseudoalteromonas tunicata D2]
 gi|88819771|gb|EAR29584.1| putative peroxiredoxin/glutaredoxin family protein
           [Pseudoalteromonas tunicata D2]
          Length = 243

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 105/173 (60%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            IP V F  R         K  QW  + T+++F GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   HIPTVTFPFR---------KDDQWHAITTEEIFKGKNVIVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  GI+ + C+SVND FVMNAW K  E  N+ ++PDG+G FT  MGMLV K ++
Sbjct: 60  ELAPIFKANGIDSIICMSVNDTFVMNAWVKDQEADNIDVIPDGAGLFTEAMGMLVDKSDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD V++  F+E     +   DP+E+S  + +L  I  +++
Sbjct: 120 GFGKRSWRYSMLVKDGVIDKMFIEP----DLPGDPFEVSDADTMLNYINPNQE 168


>gi|15603212|ref|NP_246286.1| hypothetical protein PM1347 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721717|gb|AAK03431.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 241

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 108/169 (63%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +  QW DV + +LF  K V LF+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFHTR---------QGDQWVDVTSAELFDNKTVVLFSLPGAFTPTCSSTHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  + +  G++ + C+SVND FVMNAW    E +NV ++PDG+GEFT  MGMLV K+++
Sbjct: 59  ELACEFKALGVDSIICMSVNDTFVMNAWKADQECENVIVIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+++ +VE  FVE         DP+++S  + ++K ++
Sbjct: 119 GFGKRSWRYSMLVRNGIVEKMFVEP----QEPGDPFKVSDADTMIKYLK 163


>gi|262166655|ref|ZP_06034392.1| peroxiredoxin family protein/glutaredoxin [Vibrio mimicus VM223]
 gi|262026371|gb|EEY45039.1| peroxiredoxin family protein/glutaredoxin [Vibrio mimicus VM223]
          Length = 243

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 105/172 (61%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFPTR---------QGDAWVNVTTDELFKGKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNAENITFIPDGNGEFTDGMGMLVEKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 121 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLKHIAPQYK 168


>gi|119947074|ref|YP_944754.1| glutaredoxin family protein [Psychromonas ingrahamii 37]
 gi|119865678|gb|ABM05155.1| Glutaredoxin-family domain protein [Psychromonas ingrahamii 37]
          Length = 243

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 105/173 (60%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP V F  R         +  QW +V+T +LFAGK V +FALPGAFTPTCS   LP + 
Sbjct: 9   KIPNVTFPTR---------QGDQWVNVSTDELFAGKTVVVFALPGAFTPTCSSMHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++E+ C SVND FVMN+W    E +N+ ++PDG+G F   MGMLV K ++
Sbjct: 60  ELAGVFKENGVDEIICSSVNDTFVMNSWIADQEAENITVVPDGNGTFAEGMGMLVDKSDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD V+E  F+E     N   DP+E+S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----NQPGDPFEVSDADTMLNYINPKAK 168


>gi|325577111|ref|ZP_08147595.1| antioxidant [Haemophilus parainfluenzae ATCC 33392]
 gi|325160693|gb|EGC72814.1| antioxidant [Haemophilus parainfluenzae ATCC 33392]
          Length = 241

 Score =  155 bits (391), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 77/168 (45%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDQWVDVTTSELFDNKTVVVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  E  NVK +PDG+G FT  MGMLV KD++
Sbjct: 59  ELAPVFKQHGVDDILVVSVNDTFVMNAWKEAEEAHNVKFIPDGNGTFTEGMGMLVGKDDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK I
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYI 162


>gi|326577462|gb|EGE27346.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis O35E]
          Length = 249

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 108/173 (62%), Gaps = 13/173 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P  VFH R         +  QW DVNT +LF+GK+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNAVFHTR---------QGDQWVDVNTDELFSGKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++ D+ +  GI+++ C+SVND FVMNAW    E   + L+PDG+GEFT  M  LV 
Sbjct: 57  PRYNELADEFKKLGIDDILCVSVNDTFVMNAWADDQESDKITLIPDGNGEFTEGMNRLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K+++GFG RSWRY  L+ D V+   F +E   D    DP+E+S  + ++K + 
Sbjct: 117 KEDLGFGKRSWRYSMLVDDGVIVKIF-DEPEKDG---DPFEVSDADTMIKFLN 165


>gi|296112945|ref|YP_003626883.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis RH4]
 gi|295920639|gb|ADG60990.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis RH4]
          Length = 249

 Score =  154 bits (390), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 108/173 (62%), Gaps = 13/173 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P  VFH R         +  QW DVNT +LF+GK+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPSTVFHTR---------QGDQWVDVNTDELFSGKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++ D+ +  GI+++ C+SVND FVMNAW    E   + L+PDG+GEFT  M  LV 
Sbjct: 57  PRYNELADEFKKLGIDDILCVSVNDTFVMNAWADDQESDKITLIPDGNGEFTEGMNRLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K+++GFG RSWRY  L+ D V+   F +E   D    DP+E+S  + ++K + 
Sbjct: 117 KEDLGFGKRSWRYSMLVDDGVIVKIF-DEPEKDG---DPFEVSDADTMIKFLN 165


>gi|153830204|ref|ZP_01982871.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae 623-39]
 gi|148874307|gb|EDL72442.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae 623-39]
          Length = 247

 Score =  154 bits (390), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V + +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 14  IPQVTFPTR---------QGDAWVNVTSDELFKGKTVIVFSLPGAFTPTCSSTHLPRYNE 64

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +Y   +  G++ + C+SVND FVMNAW       N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 65  LYPVFKENGVDSILCVSVNDTFVMNAWKDDQNADNITFIPDGNGEFTDGMGMLVDKNDLG 124

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 125 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLKYIAPQYK 172


>gi|261254119|ref|ZP_05946692.1| peroxiredoxin family protein/glutaredoxin [Vibrio orientalis CIP
           102891]
 gi|260937510|gb|EEX93499.1| peroxiredoxin family protein/glutaredoxin [Vibrio orientalis CIP
           102891]
          Length = 242

 Score =  154 bits (390), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQV F +R         +   W +V + DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   NVPQVTFPIR---------QGDAWVNVTSDDLFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ C+SVND FVMNAW    E +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 60  ELFPVFKEHGVDEILCVSVNDTFVMNAWKNDQEAENITFIPDGNGEFTDGMGMLVEKNDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK I
Sbjct: 120 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKHI 163


>gi|238789620|ref|ZP_04633404.1| Hybrid peroxiredoxin hyPrx5 [Yersinia frederiksenii ATCC 33641]
 gi|238722373|gb|EEQ14029.1| Hybrid peroxiredoxin hyPrx5 [Yersinia frederiksenii ATCC 33641]
          Length = 243

 Score =  154 bits (390), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 103/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IPQV FH R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPQVTFHTR---------QGDQWVDVTTDELFNNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT+ M MLV   ++
Sbjct: 60  ELAGVFKQHGVDSILCVSVNDTFVMNAWKADQHAENITFIPDGNGEFTKGMDMLVENADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|326572760|gb|EGE22746.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis BC7]
          Length = 249

 Score =  154 bits (390), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 108/173 (62%), Gaps = 13/173 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P  VFH R         +  QW DVNT +LF+GK+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNAVFHTR---------QGDQWVDVNTDELFSGKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++ D+ +  GI+++ C+SVND FVMNAW    E   + L+PDG+GEFT  M  LV 
Sbjct: 57  PRYNELADEFKKLGIDDILCVSVNDTFVMNAWADDQESDKITLIPDGNGEFTEGMNRLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K+++GFG RSWRY  L+ D V+   F +E   D    DP+E+S  + ++K + 
Sbjct: 117 KEDLGFGKRSWRYSMLVDDGVIVKIF-DEPEKDG---DPFEVSDADTMIKFLN 165


>gi|262170426|ref|ZP_06038104.1| peroxiredoxin family protein/glutaredoxin [Vibrio mimicus MB-451]
 gi|261891502|gb|EEY37488.1| peroxiredoxin family protein/glutaredoxin [Vibrio mimicus MB-451]
          Length = 243

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFPTR---------QGDAWVNVTTDELFKGKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNAENITFIPDGNGEFTDGMGMLVEKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S    +LK I    K
Sbjct: 121 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDANTMLKHIAPQYK 168


>gi|148979176|ref|ZP_01815355.1| glutaredoxin [Vibrionales bacterium SWAT-3]
 gi|145961934|gb|EDK27224.1| glutaredoxin [Vibrionales bacterium SWAT-3]
          Length = 242

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 107/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            IPQV F  R         +   W +V T++LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   SIPQVTFPTR---------QGDAWVNVTTEELFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++++ C+SVND FVMNAW    E +N+  +PDG+G+FT  MGMLV K+++
Sbjct: 60  ELHSVFKENGVDDILCVSVNDTFVMNAWKADQEAENITFIPDGNGDFTDGMGMLVEKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+K+ VVE  F+EE    +   DP+++S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVKNGVVEKMFIEE----DVPGDPFKVSDADTMLNYIAPEHK 168


>gi|312882778|ref|ZP_07742512.1| glutaredoxin [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369562|gb|EFP97080.1| glutaredoxin [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 242

 Score =  154 bits (389), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            IPQV F  R         +   W +V T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   HIPQVTFPTR---------QGDAWVNVTTDELFKDKTVIVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ C+SVND FVMNAW    E  N++ +PDG+GEFT+ MGML  K+++
Sbjct: 60  ELFSVFKEHGVDEIVCVSVNDTFVMNAWKNDQEADNIRFIPDGNGEFTQGMGMLADKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ ++E  F+E     N   DP+++S  + +LK I
Sbjct: 120 GFGQRSWRYSMLVKNGLIEKMFIEP----NEPGDPFKVSDADTMLKYI 163


>gi|153802986|ref|ZP_01957572.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MZO-3]
 gi|229521703|ref|ZP_04411121.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae TM
           11079-80]
 gi|229524616|ref|ZP_04414021.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae bv.
           albensis VL426]
 gi|229527435|ref|ZP_04416827.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae
           12129(1)]
 gi|124121470|gb|EAY40213.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MZO-3]
 gi|229335067|gb|EEO00552.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae
           12129(1)]
 gi|229338197|gb|EEO03214.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae bv.
           albensis VL426]
 gi|229341297|gb|EEO06301.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae TM
           11079-80]
          Length = 247

 Score =  154 bits (389), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 14  IPQVTFPTR---------QGDAWVNVTTDELFKGKTVIVFSLPGAFTPTCSSTHLPRYNE 64

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW       N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 65  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADNITFIPDGNGEFTDGMGMLVDKNDLG 124

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 125 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLKYIAPQYK 172


>gi|327485116|gb|AEA79523.1| Peroxiredoxin family protein/glutaredoxin [Vibrio cholerae
           LMA3894-4]
          Length = 243

 Score =  154 bits (389), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFPTR---------QGDAWVNVTTDELFKGKTVIVFSLPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW       N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADNITFIPDGNGEFTDGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 121 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLKYIAPQYK 168


>gi|32034501|ref|ZP_00134673.1| COG0678: Peroxiredoxin [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
          Length = 244

 Score =  154 bits (389), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 13/172 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNVTFHTR---------QGDAWVDVTTAELFDNKTVIVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  + +  G++++ C+SVND FVMNAW    E +NV ++PDG+GEFT  MGMLV 
Sbjct: 57  PRYNELACEFKAAGVDDILCMSVNDTFVMNAWKAAQESENVTVIPDGNGEFTEGMGMLVG 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           K+++GFG RSWRY  L+K+ VVE  F+E         DP+++S  + ++K +
Sbjct: 117 KEDLGFGKRSWRYSMLVKNGVVEKMFIEP----QEPGDPFKVSDADTMMKYL 164


>gi|126208946|ref|YP_001054171.1| hybrid peroxiredoxin HyPrx5 [Actinobacillus pleuropneumoniae L20]
 gi|126097738|gb|ABN74566.1| hybrid peroxiredoxin HyPrx5 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
          Length = 244

 Score =  154 bits (389), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 13/172 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNVTFHTR---------QGDAWVDVTTAELFDNKTVIVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  + +  G++++ C+SVND FVMNAW    E +NV ++PDG+GEFT  MGMLV 
Sbjct: 57  PRYNELACEFKAAGVDDILCMSVNDTFVMNAWKADQESENVTVIPDGNGEFTEGMGMLVG 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           K+++GFG RSWRY  L+K+ VVE  F+E         DP+++S  + ++K +
Sbjct: 117 KEDLGFGKRSWRYSMLVKNGVVEKMFIEP----QEPGDPFKVSDADTMMKYL 164


>gi|303252490|ref|ZP_07338654.1| hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307246398|ref|ZP_07528474.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307248525|ref|ZP_07530543.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307255383|ref|ZP_07537193.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259833|ref|ZP_07541551.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307261962|ref|ZP_07543620.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|302648691|gb|EFL78883.1| hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306852731|gb|EFM84960.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306855001|gb|EFM87186.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306861692|gb|EFM93676.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866131|gb|EFM98001.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306868373|gb|EFN00192.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 244

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 13/172 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNVTFHTR---------QGDAWVDVTTAELFDNKTVIVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  + +  G++++ C+SVND FVMNAW    E +NV ++PDG+GEFT  MGMLV 
Sbjct: 57  PRYNELACEFKAAGVDDIICMSVNDTFVMNAWKADQESENVTVIPDGNGEFTEGMGMLVG 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           K+++GFG RSWRY  L+K+ VVE  F+E         DP+++S  + ++K +
Sbjct: 117 KEDLGFGKRSWRYSMLVKNGVVEKMFIEP----QEPGDPFKVSDADTMMKYL 164


>gi|165976910|ref|YP_001652503.1| hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190150759|ref|YP_001969284.1| hybrid peroxiredoxin HyPrx5 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|307250756|ref|ZP_07532689.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307257552|ref|ZP_07539315.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307264161|ref|ZP_07545755.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|165877011|gb|ABY70059.1| hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189915890|gb|ACE62142.1| hybrid peroxiredoxin HyPrx5 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|306857224|gb|EFM89347.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306863953|gb|EFM95873.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306870535|gb|EFN02285.1| Hybrid peroxiredoxin hyPrx5 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 244

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 13/172 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNVTFHTR---------QGDAWVDVTTAELFDNKTVIVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  + +  G++++ C+SVND FVMNAW    E +NV ++PDG+GEFT  MGMLV 
Sbjct: 57  PRYNELACEFKAAGVDDIICMSVNDTFVMNAWKADQESENVTVIPDGNGEFTEGMGMLVG 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           K+++GFG RSWRY  L+K+ VVE  F+E         DP+++S  + ++K +
Sbjct: 117 KEDLGFGKRSWRYSMLVKNGVVEKMFIEP----QEPGDPFKVSDADTMMKYL 164


>gi|328472340|gb|EGF43210.1| peroxiredoxin family protein/glutaredoxin [Vibrio parahaemolyticus
           10329]
          Length = 242

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQV F  R         +   W +V + DLF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   NVPQVTFPTR---------QGDTWVNVTSDDLFKGKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ C+SVND FVMNAW    E +++  +PDG+GEFT  +GMLV K+++
Sbjct: 60  ELFPVFKEHGVDEILCISVNDTFVMNAWKHDQEAEHITFIPDGNGEFTDGIGMLVDKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD V+E  F+E     N   DP+++S  + +L  I
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----NEPGDPFKVSDADTMLNYI 163


>gi|94313811|ref|YP_587020.1| thioredoxin reductase [Cupriavidus metallidurans CH34]
 gi|93357663|gb|ABF11751.1| peroxiredoxin/glutaredoxin, Thioredoxin reductase [Cupriavidus
           metallidurans CH34]
          Length = 243

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 106/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R            +WKDV T +LF GK V LF+LPGAFTPTCS   LP + 
Sbjct: 9   RVPNVTFRVRANN---------EWKDVTTAELFDGKTVVLFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++      +G++ + C+SVND FVMN W K  E +N+ ++PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPVFAKQGVDAILCVSVNDTFVMNEWAKDQESENIVMIPDGNGEFTDGMGMLVDKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VV+  F+E         DP+++S  + +L  I  + K
Sbjct: 120 GFGKRSWRYSMLVKDGVVDKMFIEP----EEPGDPFKVSDADTMLNYIAPTAK 168


>gi|170718219|ref|YP_001785242.1| glutaredoxin family protein [Haemophilus somnus 2336]
 gi|168826348|gb|ACA31719.1| glutaredoxin-family domain protein [Haemophilus somnus 2336]
          Length = 240

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 105/169 (62%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  QW DV T DLF  K V LF+LPGAFTPTCS   LP + 
Sbjct: 7   KVPQVTFRTR---------QGDQWVDVTTADLFDNKTVVLFSLPGAFTPTCSATHLPRYN 57

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  + +  G++++ C+SVND FVMNAW    E +NV ++PDG+GEFT  MGMLV K  +
Sbjct: 58  ELACEFKALGVDDIICVSVNDTFVMNAWKADQESENVTVIPDGNGEFTSGMGMLVDKTEL 117

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+K+ VVE  F+E         DP+++S  + ++K + 
Sbjct: 118 GFGKRSWRYSMLVKNGVVEKMFIEP----QEPGDPFKVSDADTMIKYLN 162


>gi|254508170|ref|ZP_05120295.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [Vibrio
           parahaemolyticus 16]
 gi|219548892|gb|EED25892.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [Vibrio
           parahaemolyticus 16]
          Length = 242

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 105/173 (60%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQV F  R         +   W +V T DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   SVPQVTFPTR---------QGDAWVNVTTDDLFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++E+ CLSVND FVMNAW    E +N+  +PDG+G+FT  MGMLV K+++
Sbjct: 60  ELFPVFKEHGVDEILCLSVNDTFVMNAWKADQEAENITFIPDGNGDFTEGMGMLVDKNDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLNYIAPDYK 168


>gi|262190782|ref|ZP_06049008.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae CT
           5369-93]
 gi|262033337|gb|EEY51849.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae CT
           5369-93]
          Length = 243

 Score =  154 bits (388), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V + +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFPTR---------QGDAWVNVTSDELFKGKTVIVFSLPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW       N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADNITFIPDGNGEFTDGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 121 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTILKYIAPQYK 168


>gi|292486635|ref|YP_003529505.1| putative peroxiredoxin/glutaredoxin family protein [Erwinia
           amylovora CFBP1430]
 gi|292897873|ref|YP_003537242.1| hybrid peroxiredoxin hyprx5 (thioredoxin reductase) [Erwinia
           amylovora ATCC 49946]
 gi|291197721|emb|CBJ44816.1| hybrid peroxiredoxin hyprx5 (thioredoxin reductase) [Erwinia
           amylovora ATCC 49946]
 gi|291552052|emb|CBA19089.1| putative peroxiredoxin/glutaredoxin family protein [Erwinia
           amylovora CFBP1430]
 gi|312170700|emb|CBX78963.1| putative peroxiredoxin/glutaredoxin family protein [Erwinia
           amylovora ATCC BAA-2158]
          Length = 243

 Score =  154 bits (388), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 103/167 (61%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFHTR---------QGDSWIDVTTDELFKDKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + D  +  G++ + C+SVND FVMNAW      +++  +PDG+G+FTR M MLV K ++G
Sbjct: 61  LSDVFKQHGVDSILCVSVNDTFVMNAWKADQRAEHITFIPDGNGDFTRGMEMLVEKADLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +L+ +
Sbjct: 121 FGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLRYV 163


>gi|188532297|ref|YP_001906094.1| Putative peroxiredoxin/glutaredoxin family protein [Erwinia
           tasmaniensis Et1/99]
 gi|188027339|emb|CAO95184.1| Putative peroxiredoxin/glutaredoxin family protein [Erwinia
           tasmaniensis Et1/99]
          Length = 243

 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFHTR---------QGDSWIDVTTDELFKDKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + D  +  G++ + C+SVND FVMNAW      +++  +PDG+G+FTR M MLV K ++G
Sbjct: 61  LSDVFKQHGVDSILCVSVNDTFVMNAWKADQRAEHITFIPDGNGDFTRGMEMLVEKADLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +L+ +    K
Sbjct: 121 FGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLRYVAPEYK 168


>gi|113460184|ref|YP_718241.1| peroxiredoxin [Haemophilus somnus 129PT]
 gi|112822227|gb|ABI24316.1| peroxiredoxin [Haemophilus somnus 129PT]
          Length = 238

 Score =  153 bits (387), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 105/169 (62%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  QW DV T DLF  K V LF+LPGAFTPTCS   LP + 
Sbjct: 5   KVPQVTFRTR---------QGDQWVDVTTADLFDNKTVVLFSLPGAFTPTCSATHLPRYN 55

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  + +  G++++ C+SVND FVMNAW    E +NV ++PDG+GEFT  MGMLV K  +
Sbjct: 56  ELACEFKALGVDDIICVSVNDTFVMNAWKADQESENVTVIPDGNGEFTSGMGMLVDKTEL 115

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+K+ VVE  F+E         DP+++S  + ++K + 
Sbjct: 116 GFGKRSWRYSMLVKNGVVEKMFIEP----QEPGDPFKVSDADTMIKYLN 160


>gi|258625700|ref|ZP_05720579.1| peroxiredoxin family protein/glutaredoxin [Vibrio mimicus VM603]
 gi|258581938|gb|EEW06808.1| peroxiredoxin family protein/glutaredoxin [Vibrio mimicus VM603]
          Length = 243

 Score =  153 bits (387), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IP V F  R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPHVTFPTR---------QGDAWVNVTTDELFKGKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDSILCISVNDTFVMNAWKDDQNAENITFIPDGNGEFTDGMGMLVEKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 121 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLKHIAPQYK 168


>gi|271502440|ref|YP_003335466.1| glutaredoxin-family domain-containing protein [Dickeya dadantii
           Ech586]
 gi|270345995|gb|ACZ78760.1| glutaredoxin-family domain protein [Dickeya dadantii Ech586]
          Length = 243

 Score =  153 bits (387), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 103/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP V FH R         +  QW DV +++LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPSVTFHTR---------QGDQWVDVTSEELFNNKTVVVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++ +  +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFTR M MLV K  +
Sbjct: 60  ELAEVFKQFGVDAILCVSVNDTFVMNAWKADQNAENITFIPDGNGEFTRAMNMLVEKAEL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L++  VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRHGVVEKMFVE----PNKPGDPFEVSDADTMLKYL 163


>gi|326567643|gb|EGE17751.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis 12P80B1]
          Length = 249

 Score =  153 bits (387), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 108/173 (62%), Gaps = 13/173 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P  VFH R         +  QW DVNT +LF+GK+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNAVFHTR---------QGDQWVDVNTDELFSGKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++ D+ +  GI+++ C+SVND FVMNAW    E   + L+PDG+GEFT  M  LV 
Sbjct: 57  PRYNELADEFKKLGIDDILCVSVNDTFVMNAWADDQESDKITLIPDGNGEFTEGMNRLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K+++GFG RSWRY  L+ D ++   F +E   D    DP+E+S  + ++K + 
Sbjct: 117 KEDLGFGKRSWRYSMLVDDGMIVKIF-DEPEKDG---DPFEVSDADTMIKFLN 165


>gi|59712907|ref|YP_205683.1| glutaredoxin [Vibrio fischeri ES114]
 gi|197334763|ref|YP_002157095.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [Vibrio
           fischeri MJ11]
 gi|59481008|gb|AAW86795.1| glutaredoxin [Vibrio fischeri ES114]
 gi|197316253|gb|ACH65700.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [Vibrio
           fischeri MJ11]
          Length = 242

 Score =  153 bits (387), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 107/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQV F  R         +   W +V T++LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   SVPQVTFPTR---------QGDAWVNVTTEELFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++++ C+SVND FVMNAW    E +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 60  ELHSVFKENGVDDILCVSVNDTFVMNAWKADQEAENITFIPDGNGEFTDGMGMLVEKNDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+K+ VVE  F+EE    +   DP+++S  + +L  +    K
Sbjct: 120 GFGKRSWRYSMLVKNGVVEKMFIEE----DVPGDPFKVSDADTMLNYLAPEHK 168


>gi|326567942|gb|EGE18039.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis BC1]
 gi|326569477|gb|EGE19537.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis BC8]
          Length = 249

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 108/173 (62%), Gaps = 13/173 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P  VFH R         +  QW DVNT +LF+GK+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNAVFHTR---------QGDQWVDVNTDELFSGKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++ D+ +  GI+++ C+SVND FVMNAW    E   + L+PDG+GEFT  M  LV 
Sbjct: 57  PRYNELADEFKKLGIDDILCVSVNDTFVMNAWADDQESDKITLIPDGNGEFTEGMNRLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K+++GFG RSWRY  L+ D ++   F +E   D    DP+E+S  + ++K + 
Sbjct: 117 KEDLGFGKRSWRYSMLVDDGMIVKIF-DEPEKDG---DPFEVSDADTMIKFLN 165


>gi|326562853|gb|EGE13141.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis 103P14B1]
 gi|326574020|gb|EGE23969.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis CO72]
 gi|326577012|gb|EGE26907.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis 101P30B1]
          Length = 249

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 108/173 (62%), Gaps = 13/173 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P  VFH R         +  QW DVNT +LF+GK+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNAVFHTR---------QGDQWVDVNTDELFSGKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++ D+ +  GI+++ C+SVND FVMNAW    E   + L+PDG+GEFT  M  LV 
Sbjct: 57  PRYNELADEFKKLGIDDILCVSVNDTFVMNAWADDQESDKITLIPDGNGEFTEGMNRLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K+++GFG RSWRY  L+ D ++   F +E   D    DP+E+S  + ++K + 
Sbjct: 117 KEDLGFGKRSWRYSMLVDDGMIVKIF-DEPEKDG---DPFEVSDADTMIKFLN 165


>gi|163856851|ref|YP_001631149.1| putative glutaredoxin [Bordetella petrii DSM 12804]
 gi|163260579|emb|CAP42881.1| putative glutaredoxin [Bordetella petrii]
          Length = 241

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 103/173 (59%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R         +  +WK V+T DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPNVTFPIR---------QDNEWKQVSTDDLFKNKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++ V C+SVND FVMN W K  E  N+ LLPDG+G+FT  MGMLV K ++
Sbjct: 60  ELASTFASVGVDAVVCVSVNDTFVMNEWAKDQEAGNITLLPDGNGDFTEGMGMLVDKRDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD V+E  F+E         DP+E+S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVKDGVIEKMFIEP----QKEGDPFEVSDADTMLAYIAPQAK 168


>gi|258620487|ref|ZP_05715525.1| peroxiredoxin family protein/glutaredoxin [Vibrio mimicus VM573]
 gi|258587366|gb|EEW12077.1| peroxiredoxin family protein/glutaredoxin [Vibrio mimicus VM573]
          Length = 243

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IP V F  R         +   W +V T +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPHVTFPTR---------QGDAWVNVTTDELFKGKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW      +N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNAENITFIPDGNGEFTDGMGMLVEKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 121 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLKHIAPQYK 168


>gi|33151875|ref|NP_873228.1| putative peroxiredoxin/glutaredoxin family protein [Haemophilus
           ducreyi 35000HP]
 gi|33148096|gb|AAP95617.1| putative peroxiredoxin/glutaredoxin family protein [Haemophilus
           ducreyi 35000HP]
          Length = 244

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/172 (43%), Positives = 106/172 (61%), Gaps = 13/172 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNVTFHTR---------QGDAWVDVTTSELFDNKTVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  + +  G++ + C+SVND FVMNAW    E +NV ++PDG+GEFT  MGMLV 
Sbjct: 57  PRYNELACEFKAAGVDSILCVSVNDTFVMNAWKADQESENVMVIPDGNGEFTEGMGMLVG 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           K+++GFG RSWRY  L+K+ VVE  FVE         DP+++S  + ++K +
Sbjct: 117 KEDLGFGNRSWRYSMLVKNGVVEKMFVEP----QEPGDPFKVSDADTMMKYL 164


>gi|121998468|ref|YP_001003255.1| glutaredoxin family protein [Halorhodospira halophila SL1]
 gi|121589873|gb|ABM62453.1| Glutaredoxin-family domain protein [Halorhodospira halophila SL1]
          Length = 248

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/167 (45%), Positives = 104/167 (62%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P+V F  RV           QW+DV T +LF GK V +FALPGAFTPTCS   LP + +
Sbjct: 10  VPRVTFRTRVNG---------QWQDVTTDELFKGKTVVVFALPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++++ CLSVNDAFVM  W +    +NV  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LAPVFWDNGVDDIVCLSVNDAFVMEEWRRDQHAENVTFIPDGNGEFTEGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  +++D V+E  FVE         DP+E+S  + +L+ I
Sbjct: 121 FGKRSWRYAMVVRDGVIEQMFVEP----EKPGDPFEVSDADTMLRHI 163


>gi|15642632|ref|NP_232265.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121587911|ref|ZP_01677666.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae 2740-80]
 gi|121727592|ref|ZP_01680700.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae V52]
 gi|147675129|ref|YP_001218130.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae O395]
 gi|153213977|ref|ZP_01949170.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae 1587]
 gi|153819461|ref|ZP_01972128.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae NCTC
           8457]
 gi|153821573|ref|ZP_01974240.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae B33]
 gi|153825079|ref|ZP_01977746.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MZO-2]
 gi|227082753|ref|YP_002811304.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae M66-2]
 gi|229507311|ref|ZP_04396816.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae BX
           330286]
 gi|229509765|ref|ZP_04399246.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae B33]
 gi|229516890|ref|ZP_04406336.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae RC9]
 gi|229606817|ref|YP_002877465.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MJ-1236]
 gi|254225383|ref|ZP_04918994.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae V51]
 gi|254285832|ref|ZP_04960794.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae
           AM-19226]
 gi|254851176|ref|ZP_05240526.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MO10]
 gi|297581477|ref|ZP_06943400.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae RC385]
 gi|298500540|ref|ZP_07010344.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MAK 757]
 gi|9657228|gb|AAF95778.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121547816|gb|EAX57902.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae 2740-80]
 gi|121630083|gb|EAX62488.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae V52]
 gi|124115547|gb|EAY34367.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae 1587]
 gi|125622017|gb|EAZ50340.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae V51]
 gi|126510002|gb|EAZ72596.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae NCTC
           8457]
 gi|126520958|gb|EAZ78181.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae B33]
 gi|146317012|gb|ABQ21551.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae O395]
 gi|149741225|gb|EDM55267.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MZO-2]
 gi|150424014|gb|EDN15953.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae
           AM-19226]
 gi|227010641|gb|ACP06853.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae M66-2]
 gi|227014525|gb|ACP10735.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae O395]
 gi|229345953|gb|EEO10925.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae RC9]
 gi|229353239|gb|EEO18178.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae B33]
 gi|229354816|gb|EEO19737.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae BX
           330286]
 gi|229369472|gb|ACQ59895.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MJ-1236]
 gi|254846881|gb|EET25295.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MO10]
 gi|297534315|gb|EFH73153.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae RC385]
 gi|297540709|gb|EFH76766.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae MAK 757]
          Length = 247

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V + +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 14  IPQVTFPTR---------QGDAWVNVTSDELFKGKTVIVFSLPGAFTPTCSSTHLPRYNE 64

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW       N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 65  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADNITFIPDGNGEFTDGMGMLVDKNDLG 124

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 125 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLKYIAPQYK 172


>gi|229513560|ref|ZP_04403024.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae TMA 21]
 gi|229349437|gb|EEO14393.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae TMA 21]
          Length = 247

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V + +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 14  IPQVTFPTR---------QGDAWVNVTSDELFKGKTVIVFSLPGAFTPTCSSTHLPRYNE 64

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW       N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 65  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADNITFIPDGNGEFTDGMGMLVDKNDLG 124

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 125 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLKYIAPQYK 172


>gi|255744397|ref|ZP_05418349.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholera CIRS 101]
 gi|262158493|ref|ZP_06029608.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae INDRE
           91/1]
 gi|262170114|ref|ZP_06037803.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae RC27]
 gi|255737922|gb|EET93315.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholera CIRS 101]
 gi|262021522|gb|EEY40234.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae RC27]
 gi|262029654|gb|EEY48303.1| peroxiredoxin family protein/glutaredoxin [Vibrio cholerae INDRE
           91/1]
          Length = 243

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V + +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFPTR---------QGDAWVNVTSDELFKGKTVIVFSLPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW       N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADNITFIPDGNGEFTDGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+KD VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 121 FGKRSWRYSMLVKDGVVEKMFIEP----NEPGDPFKVSDADTMLKYIAPQYK 168


>gi|269961459|ref|ZP_06175823.1| peroxiredoxin family protein/glutaredoxin [Vibrio harveyi 1DA3]
 gi|269833836|gb|EEZ87931.1| peroxiredoxin family protein/glutaredoxin [Vibrio harveyi 1DA3]
          Length = 242

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 105/167 (62%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F  R         K   W +V T++LF  + V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFPTR---------KGDAWVNVTTEELFKDRTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++E+ C+SVND FVMNAW    E +N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFSVFKEHGVDEILCVSVNDTFVMNAWKADQEAENITFIPDGNGEFTDGMGMLVDKNDIG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L+K+ VVE  F+E     N   DP+++S  + ++  +
Sbjct: 121 FGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMMNYV 163


>gi|322834982|ref|YP_004215009.1| glutaredoxin-family domain protein [Rahnella sp. Y9602]
 gi|321170183|gb|ADW75882.1| glutaredoxin-family domain protein [Rahnella sp. Y9602]
          Length = 253

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 103/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +P V FH R         +  QW D++++ LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   HVPHVTFHTR---------QGDQWVDLSSEQLFKNKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ + C+SVND FVMNAW  +    N+  +PDG+GEFT+ M MLV K ++
Sbjct: 60  ELAPVFKNHGVDSILCVSVNDTFVMNAWKAEQNASNITFIPDGNGEFTKGMDMLVEKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|310766057|gb|ADP11007.1| peroxiredoxin/glutaredoxin family protein [Erwinia sp. Ejp617]
          Length = 265

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 103/167 (61%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IP V+FH R         +   W DV T +LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 32  IPPVIFHTR---------QGDSWIDVTTDELFKDKTVIVFSLPGAFTPTCSSSHLPRYNE 82

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + D  +  G++ + C+SVND FVMNAW      +++  +PDG+G+FTR M MLV K ++G
Sbjct: 83  LSDVFKQHGVDSILCVSVNDTFVMNAWKADQRAEHITFIPDGNGDFTRGMEMLVEKADLG 142

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L+++ VVE  FVE     N   DP+E+S  + +L+ +
Sbjct: 143 FGPRSWRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLRYV 185


>gi|86147320|ref|ZP_01065634.1| glutaredoxin [Vibrio sp. MED222]
 gi|218710797|ref|YP_002418418.1| peroxiredoxin family protein/glutaredoxin [Vibrio splendidus LGP32]
 gi|85834885|gb|EAQ53029.1| glutaredoxin [Vibrio sp. MED222]
 gi|218323816|emb|CAV20173.1| peroxiredoxin family protein/glutaredoxin [Vibrio splendidus LGP32]
          Length = 242

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 106/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            IPQV F  R         +   W +V T++LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   SIPQVTFPTR---------QGDAWVNVTTEELFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++++ C+SVND FVMNAW    E + +  +PDG+G+FT  MGMLV K+++
Sbjct: 60  ELHSVFKDNGVDDILCVSVNDTFVMNAWKADQEAEKITFIPDGNGDFTDGMGMLVEKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+K+ VVE  F+EE    +   DP+++S  + +L  I    K
Sbjct: 120 GFGKRSWRYSMLVKNGVVEKMFIEE----DVPGDPFKVSDADTMLNYIAPEHK 168


>gi|317403061|gb|EFV83596.1| glutaredoxin [Achromobacter xylosoxidans C54]
          Length = 242

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 79/176 (44%), Positives = 102/176 (57%), Gaps = 19/176 (10%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R             WK V T DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPNVTFPVREGNT---------WKKVTTDDLFKNKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++ + C+SVND FVMN W K  E  N+ LLPDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPAFFAAGVDSIVCVSVNDTFVMNEWAKDQESANITLLPDGNGEFTEGMGMLVDKSDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVE---EGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VV+  F+E   EG       DP+E+S  + +L     S K
Sbjct: 120 GFGKRSWRYSMLVKDGVVQKMFIEPEKEG-------DPFEVSDADTMLAHFAPSAK 168


>gi|323498113|ref|ZP_08103117.1| peroxiredoxin family protein/glutaredoxin [Vibrio sinaloensis DSM
           21326]
 gi|323316824|gb|EGA69831.1| peroxiredoxin family protein/glutaredoxin [Vibrio sinaloensis DSM
           21326]
          Length = 242

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F  R         +   W +V + +LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFPTR---------QGDAWVNVTSDELFKNKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++E+ C+SVND FVMNAW    E +N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFQEHGVDEILCVSVNDTFVMNAWKHDQEAENITFIPDGNGEFTDGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +  + K
Sbjct: 121 FGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKHVAPNYK 168


>gi|307128958|ref|YP_003880974.1| Peroxiredoxin family protein/glutaredoxin [Dickeya dadantii 3937]
 gi|306526487|gb|ADM96417.1| Peroxiredoxin family protein/glutaredoxin [Dickeya dadantii 3937]
          Length = 243

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 101/168 (60%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP V FH R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   KIPSVTFHTR---------QGDQWVDVTTAELFNNKTVVVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++ V C+SVND FVMNAW    + +N+  +PDG+GEFTR M MLV K  +
Sbjct: 60  ELAAVFKQFGVDAVLCVSVNDTFVMNAWKADQDAENITFIPDGNGEFTRAMNMLVEKAEL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L++  VV   FVE     N   DP+E+S  + +LK +
Sbjct: 120 GFGPRSWRYSMLVRHGVVAKMFVEP----NKPGDPFEVSDADTMLKYL 163


>gi|153835120|ref|ZP_01987787.1| AhpC/TSA family/glutaredoxin domain protein [Vibrio harveyi HY01]
 gi|148868427|gb|EDL67538.1| AhpC/TSA family/glutaredoxin domain protein [Vibrio harveyi HY01]
          Length = 242

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F  R         K   W +V T +LF  + V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFPTR---------KGDAWVNVTTDELFKDRTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++E+ C+SVND FVMNAW    E +N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFSVFKEHGVDEILCVSVNDTFVMNAWKADQEAENITFIPDGNGEFTDGMGMLVDKNDIG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  F+E     N   DP+++S  + ++  +    K
Sbjct: 121 FGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMMNYVAPEYK 168


>gi|224824144|ref|ZP_03697252.1| glutaredoxin-family domain protein [Lutiella nitroferrum 2002]
 gi|224603563|gb|EEG09738.1| glutaredoxin-family domain protein [Lutiella nitroferrum 2002]
          Length = 243

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 104/173 (60%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V FH+R         +  +WKDV T+ LF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPNVTFHIR---------ENNEWKDVTTEQLFQGKNVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       GI+ + C+SVND FVMN W +  E +N+ ++PDG+GEFT  M MLV K  +
Sbjct: 60  ELAPAFFENGIDAILCVSVNDTFVMNEWAQDQEAQNIVMVPDGNGEFTAGMNMLVDKSEL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L++D VVE  FVE         DP+++S  + +L  +    K
Sbjct: 120 GFGKRSWRYSMLVRDGVVEKVFVEP----QEPGDPFKVSDADTMLDYLNPKAK 168


>gi|332305390|ref|YP_004433241.1| glutaredoxin-family domain protein [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172719|gb|AEE21973.1| glutaredoxin-family domain protein [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 247

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 107/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +RV           +W+   + ++FAGK V +F+LPGAFTPTCS   LP + 
Sbjct: 13  RVPNVTFPIRVND---------EWEKRTSDEIFAGKTVVVFSLPGAFTPTCSSTHLPRYN 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++E+ C+SVND FVMNAW +  E +N+ LLPDG+ EFT  MG+LV K ++
Sbjct: 64  ELAKVFKANGVDEIVCVSVNDTFVMNAWAQDQEAQNISLLPDGNCEFTDGMGLLVDKADL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VV+  F+E     +   DP+E+S  + +L+ +
Sbjct: 124 GFGKRSWRYSMLVKDGVVDKMFIEP----DLPGDPFEVSDADTMLEYV 167


>gi|109899643|ref|YP_662898.1| glutaredoxin family protein [Pseudoalteromonas atlantica T6c]
 gi|109701924|gb|ABG41844.1| Glutaredoxin-family domain protein [Pseudoalteromonas atlantica
           T6c]
          Length = 247

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 107/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +RV           +W+   T ++F+GK V +F+LPGAFTPTCS   LP + 
Sbjct: 13  RVPNVTFPVRVND---------EWEKRTTDEIFSGKTVVVFSLPGAFTPTCSSTHLPRYN 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++E+ C+SVND FVMNAW +  E +N+ LLPDG+ EFT  MG+LV K ++
Sbjct: 64  ELAKVFKANGVDEIVCVSVNDTFVMNAWAQDQEAQNISLLPDGNCEFTDGMGLLVDKADL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VV+  F+E     +   DP+E+S  + +L+ I
Sbjct: 124 GFGKRSWRYSMLVKDGVVDKMFIEP----DLPGDPFEVSDADTMLEYI 167


>gi|326561580|gb|EGE11921.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis 46P47B1]
          Length = 249

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 108/173 (62%), Gaps = 13/173 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P  VFH R         +  QW DV+T +LF+GK+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPSTVFHTR---------QGDQWVDVSTDELFSGKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++ D+ +  GI+++ C+SVND FVMNAW    E   + L+PDG+GEFT  M  LV 
Sbjct: 57  PRYNELADEFKKLGIDDILCVSVNDTFVMNAWADDQESDKITLIPDGNGEFTEGMNRLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K+++GFG RSWRY  L+ D ++   F +E   D    DP+E+S  + ++K + 
Sbjct: 117 KEDLGFGKRSWRYSMLVDDGMIVKIF-DEPEKDG---DPFEVSDADTMIKFLN 165


>gi|52424210|ref|YP_087347.1| AHP1 protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306262|gb|AAU36762.1| AHP1 protein [Mannheimia succiniciproducens MBEL55E]
          Length = 243

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 106/169 (62%), Gaps = 13/169 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH R         +   W DV +  LF  K V +F+LPGA+TPTCS   LP + 
Sbjct: 8   KVPQVTFHTR---------QGDAWVDVTSAQLFDNKTVVVFSLPGAYTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++  + +  G+++V C+SVND FVMNAW    +  N+ +LPDG+GEFT  MGMLV K+ +
Sbjct: 59  ELTPEFKKLGVDDVICVSVNDTFVMNAWKCDEDADNITVLPDGNGEFTEGMGMLVDKEEL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           GFG RSWRY  L+K+ V+E  F+E     N   DP+++S  + ++K I+
Sbjct: 119 GFGKRSWRYSMLVKNGVIEKMFIEP----NEPGDPFKVSDADTMIKFIK 163


>gi|163803096|ref|ZP_02196980.1| bifunctional argininosuccinate lyase/N-acetylglutamate synthase
           [Vibrio sp. AND4]
 gi|159173088|gb|EDP57920.1| bifunctional argininosuccinate lyase/N-acetylglutamate synthase
           [Vibrio sp. AND4]
          Length = 242

 Score =  151 bits (381), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F  R         +   W +V T +LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFPTR---------EGDAWVNVTTDELFKDKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++E+ C+SVND FVMNAW    E +N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFSVFKEHGVDEIVCVSVNDTFVMNAWKADQEAENITFIPDGNGEFTDGMGMLVDKNDIG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  F+E     N   DP+++S  + ++  +    K
Sbjct: 121 FGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMMNYVAPEYK 168


>gi|332142442|ref|YP_004428180.1| putative peroxiredoxin/glutaredoxin family protein [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327552464|gb|AEA99182.1| putative peroxiredoxin/glutaredoxin family protein [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 246

 Score =  151 bits (381), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 101/168 (60%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP V F  R         +   W    T+ LF+GK V +F+LPGAFTPTCS   LP + 
Sbjct: 13  KIPSVSFQCR---------EGDAWVTKTTEALFSGKNVVVFSLPGAFTPTCSSTHLPRYN 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            +       GI+++ C+SVND FVMNAW    E  N+ ++PDG+GEFT  MGMLV K ++
Sbjct: 64  ALAKKFAKHGIDDIVCMSVNDTFVMNAWAADQEADNITVIPDGNGEFTDGMGMLVDKADL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VV+  F+E     + A DP+E+S  + +L  I
Sbjct: 124 GFGKRSWRYSMLVKDGVVDKMFIEP----DVAGDPFEVSDADTMLAYI 167


>gi|239993282|ref|ZP_04713806.1| putative peroxiredoxin/glutaredoxin family protein [Alteromonas
           macleodii ATCC 27126]
          Length = 246

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 75/168 (44%), Positives = 101/168 (60%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F  R         +   W    T +LF+GK V +F+LPGAFTPTCS   LP + 
Sbjct: 13  KVPSVSFPCR---------EGETWVTKTTDELFSGKNVVVFSLPGAFTPTCSSTHLPRYN 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            +       GI+E+ C+SVND FVMNAW    E  N+ ++PDG+GEFT  MGMLV K ++
Sbjct: 64  ALAKKFAKHGIDEIVCVSVNDTFVMNAWAADQEAANITVIPDGNGEFTDGMGMLVDKADL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VV+  F+E     + A DP+E+S  + +L  I
Sbjct: 124 GFGKRSWRYSMLVKDGVVDKMFIEP----DVAGDPFEVSDADTMLAYI 167


>gi|84390826|ref|ZP_00991518.1| glutaredoxin [Vibrio splendidus 12B01]
 gi|84376629|gb|EAP93506.1| glutaredoxin [Vibrio splendidus 12B01]
          Length = 242

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 106/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            IPQV F  R         +   W +V T++LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   SIPQVTFPTR---------QGDAWVNVTTEELFKDKTVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           +++   +  G++++ C+SVND FVMNAW    E + +  +PDG+G+FT  MGMLV K+++
Sbjct: 60  ELHSVFKENGVDDILCVSVNDTFVMNAWKADQEAEKITFIPDGNGDFTDGMGMLVEKNDI 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+K+ VVE  F+EE    +   DP+++S  + +L  +    K
Sbjct: 120 GFGKRSWRYSMLVKNGVVEKMFIEE----DVPGDPFKVSDADTMLNYLAPEHK 168


>gi|254674305|emb|CBA10089.1| putative peroxiredoxin/glutaredoxin family protein [Neisseria
           meningitidis alpha275]
          Length = 219

 Score =  150 bits (380), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 68/142 (47%), Positives = 98/142 (69%), Gaps = 4/142 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++T DLF GK+V +F+LPGAFTPTCS   LP + +++   +  G++ +YC+SVND FVMN
Sbjct: 1   MSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYNELFGAFKENGVDAIYCVSVNDTFVMN 60

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           AW  + E  N+ ++PDG+GEFT  MGMLV K+++GFG RSWRY  L+ D VVE  F+E  
Sbjct: 61  AWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVNDGVVEKMFIEP- 119

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                  DP+++S  + +LK +
Sbjct: 120 ---EEPGDPFKVSDADTMLKFV 138


>gi|71278241|ref|YP_271004.1| peroxiredoxin/glutaredoxin family protein [Colwellia
           psychrerythraea 34H]
 gi|71143981|gb|AAZ24454.1| peroxiredoxin/glutaredoxin family protein [Colwellia
           psychrerythraea 34H]
          Length = 242

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 95/146 (65%), Gaps = 4/146 (2%)

Query: 28  WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAF 87
           W   N++++FA K V +F+LPGAFTPTCS   LP + ++       G++E+ C+SVND F
Sbjct: 23  WSTRNSEEIFANKTVVVFSLPGAFTPTCSSSHLPRYNELATKFSANGVDEIICISVNDTF 82

Query: 88  VMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           VMNAW K  +  N+  +PDG+GEFT+ MG+LV K  +GFG RSWRY  L+K+ V+E  F+
Sbjct: 83  VMNAWAKDQDADNISFIPDGNGEFTQGMGLLVDKAAIGFGKRSWRYAMLVKNGVIEKMFI 142

Query: 148 EEGFSDNCATDPYEISSPENVLKVIR 173
           E     +   DP+E+S  + +L  I 
Sbjct: 143 EP----DLPGDPFEVSDADTMLNFIN 164


>gi|116695042|ref|YP_840618.1| peroxiredoxin [Ralstonia eutropha H16]
 gi|113529541|emb|CAJ95888.1| Peroxiredoxin [Ralstonia eutropha H16]
          Length = 243

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 104/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F MR         +  +WK V T +LF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPNVAFRMR---------EDNEWKTVTTGELFNGKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++++ C+SVND FVMN W K  E +N+ ++PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPVFAKHGVDDILCVSVNDTFVMNEWAKDQESENITMIPDGNGEFTEGMGMLVDKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VV+  F+E         DP+++S  + +L  I
Sbjct: 120 GFGKRSWRYSMLVKDGVVQKMFIEP----QEPGDPFKVSDADTMLAHI 163


>gi|257465568|ref|ZP_05629939.1| putative peroxiredoxin/glutaredoxin family protein [Actinobacillus
           minor 202]
 gi|257451228|gb|EEV25271.1| putative peroxiredoxin/glutaredoxin family protein [Actinobacillus
           minor 202]
          Length = 245

 Score =  150 bits (379), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 107/175 (61%), Gaps = 13/175 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V FH R         +   W D+ T +LF  K+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPSVTFHTR---------QGDAWVDITTDELFNNKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  +    G++E+ C+SVND FVMNAW    E +NV ++PDG+G+FTR MGMLV 
Sbjct: 57  PRYNELAKEFYALGVDEIVCVSVNDTFVMNAWKADQESENVTVIPDGNGDFTRGMGMLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           K+++GFG RSWRY   + + VVE  F+E         DP+++S  + ++K +  +
Sbjct: 117 KNDLGFGDRSWRYSMYVVNGVVEKMFIEP----QEPGDPFKVSDADTMIKYLNPA 167


>gi|240948230|ref|ZP_04752616.1| putative peroxiredoxin/glutaredoxin family protein [Actinobacillus
           minor NM305]
 gi|240297269|gb|EER47810.1| putative peroxiredoxin/glutaredoxin family protein [Actinobacillus
           minor NM305]
          Length = 245

 Score =  150 bits (379), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 71/175 (40%), Positives = 106/175 (60%), Gaps = 13/175 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V FH R         +   W DV T +LF  K+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPSVTFHTR---------QGDAWIDVTTDELFNNKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  +    G++E+ C+SVND FVMNAW    E +NV ++PDG+G+FTR MGMLV 
Sbjct: 57  PRYNELAKEFYALGVDEIVCVSVNDTFVMNAWKADQESENVTVIPDGNGDFTRGMGMLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
           K+++GFG RSWRY   + +  +E  F+E         DP+++S  + ++K +  +
Sbjct: 117 KNDLGFGDRSWRYSMFVNNGTIEKMFIEP----QEPGDPFKVSDADTMIKYLNPA 167


>gi|326561169|gb|EGE11534.1| hybrid peroxiredoxin HyPrx5 [Moraxella catarrhalis 7169]
          Length = 249

 Score =  150 bits (379), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 107/173 (61%), Gaps = 13/173 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P  VFH R         +  QW DV+T +LF GK+V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPSTVFHTR---------QGDQWVDVSTDELFNGKKVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++ D+ +  GI+++ C+SVND FVMNAW    E   + L+PDG+GEFT  M  LV 
Sbjct: 57  PRYNELADEFKKLGIDDILCVSVNDTFVMNAWADDQESDKITLIPDGNGEFTEGMNRLVS 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K+++GFG RSWRY  L+ D ++   F +E   D    DP+E+S  + ++K + 
Sbjct: 117 KEDLGFGKRSWRYSMLVDDGMIVKIF-DEPEKDG---DPFEVSDADTMIKFLN 165


>gi|33601987|ref|NP_889547.1| putative glutaredoxin [Bordetella bronchiseptica RB50]
 gi|33576425|emb|CAE33503.1| putative glutaredoxin [Bordetella bronchiseptica RB50]
          Length = 242

 Score =  150 bits (379), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 101/171 (59%), Gaps = 19/171 (11%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R             WK V T D+F  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPSVTFPVRENNA---------WKQVTTDDVFKNKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++ + C+SVND FVMN W K  E  NV LLPDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPAFFAAGVDSIVCVSVNDTFVMNEWAKDQESANVTLLPDGNGEFTDGMGMLVDKKDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVE---EGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VVE  F+E   EG       DP+E+S  + +L  +
Sbjct: 120 GFGKRSWRYAMLVKDGVVEKMFIEPEKEG-------DPFEVSDADTMLAYV 163


>gi|33597584|ref|NP_885227.1| putative glutaredoxin [Bordetella parapertussis 12822]
 gi|33574012|emb|CAE38335.1| putative glutaredoxin [Bordetella parapertussis]
          Length = 242

 Score =  150 bits (379), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 78/171 (45%), Positives = 102/171 (59%), Gaps = 19/171 (11%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R         +   WK V T D+F  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPSVTFPVR---------ENNAWKQVTTDDVFKNKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++ + C+SVND FVMN W K  E  NV LLPDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPAFFAAGVDSIVCVSVNDTFVMNEWAKDQESANVTLLPDGNGEFTDGMGMLVDKKDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVE---EGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VVE  F+E   EG       DP+E+S  + +L  +
Sbjct: 120 GFGKRSWRYAMLVKDGVVEKMFIEPEKEG-------DPFEVSDADTMLAYV 163


>gi|226940415|ref|YP_002795489.1| peroxiredoxin/glutaredoxin family protein [Laribacter hongkongensis
           HLHK9]
 gi|226715342|gb|ACO74480.1| Probable peroxiredoxin/glutaredoxin family protein [Laribacter
           hongkongensis HLHK9]
          Length = 245

 Score =  150 bits (379), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 105/173 (60%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R         +   WK V + +LFAGK V +F+LPGAFTPTCS   LP + 
Sbjct: 11  RVPSVQFRVR---------ENNDWKTVTSDELFAGKTVVVFSLPGAFTPTCSSTHLPRYN 61

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    R  G++ + C+SVND FVMN W K  E  N+ ++PDG+GEFT  MGMLV K ++
Sbjct: 62  ELAAVFRENGVDNILCVSVNDTFVMNEWAKDQESANIVMVPDGNGEFTEGMGMLVDKADL 121

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VV+  F+E         DP+++S  + +L  I  + K
Sbjct: 122 GFGKRSWRYSMLVKDGVVQKMFIEP----QEPGDPFKVSDADTMLAYINPNAK 170


>gi|257456006|ref|ZP_05621215.1| hybrid peroxiredoxin hyPrx5 [Enhydrobacter aerosaccus SK60]
 gi|257446595|gb|EEV21629.1| hybrid peroxiredoxin hyPrx5 [Enhydrobacter aerosaccus SK60]
          Length = 248

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 11/172 (6%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MI  Q+P V FH +         +  +W DV+T +LF GK+V LFALPGAFTPTCS   L
Sbjct: 6   MIGKQVPSVTFHTQ---------QQGKWVDVSTDELFKGKKVVLFALPGAFTPTCSSLHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  +    G++++ C+SVND FVMNAW K  +  NV ++PDG+GEF   MG L+ 
Sbjct: 57  PRYNELATEFAKLGVDDIVCVSVNDTFVMNAWAKDQDCSNVTVIPDGNGEFAEAMGRLID 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
              +GFG RSWRY  L+ D  +   F E    ++ + DP+E+S  + ++K I
Sbjct: 117 DSAIGFGKRSWRYSMLVDDGKIVKIFDEP--QNSGSDDPFEVSDADTMIKYI 166


>gi|156972416|ref|YP_001443323.1| glutaredoxin [Vibrio harveyi ATCC BAA-1116]
 gi|156524010|gb|ABU69096.1| hypothetical protein VIBHAR_00036 [Vibrio harveyi ATCC BAA-1116]
          Length = 242

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 104/172 (60%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F  R         K   W +V T +LF  + V +F+LPGAFTPTCS    P + +
Sbjct: 10  VPQVTFPTR---------KGDAWVNVTTDELFKDRTVIVFSLPGAFTPTCSSSHQPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++E+ C+SVND FVMNAW    E +N+  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFSVFKEHGVDEILCVSVNDTFVMNAWKADQEAENITFIPDGNGEFTDGMGMLVDKNDIG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  F+E     N   DP+++S  + ++  +    K
Sbjct: 121 FGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMMNYVAPEYK 168


>gi|260770875|ref|ZP_05879804.1| peroxiredoxin family protein/glutaredoxin [Vibrio furnissii CIP
           102972]
 gi|260614112|gb|EEX39302.1| peroxiredoxin family protein/glutaredoxin [Vibrio furnissii CIP
           102972]
 gi|315178919|gb|ADT85833.1| AhpC/TSA family/glutaredoxin domain protein [Vibrio furnissii NCTC
           11218]
          Length = 244

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 104/167 (62%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F +R         +   W +V + +LF GK V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPQVTFPIR---------QGDAWVNVTSDELFKGKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + CLSVND FVMNAW    E ++++ +PDG+GEFT  MG+LV K  +G
Sbjct: 61  LFPVFKEHGVDSILCLSVNDTFVMNAWKHDQEAEHIQFIPDGNGEFTDGMGLLVDKKELG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RSWRY  L+KD ++E  F+E     N   DP+++S  + +L  +
Sbjct: 121 FGKRSWRYSMLVKDGIIEKMFIEP----NEPGDPFKVSDADTMLNYL 163


>gi|293605687|ref|ZP_06688065.1| antioxidant [Achromobacter piechaudii ATCC 43553]
 gi|292815925|gb|EFF75028.1| antioxidant [Achromobacter piechaudii ATCC 43553]
          Length = 242

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 103/176 (58%), Gaps = 19/176 (10%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R         +   WK V T DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPNVTFPVR---------EDNTWKKVTTDDLFKNKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++ + C+SVND FVMN W K  E  N+ LLPDG+G FT  MGMLV K ++
Sbjct: 60  ELAPAFFNAGVDSIVCVSVNDTFVMNEWAKDQESANITLLPDGNGAFTEGMGMLVDKSDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVE---EGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VV+  F+E   EG       DP+E+S  + +L  I  + K
Sbjct: 120 GFGKRSWRYSMLVKDGVVQKMFIEPEKEG-------DPFEVSDADTMLAHIAPTAK 168


>gi|261867006|ref|YP_003254928.1| hybrid peroxiredoxin hyPrx5 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|293391102|ref|ZP_06635436.1| peroxiredoxin like protein [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|261412338|gb|ACX81709.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase)
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290951636|gb|EFE01755.1| peroxiredoxin like protein [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 242

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDQWIDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  +  N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVISVNDTFVMNAWKEDEKSDNITFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|38488593|dbj|BAD02311.1| peroxiredoxin like protein [Actinobacillus actinomycetemcomitans]
          Length = 253

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  QW DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 19  KVPQVTFRTR---------QGDQWIDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 69

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  +  N+  +PDG+GEFT  MGMLV K+++
Sbjct: 70  ELAPVFKKYGVDDILVISVNDTFVMNAWKEDEKSDNITFIPDGNGEFTEGMGMLVGKEDL 129

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 130 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 173


>gi|194291683|ref|YP_002007590.1| peroxiredoxin/glutaredoxin, thioredoxin reductase [Cupriavidus
           taiwanensis LMG 19424]
 gi|193225587|emb|CAQ71533.1| peroxiredoxin/glutaredoxin, Thioredoxin reductase [Cupriavidus
           taiwanensis LMG 19424]
          Length = 243

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 103/168 (61%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R         +  +WK V T +LF GK V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPNVAFRIR---------EDNEWKTVTTAELFDGKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++++ C+SVND FVMN W K  E  N+ ++PDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPVFARHGVDDILCVSVNDTFVMNEWAKDQESGNITMIPDGNGEFTEGMGMLVDKADL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VV+  F+E         DP+++S  + +L  I
Sbjct: 120 GFGKRSWRYAMLVKDGVVQKMFIEP----EEPGDPFKVSDADTMLAYI 163


>gi|238921681|ref|YP_002935196.1| hybrid peroxiredoxin, [Edwardsiella ictaluri 93-146]
 gi|238871250|gb|ACR70961.1| hybrid peroxiredoxin, putative [Edwardsiella ictaluri 93-146]
          Length = 244

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 102/172 (59%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P V FH R         +  +W DV +  LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPPVTFHTR---------QRDKWLDVTSDALFRDKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++ + C+SVND FVMNAW    + +++  +PDG+GEFTR M MLV K ++G
Sbjct: 61  LAPIFHQHGVDSILCVSVNDTFVMNAWKNDQKAEHITFIPDGNGEFTRGMNMLVEKTDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+++ VVE  FVE     N   DP+++S  + +LK +    K
Sbjct: 121 FGPRSWRYSMLVRNGVVEKMFVEP----NLPGDPFQVSDADTMLKYLAPEHK 168


>gi|315635194|ref|ZP_07890472.1| antioxidant [Aggregatibacter segnis ATCC 33393]
 gi|315476156|gb|EFU66910.1| antioxidant [Aggregatibacter segnis ATCC 33393]
          Length = 242

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  QW DV + +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDQWVDVTSSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  +  N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKADNITFVPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  FVE     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFVEP----NEPGDPFKVSDADTMLKYL 162


>gi|262401926|ref|ZP_06078491.1| peroxiredoxin family protein/glutaredoxin [Vibrio sp. RC586]
 gi|262351898|gb|EEZ01029.1| peroxiredoxin family protein/glutaredoxin [Vibrio sp. RC586]
          Length = 243

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 102/172 (59%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V T +LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFPTR---------QGDAWVNVTTDELFKDKTVIVFSLPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW        +  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADQITFIPDGNGEFTNGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 121 FGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYIAPQYK 168


>gi|145635341|ref|ZP_01791043.1| hypothetical protein CGSHiAA_09567 [Haemophilus influenzae PittAA]
 gi|145267347|gb|EDK07349.1| hypothetical protein CGSHiAA_09567 [Haemophilus influenzae PittAA]
          Length = 241

 Score =  148 bits (373), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELVPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|68249172|ref|YP_248284.1| peroxiredoxin/glutaredoxin [Haemophilus influenzae 86-028NP]
 gi|145628955|ref|ZP_01784755.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           22.1-21]
 gi|145631748|ref|ZP_01787509.1| hypothetical protein CGSHi22421_05982 [Haemophilus influenzae
           R3021]
 gi|145638519|ref|ZP_01794128.1| hypothetical protein CGSHiII_07391 [Haemophilus influenzae PittII]
 gi|145640548|ref|ZP_01796132.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           R3021]
 gi|145642264|ref|ZP_01797829.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           R3021]
 gi|68057371|gb|AAX87624.1| peroxiredoxin/glutaredoxin [Haemophilus influenzae 86-028NP]
 gi|144979425|gb|EDJ89111.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           22.1-21]
 gi|144982609|gb|EDJ90155.1| hypothetical protein CGSHi22421_05982 [Haemophilus influenzae
           R3021]
 gi|145272114|gb|EDK12022.1| hypothetical protein CGSHiII_07391 [Haemophilus influenzae PittII]
 gi|145273020|gb|EDK12901.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           22.4-21]
 gi|145275134|gb|EDK14996.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           22.4-21]
 gi|309750023|gb|ADO80007.1| Peroxiredoxin/glutaredoxin glutathione-dependent peroxidase
           [Haemophilus influenzae R2866]
          Length = 241

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|16272515|ref|NP_438729.1| peroxiredoxin hybrid Prx5 [Haemophilus influenzae Rd KW20]
 gi|260581018|ref|ZP_05848841.1| peroxiredoxin hybrid Prx5 [Haemophilus influenzae RdAW]
 gi|1723174|sp|P44758|PRX5_HAEIN RecName: Full=Hybrid peroxiredoxin hyPrx5; AltName:
           Full=Thioredoxin reductase
 gi|1573561|gb|AAC22230.1| membrane protein [Haemophilus influenzae Rd KW20]
 gi|260092377|gb|EEW76317.1| peroxiredoxin hybrid Prx5 [Haemophilus influenzae RdAW]
          Length = 241

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENISFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|148827764|ref|YP_001292517.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           PittGG]
 gi|260582724|ref|ZP_05850511.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           NT127]
 gi|329122451|ref|ZP_08251038.1| antioxidant [Haemophilus aegyptius ATCC 11116]
 gi|148719006|gb|ABR00134.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           PittGG]
 gi|260094174|gb|EEW78075.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           NT127]
 gi|301169287|emb|CBW28885.1| peroxiredoxin/glutaredoxin [Haemophilus influenzae 10810]
 gi|327473733|gb|EGF19152.1| antioxidant [Haemophilus aegyptius ATCC 11116]
          Length = 241

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|319775507|ref|YP_004137995.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           F3047]
 gi|317450098|emb|CBY86312.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           F3047]
          Length = 241

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|319897912|ref|YP_004136109.1| DNA-binding transcriptional regulator oxyr [Haemophilus influenzae
           F3031]
 gi|317433418|emb|CBY81799.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           F3031]
          Length = 241

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|269140818|ref|YP_003297519.1| glutaredoxin-family domain protein [Edwardsiella tarda EIB202]
 gi|267986479|gb|ACY86308.1| glutaredoxin-family domain protein [Edwardsiella tarda EIB202]
 gi|304560578|gb|ADM43242.1| Peroxiredoxin family protein/glutaredoxin [Edwardsiella tarda
           FL6-60]
          Length = 244

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 101/172 (58%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P V FH R         +  +W DV +  LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  VPPVTFHTR---------QGDKWLDVTSDALFRDKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++ + C+SVND FVMNAW    + +++  +PDG+GEFTR M MLV K  +G
Sbjct: 61  LAPIFHQHGVDSILCVSVNDTFVMNAWKNDQKAEHITFIPDGNGEFTRGMNMLVEKAELG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+++ VVE  FVE     N   DP+++S  + +LK +    K
Sbjct: 121 FGPRSWRYSMLVRNGVVEKMFVEP----NLPGDPFQVSDADTMLKYLAPEHK 168


>gi|187478465|ref|YP_786489.1| antioxidant [Bordetella avium 197N]
 gi|115423051|emb|CAJ49582.1| putative antioxidant [Bordetella avium 197N]
          Length = 242

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 105/176 (59%), Gaps = 19/176 (10%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V+F +R         +   WK V T D+F  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPNVMFPVR---------EENNWKKVGTDDIFKNKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++ + C+SVND+FVMN W K  E  ++ LLPDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPTFFAHGVDAIVCVSVNDSFVMNEWAKDQESTHITLLPDGNGEFTAGMGMLVDKSDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVE---EGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L++D VV   F+E   EG       DP+E+S  + +L  I  + K
Sbjct: 120 GFGKRSWRYSMLVEDGVVRKMFIEPEKEG-------DPFEVSDADTMLAHIAPAAK 168


>gi|145633472|ref|ZP_01789201.1| hypothetical protein CGSHi3655_05114 [Haemophilus influenzae 3655]
 gi|145637932|ref|ZP_01793574.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           PittHH]
 gi|144985841|gb|EDJ92449.1| hypothetical protein CGSHi3655_05114 [Haemophilus influenzae 3655]
 gi|145268872|gb|EDK08833.1| DNA-binding transcriptional regulator OxyR [Haemophilus influenzae
           PittHH]
 gi|309972277|gb|ADO95478.1| Peroxiredoxin/glutaredoxin glutathione-dependent peroxidase
           [Haemophilus influenzae R2846]
          Length = 241

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|311106587|ref|YP_003979440.1| hybrid peroxiredoxin hyPrx5 [Achromobacter xylosoxidans A8]
 gi|310761276|gb|ADP16725.1| hybrid peroxiredoxin hyPrx5 [Achromobacter xylosoxidans A8]
          Length = 242

 Score =  147 bits (372), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 77/176 (43%), Positives = 101/176 (57%), Gaps = 19/176 (10%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R             WK V + DLF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPNVTFPVREDNT---------WKKVTSDDLFKNKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++ + C+SVND FVMN W K  E  N+ LLPDG+G FT  MGMLV K ++
Sbjct: 60  ELAPAFFAAGVDSIVCVSVNDTFVMNEWAKDQESANITLLPDGNGAFTEGMGMLVDKSDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVE---EGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+KD VV+  F+E   EG       DP+E+S  + +L     S K
Sbjct: 120 GFGKRSWRYSMLVKDGVVQKMFIEPEKEG-------DPFEVSDADTMLAHFAPSAK 168


>gi|301166721|emb|CBW26297.1| putative peroxiredoxin/glutaredoxin family protein [Bacteriovorax
           marinus SJ]
          Length = 243

 Score =  147 bits (372), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 96/146 (65%), Gaps = 4/146 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + + + DLF  K+V LF+LPGAFTPTCS   LP + ++      EG++E+ CLSVNDAFV
Sbjct: 25  QSIASDDLFKNKKVILFSLPGAFTPTCSSTHLPRYNQLAKTFAKEGVDEIVCLSVNDAFV 84

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           M +WG+  E   V LL DG+GEFT KMG+LV K ++GFG RSWRY  L+ + V+E  F+E
Sbjct: 85  MKSWGESQEADKVTLLADGNGEFTEKMGLLVDKSDLGFGKRSWRYSMLVNNGVIEKMFIE 144

Query: 149 EGFSDNCATDPYEISSPENVLKVIRE 174
                +   DP+E+S  + +L  I +
Sbjct: 145 P----DKPGDPFEVSDADTMLAFIND 166


>gi|83643062|ref|YP_431497.1| peroxiredoxin [Hahella chejuensis KCTC 2396]
 gi|83631105|gb|ABC27072.1| Peroxiredoxin [Hahella chejuensis KCTC 2396]
          Length = 244

 Score =  147 bits (372), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 102/169 (60%), Gaps = 13/169 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P V F++R      +G K   W  V T DLF GK V +FALPGAFTPTCS   LP + +
Sbjct: 10  VPSVTFNLR------EGEK---WVQVTTDDLFKGKNVIVFALPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +    +  GI+ + CLSVND FVMN+W    + +N+  L DG+GEF+  MGMLV K  +G
Sbjct: 61  LAPVFKQNGIDAIICLSVNDTFVMNSWKADQKAENIYFLADGNGEFSAGMGMLVEKSELG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRE 174
           FG RSWRY  L++D V+E  F+E         DP+++S  + +L  I +
Sbjct: 121 FGKRSWRYSMLVRDGVIEKMFIEP----ELPGDPFKVSDADTMLNYINK 165


>gi|261211207|ref|ZP_05925496.1| peroxiredoxin family protein/glutaredoxin [Vibrio sp. RC341]
 gi|260839708|gb|EEX66319.1| peroxiredoxin family protein/glutaredoxin [Vibrio sp. RC341]
          Length = 243

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 102/172 (59%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IPQV F  R         +   W +V T +LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPQVTFPTR---------QGDAWVNVTTDELFKDKTVIVFSLPGAFTPTCSSTHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           ++   +  G++ + C+SVND FVMNAW        +  +PDG+GEFT  MGMLV K+++G
Sbjct: 61  LFPVFKEHGVDSILCVSVNDTFVMNAWKDDQNADQITFIPDGNGEFTDGMGMLVDKNDLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK I    K
Sbjct: 121 FGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYIAPQYK 168


>gi|229845701|ref|ZP_04465824.1| hypothetical protein CGSHi6P18H1_05361 [Haemophilus influenzae
           6P18H1]
 gi|229811387|gb|EEP47093.1| hypothetical protein CGSHi6P18H1_05361 [Haemophilus influenzae
           6P18H1]
          Length = 241

 Score =  147 bits (371), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKIFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|308188589|ref|YP_003932720.1| peroxiredoxin/glutaredoxin family protein [Pantoea vagans C9-1]
 gi|308059099|gb|ADO11271.1| putative peroxiredoxin/glutaredoxin family protein [Pantoea vagans
           C9-1]
          Length = 244

 Score =  147 bits (370), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 73/167 (43%), Positives = 101/167 (60%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           IP V FH R         +  +W DV T+ LF  K V +F+LPGAFTPTCS   LP + +
Sbjct: 10  IPSVTFHTR---------QGDRWVDVTTEALFKDKTVIVFSLPGAFTPTCSSSHLPRYNE 60

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +      +G++ + C+SVND FVMNAW  +    N+  +PDG+GEFTR M MLV K ++G
Sbjct: 61  LAGLFAQQGVDSILCVSVNDTFVMNAWKAEQRADNITFIPDGNGEFTRGMEMLVEKADLG 120

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RS RY  L+++ VVE  FVE     N   DP+E+S  + +L+ +
Sbjct: 121 FGPRSCRYSMLVRNGVVEKMFVEP----NKPGDPFEVSDADTMLRYL 163


>gi|261493516|ref|ZP_05990037.1| peroxiredoxin/glutaredoxin family protein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
 gi|261495961|ref|ZP_05992377.1| peroxiredoxin/glutaredoxin family protein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261308367|gb|EEY09654.1| peroxiredoxin/glutaredoxin family protein [Mannheimia haemolytica
           serotype A2 str. OVINE]
 gi|261310812|gb|EEY11994.1| peroxiredoxin/glutaredoxin family protein [Mannheimia haemolytica
           serotype A2 str. BOVINE]
          Length = 244

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 106/172 (61%), Gaps = 13/172 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V F  R         +   W DV T +LF  K V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPSVTFRTR---------QNDAWVDVTTDELFNNKTVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  + +  G++++ C+SVND FVMNAW    E +N+ ++PDG+GEFT  MG+LV 
Sbjct: 57  PRYNELACEFKALGVDDIICMSVNDTFVMNAWKADQESENITVIPDGNGEFTEGMGLLVD 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           K+++GFG RSWRY  L+K+ +VE  F+E         DP+++S  + ++K +
Sbjct: 117 KNDLGFGKRSWRYSMLVKNGIVEKMFIEP----QEPGDPFKVSDADTMIKYL 164


>gi|254363241|ref|ZP_04979289.1| peroxiredoxin/glutaredoxin family protein [Mannheimia haemolytica
           PHL213]
 gi|153095138|gb|EDN75685.1| peroxiredoxin/glutaredoxin family protein [Mannheimia haemolytica
           PHL213]
          Length = 244

 Score =  146 bits (369), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 106/172 (61%), Gaps = 13/172 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V F  R         +   W DV T +LF  K V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPSVTFRTR---------QNDAWVDVTTDELFNNKTVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  + +  G++++ C+SVND FVMNAW    E +N+ ++PDG+GEFT  MG+LV 
Sbjct: 57  PRYNELACEFKALGVDDIICMSVNDTFVMNAWKADQESENITVIPDGNGEFTEGMGLLVD 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           K+++GFG RSWRY  L+K+ +VE  F+E         DP+++S  + ++K +
Sbjct: 117 KNDLGFGKRSWRYSMLVKNGIVEKMFIEP----QEPGDPFKVSDADTMIKYL 164


>gi|148825149|ref|YP_001289902.1| hypothetical protein CGSHiEE_00105 [Haemophilus influenzae PittEE]
 gi|229846662|ref|ZP_04466770.1| hypothetical protein CGSHi7P49H1_08315 [Haemophilus influenzae
           7P49H1]
 gi|148715309|gb|ABQ97519.1| hypothetical protein CGSHiEE_00105 [Haemophilus influenzae PittEE]
 gi|229810755|gb|EEP46473.1| hypothetical protein CGSHi7P49H1_08315 [Haemophilus influenzae
           7P49H1]
          Length = 241

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 106/168 (63%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQ+ F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQMTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENITFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|33592799|ref|NP_880443.1| putative glutaredoxin [Bordetella pertussis Tohama I]
 gi|33572447|emb|CAE42015.1| putative glutaredoxin [Bordetella pertussis Tohama I]
 gi|332382212|gb|AEE67059.1| putative glutaredoxin [Bordetella pertussis CS]
          Length = 242

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 101/171 (59%), Gaps = 19/171 (11%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F +R         +   WK V T D+F  K V +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPSVTFPVR---------ENNAWKQVTTDDVFKNKTVVVFSLPGAFTPTCSSTHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++       G++ + C+SVND FVMN   K  E  NV LLPDG+GEFT  MGMLV K ++
Sbjct: 60  ELAPTFFAAGVDSIVCVSVNDTFVMNERAKDQESANVTLLPDGNGEFTDGMGMLVDKKDL 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVE---EGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+KD VVE  F+E   EG       DP+E+S  + +L  +
Sbjct: 120 GFGKRSWRYAMLVKDGVVEKMFIEPEKEG-------DPFEVSDADTMLAYV 163


>gi|332991923|gb|AEF01978.1| putative peroxiredoxin/glutaredoxin family protein [Alteromonas sp.
           SN2]
          Length = 246

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 102/168 (60%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P V   +R      DG     W    T++LF+ K V +F+LPGAFTPTCS   LP + 
Sbjct: 13  QVPSVSIPVR------DGE---TWATKTTEELFSNKTVVVFSLPGAFTPTCSSTHLPRYN 63

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
            +    +  G++++ C+SVND FVMNAW    E +NV ++PDG+G+FT  MGMLV K ++
Sbjct: 64  ALAKVFKQHGVDDILCISVNDTFVMNAWAADQEAENVTVIPDGNGDFTDGMGMLVDKADL 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+  VE  F+E     +   DP+E+S  + +L  I
Sbjct: 124 GFGKRSWRYSMLVKNGTVEKMFIEP----DVPGDPFEVSDADTMLAYI 167


>gi|149910252|ref|ZP_01898897.1| glutaredoxin [Moritella sp. PE36]
 gi|149806721|gb|EDM66686.1| glutaredoxin [Moritella sp. PE36]
          Length = 192

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 105/172 (61%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F +R         +   W +  T++LFA K V +F+LPGAFTPTCS   LP + +
Sbjct: 12  VPQVTFPIR---------QGDAWVNRTTEELFANKTVIVFSLPGAFTPTCSSSHLPRYNE 62

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           +       G++++ C+SVND FVMNAW    E +N+  +PDG+GEF+  MGMLV K ++G
Sbjct: 63  LASVFSAHGVDDILCVSVNDTFVMNAWKDDQEAENITFIPDGNGEFSAGMGMLVDKSDIG 122

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VV   F+E     +   DP+++S  + +L +  ++ K
Sbjct: 123 FGKRSWRYSMLVKNGVVAKMFIEA----DEPGDPFKVSDADTMLGMWHQNIK 170


>gi|251793684|ref|YP_003008414.1| hybrid peroxiredoxin hyPrx5 [Aggregatibacter aphrophilus NJ8700]
 gi|247535081|gb|ACS98327.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase)
           [Aggregatibacter aphrophilus NJ8700]
          Length = 242

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 105/168 (62%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  +  N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSDNITFVPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VV+  F+E     N   DP+++S  + +LK +
Sbjct: 119 GFGKRSWRYSMLVKNGVVDKMFIEP----NEPGDPFKVSDADTMLKYL 162


>gi|289209017|ref|YP_003461083.1| glutaredoxin-family domain protein [Thioalkalivibrio sp. K90mix]
 gi|288944648|gb|ADC72347.1| glutaredoxin-family domain protein [Thioalkalivibrio sp. K90mix]
          Length = 249

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 101/168 (60%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P+V F  R         K   W DV ++DLF G+ V +FALPGAFTPTCS   +P + 
Sbjct: 10  RVPEVTFRCR---------KDNDWNDVRSEDLFKGRNVIVFALPGAFTPTCSSAHVPRYN 60

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  GI+E+ C+SVND FVM AW    +   V  + DG+GEFT +MGMLV K ++
Sbjct: 61  ELAPVFKKHGIDEIVCISVNDGFVMEAWQADQQADRVTFIADGNGEFTEQMGMLVDKSDL 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L++D V+E  F+E     +   DP+ +S  + +L  I
Sbjct: 121 GFGWRSWRYSMLVRDGVIEKQFIEP----DEPGDPFVVSDADTMLAHI 164


>gi|149911756|ref|ZP_01900362.1| glutaredoxin [Moritella sp. PE36]
 gi|149805181|gb|EDM65201.1| glutaredoxin [Moritella sp. PE36]
          Length = 244

 Score =  144 bits (363), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 102/172 (59%), Gaps = 13/172 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F +R         +   W +  T++LFA K V +F+LPGAFTPTCS   LP + +
Sbjct: 12  VPQVTFPIR---------QGDAWVNRTTEELFANKTVIVFSLPGAFTPTCSSSHLPRYNE 62

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + +     G++++ C+SVND FVMNAW    E +N+  +PDG+ EF+  MGMLV K ++G
Sbjct: 63  LANVFSAHGVDDILCVSVNDTFVMNAWKDDQEAENITFIPDGNSEFSAGMGMLVDKSDIG 122

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           FG RSWRY  L+K+ VV   F+E     +   DP+ +S  + +L  +    K
Sbjct: 123 FGKRSWRYSMLVKNGVVAKMFIEA----DEPGDPFNVSDADTMLGYVAPEYK 170


>gi|92113381|ref|YP_573309.1| glutaredoxin-like region [Chromohalobacter salexigens DSM 3043]
 gi|91796471|gb|ABE58610.1| Glutaredoxin-like region [Chromohalobacter salexigens DSM 3043]
          Length = 249

 Score =  143 bits (360), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 101/167 (60%), Gaps = 13/167 (7%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P V F +R         +     DV ++ LF G+ V LFALPGA+TPTCS + LP + +
Sbjct: 11  VPDVTFKVR---------RDGHLIDVTSEALFKGRNVVLFALPGAYTPTCSSNHLPRYNE 61

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + D     GI+++ CLSVND FVM AWG+  E +N+ L+ DG+GEFT  MGMLV K   G
Sbjct: 62  LADRFYTSGIDDIVCLSVNDPFVMEAWGQHQEAENLTLIGDGNGEFTAGMGMLVDKSGQG 121

Query: 126 FGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           FG RS RY  L+++ V+E  FVE     +   DP+E+S  + +L  +
Sbjct: 122 FGQRSRRYAMLVRNGVIEKLFVEP----DLPGDPFEVSDADTMLDYL 164


>gi|322515503|ref|ZP_08068489.1| peroxiredoxin [Actinobacillus ureae ATCC 25976]
 gi|322118470|gb|EFX90721.1| peroxiredoxin [Actinobacillus ureae ATCC 25976]
          Length = 245

 Score =  140 bits (353), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 102/173 (58%), Gaps = 13/173 (7%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           M   ++P V F  R         K  +W +V T DLF  K V +F+LPGAFTPTCS   L
Sbjct: 6   MTGQKVPNVTFPTR---------KGGEWVNVTTADLFDNKTVVVFSLPGAFTPTCSSTHL 56

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           P + ++  + +   ++ + C+SVND FVMNAW K  + +NV LL DG+GEFT  MG LV 
Sbjct: 57  PRYNELAGEFKKLDVDSIICISVNDTFVMNAWAKDQDAENVILLADGNGEFTEGMGRLVD 116

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           K N+GFG RSWRY  L+K+  V   F +E   D    DP+E+S  E ++K + 
Sbjct: 117 KANLGFGKRSWRYSMLVKNGEVVKMF-DEPEKDG---DPFEVSDAETMIKFLN 165


>gi|29726703|pdb|1NM3|A Chain A, Crystal Structure Of Heamophilus Influenza Hybrid-Prx5
 gi|29726704|pdb|1NM3|B Chain B, Crystal Structure Of Heamophilus Influenza Hybrid-Prx5
          Length = 241

 Score =  140 bits (352), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 102/168 (60%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R         +  +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTR---------QGDKWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FV NAW +  + +N+  +PDG+GEFT   G LV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVXNAWKEDEKSENISFIPDGNGEFTEGXGXLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  +  LK +
Sbjct: 119 GFGKRSWRYSXLVKNGVVEKXFIEP----NEPGDPFKVSDADTXLKYL 162


>gi|294634272|ref|ZP_06712814.1| antioxidant, AhpC/TSA family/glutaredoxin [Edwardsiella tarda ATCC
           23685]
 gi|291092312|gb|EFE24873.1| antioxidant, AhpC/TSA family/glutaredoxin [Edwardsiella tarda ATCC
           23685]
          Length = 242

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 99/168 (58%), Gaps = 13/168 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV FH           +  QW +V + +LF  +RV +F+LPGAFTPTCS   LP + 
Sbjct: 9   RVPQVTFHTH---------QGDQWVEVTSDELFRDQRVIVFSLPGAFTPTCSSSHLPRYN 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  GI+ + C+SVNDAFVM AW +  + ++V  LPDG G FTR M M+V K   
Sbjct: 60  ELAPIFQQYGIDRILCVSVNDAFVMEAWKEAQKAEHVTFLPDGEGHFTRGMNMMVEKSEQ 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            FG R+WRY  L+ D V+E  F+E    D    DP+++S  + +L  +
Sbjct: 120 SFGPRAWRYSMLVCDGVIEKMFIEPDTLD----DPFQVSDADTMLNYL 163


>gi|3462877|gb|AAC34466.1| unknown [Rhizobium etli]
          Length = 112

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 63/107 (58%), Positives = 77/107 (71%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P V F  RV      G   ++W+D  T D F+GKRV LF+LPGAFTP CS  QLP FE
Sbjct: 6   QVPIVTFRTRVRDESISGPNPYRWEDKTTDDYFSGKRVILFSLPGAFTPICSTFQLPDFE 65

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEF 111
            +Y + +  GI+++YCLSVNDAFVMNAWGK   +KNVKL+PDGSGEF
Sbjct: 66  SLYVEFKKNGIDDIYCLSVNDAFVMNAWGKSQGLKNVKLIPDGSGEF 112


>gi|326782471|ref|YP_004322871.1| antioxidant protein [Synechococcus phage S-ShM2]
 gi|310003419|gb|ADO97816.1| antioxidant protein [Synechococcus phage S-ShM2]
          Length = 168

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 90/143 (62%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
            TQ+LFAGK++ L  LPGAFTPTCS+ QLP +E+   D    G++EV+  SVND F M A
Sbjct: 22  TTQELFAGKKIVLVGLPGAFTPTCSEKQLPQYEEQIQDFLALGVDEVWLTSVNDDFTMKA 81

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           W ++  I+ VK L DG+      +  LV K++ GFGLRSWRY  ++ DM +     E G 
Sbjct: 82  WFEERGIRYVKFLADGNAHLAAMLNQLVLKNDKGFGLRSWRYAMVVDDMKIAFQTEESGK 141

Query: 152 SDNCATDPYEISSPENVLKVIRE 174
            DN   DPYE ++P  VL+ +++
Sbjct: 142 RDNAEEDPYEKTTPAVVLQFLKQ 164


>gi|163795033|ref|ZP_02189002.1| hypothetical protein BAL199_09158 [alpha proteobacterium BAL199]
 gi|159179852|gb|EDP64379.1| hypothetical protein BAL199_09158 [alpha proteobacterium BAL199]
          Length = 160

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/142 (48%), Positives = 92/142 (64%), Gaps = 8/142 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           +DV T DLF GK V LFALPGAFTPTCS   LPG+     DL+ +G++ + CLSVNDAFV
Sbjct: 23  QDVKTADLFGGKTVVLFALPGAFTPTCSAKHLPGYVAKAADLKGKGVDAIACLSVNDAFV 82

Query: 89  MNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M+AWGK  ++  NV +L DG+ +FT+ +G+ +     G G RS RY  ++KD VV+  FV
Sbjct: 83  MDAWGKDQKVGDNVMMLADGNADFTKAVGLEMDGSGYGMGTRSKRYAMVVKDGVVKDLFV 142

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           EE          +E+SS + VL
Sbjct: 143 EE-------PGQFEVSSADYVL 157


>gi|83032914|ref|XP_729247.1| hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
 gi|23486502|gb|EAA20812.1| hypothetical protein [Plasmodium yoelii yoelii]
          Length = 245

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 97/150 (64%), Gaps = 1/150 (0%)

Query: 28  WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD-LRCEGIEEVYCLSVNDA 86
           ++ ++T +LF  KR+ L +LPGAFTP C+   +P +EK YD+ +R    +++YC++ ND 
Sbjct: 95  FRSIDTHELFKSKRILLISLPGAFTPLCTSKMIPEYEKEYDNFIRENKFDDIYCITNNDI 154

Query: 87  FVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           +V+ +W K ++IK +K + DG+  FT  M MLV K N   G+R WRY A++++ ++   F
Sbjct: 155 YVLKSWFKSMDIKKIKYISDGNSSFTESMNMLVDKSNYFMGMRPWRYVAIVENNILIKIF 214

Query: 147 VEEGFSDNCATDPYEISSPENVLKVIRESK 176
            E     N  TDPY+ISS ++V + ++ +K
Sbjct: 215 QENEKQHNIQTDPYDISSVDHVKEFLKHNK 244


>gi|332185779|ref|ZP_08387526.1| redoxin family protein [Sphingomonas sp. S17]
 gi|332014137|gb|EGI56195.1| redoxin family protein [Sphingomonas sp. S17]
          Length = 159

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 93/155 (60%), Gaps = 12/155 (7%)

Query: 18  VLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEE 77
           V P+G +      V++ D FAG+RV LFA+PGAFTPTCS   LPGF    D L+ +G++E
Sbjct: 17  VTPEGPE-----QVSSTDYFAGRRVALFAVPGAFTPTCSAQHLPGFVAQGDALKAKGVDE 71

Query: 78  VYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           + C SVNDAFVM AWG+      + +L DG+ +F + +G+ +     G G RS RY  L+
Sbjct: 72  IACTSVNDAFVMKAWGQASGSAGITMLADGNADFAKAVGLTMDGSKFGMGTRSQRYAMLV 131

Query: 138 KDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            D VVE  FVE       A   +++SS E++L  I
Sbjct: 132 HDGVVEQLFVE-------APGEFKVSSAEHLLSQI 159


>gi|296004905|ref|XP_002808799.1| 1-cys peroxiredoxin [Plasmodium falciparum 3D7]
 gi|34591895|gb|AAQ76285.1| peroxiredoxin [Plasmodium falciparum 3D7]
 gi|225632188|emb|CAX64072.1| 1-cys peroxiredoxin [Plasmodium falciparum 3D7]
          Length = 240

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 100/157 (63%), Gaps = 2/157 (1%)

Query: 21  DGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD-LRCEGIEEVY 79
           DGS    +  ++T +LF  K++ L +LPGAFTPTCS   +PG+E+ YD  ++    +++Y
Sbjct: 84  DGSPN-DFTSIDTHELFNNKKILLISLPGAFTPTCSTKMIPGYEEEYDYFIKENNFDDIY 142

Query: 80  CLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           C++ ND +V+ +W K ++IK +K + DG+  FT  M MLV K N   G+R WR+ A++++
Sbjct: 143 CITNNDIYVLKSWFKSMDIKKIKYISDGNSSFTESMNMLVDKSNFFMGMRPWRFVAIVEN 202

Query: 140 MVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
            ++   F E+    N  TDPY+IS+  NV + ++ ++
Sbjct: 203 NILVKMFQEKDKQHNIQTDPYDISTVNNVKEFLKNNQ 239


>gi|332707463|ref|ZP_08427511.1| peroxiredoxin [Lyngbya majuscula 3L]
 gi|332353760|gb|EGJ33252.1| peroxiredoxin [Lyngbya majuscula 3L]
          Length = 98

 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (78%)

Query: 80  CLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           CLSVNDAFVM  WGK+  ++N+ LLPDG+GEFTRKMGMLV KDN+GFG+RSWRY  ++ D
Sbjct: 1   CLSVNDAFVMFQWGKQQGVQNIFLLPDGNGEFTRKMGMLVEKDNLGFGMRSWRYSMVVDD 60

Query: 140 MVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
             +E  FVE G++DNC TDP+E+S  + +L  ++ +KK
Sbjct: 61  GKIEKMFVEPGYADNCPTDPFEVSDADTMLAYLKSAKK 98


>gi|68075209|ref|XP_679521.1| antioxidant protein [Plasmodium berghei strain ANKA]
 gi|56500288|emb|CAH95621.1| antioxidant protein, putative [Plasmodium berghei]
          Length = 151

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 95/150 (63%), Gaps = 1/150 (0%)

Query: 28  WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD-LRCEGIEEVYCLSVNDA 86
           ++ ++T +LF  KR+ L +LPGAFTP C+   +P +EK YD  +R    +++YC++ ND 
Sbjct: 1   FRSIDTHELFKSKRILLISLPGAFTPLCTSKMIPEYEKEYDSFIRENKFDDIYCITNNDI 60

Query: 87  FVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           +V+ +W K ++IK +K + DG+  FT  M MLV K N   G+R WRY  ++++ ++   F
Sbjct: 61  YVLKSWFKNMDIKKIKYISDGNSSFTESMNMLVDKSNYFMGMRPWRYVGIVENNILIKIF 120

Query: 147 VEEGFSDNCATDPYEISSPENVLKVIRESK 176
            E     N  TDPY+ISS ++V + ++ +K
Sbjct: 121 QENEKQHNIQTDPYDISSADHVKEFLKHNK 150


>gi|70953094|ref|XP_745670.1| antioxidant protein [Plasmodium chabaudi chabaudi]
 gi|56526067|emb|CAH77947.1| antioxidant protein, putative [Plasmodium chabaudi chabaudi]
          Length = 176

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 96/158 (60%), Gaps = 3/158 (1%)

Query: 20  PDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG-IEEV 78
           PD    F  + ++T +LF  KR+ L +LPGAFTP C+   +P +EK YD+   E   +++
Sbjct: 20  PDDKSPF--RSIDTHELFKSKRILLISLPGAFTPLCTSKMIPEYEKEYDNFIIENKFDDI 77

Query: 79  YCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIK 138
           YC++ ND +V+ +W K + IK +K + DG+  FT  M MLV K N   G+R WRY A+++
Sbjct: 78  YCITNNDIYVLKSWFKDMGIKKIKYISDGNSSFTESMNMLVDKSNYFMGMRPWRYVAIVE 137

Query: 139 DMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           + ++   F E     N  TDPY+ISS  +V + ++ +K
Sbjct: 138 NNILIKIFQENEKQHNIQTDPYDISSANHVKEFLKHNK 175


>gi|330814154|ref|YP_004358393.1| rhodanese domain protein [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487249|gb|AEA81654.1| rhodanese domain protein [Candidatus Pelagibacter sp. IMCC9063]
          Length = 160

 Score =  130 bits (328), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 89/146 (60%), Gaps = 9/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P V F  R+     DG    +     T D+F  K++ +FALPGAFTPTCSD+ LP +E
Sbjct: 4   QVPNVNFIYRI-----DGENIKK----TTNDIFLNKKIVVFALPGAFTPTCSDYHLPSYE 54

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             YD ++  G+++++CLSVND+FV N W K   +K V  +PDG+ +FT++M ML  +   
Sbjct: 55  DNYDKIQKYGVDDIFCLSVNDSFVQNVWKKNSNVKKVNFIPDGNADFTKEMNMLTDRSET 114

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEG 150
           G G+RS+RY   + +  +   F +E 
Sbjct: 115 GMGMRSFRYSMYVDNKKIIKIFKDEN 140


>gi|256822798|ref|YP_003146761.1| Redoxin domain-containing protein [Kangiella koreensis DSM 16069]
 gi|256796337|gb|ACV26993.1| Redoxin domain protein [Kangiella koreensis DSM 16069]
          Length = 157

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 91/141 (64%), Gaps = 8/141 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           +D++T D+F+GK+V LFA+PGAFTPTCS   LPGF    DD++ +G++ + C+SVND FV
Sbjct: 22  QDISTDDIFSGKKVVLFAVPGAFTPTCSAAHLPGFVVQADDIKSKGVDTIACMSVNDVFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           M+AWGK      + +L DG+ +FT  MG+ +     G G+RS R+  ++ D VV++  V+
Sbjct: 82  MDAWGKAQNADEIMMLADGNADFTEAMGIEMDATGFGMGVRSKRFAMIVDDGVVKALEVD 141

Query: 149 EGFSDNCATDPYEISSPENVL 169
           E          +E SS EN+L
Sbjct: 142 E--------KGFEKSSAENIL 154


>gi|154251139|ref|YP_001411963.1| redoxin domain-containing protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154155089|gb|ABS62306.1| Redoxin domain protein [Parvibaculum lavamentivorans DS-1]
          Length = 162

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 66/141 (46%), Positives = 91/141 (64%), Gaps = 7/141 (4%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V T + F G++V +FALPGAFTPTCS+  LPGF K  D ++ +G++E+ CLSVNDAFVM 
Sbjct: 25  VKTGEFFKGRKVVVFALPGAFTPTCSNQHLPGFIKNADTIKGKGVDEIVCLSVNDAFVMG 84

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWGK+    + V +L DG+G+FT+ +G+     N G G+RS RY  L+ D VV+S   E 
Sbjct: 85  AWGKQQGADSKVTMLADGNGDFTKALGLEFDGSNFGMGVRSSRYSMLVDDGVVKSLNKEP 144

Query: 150 GFSDNCATDPYEISSPENVLK 170
                 A    E+S  EN+L+
Sbjct: 145 ------AGGKAEVSGAENILQ 159


>gi|329890620|ref|ZP_08268963.1| redoxin family protein [Brevundimonas diminuta ATCC 11568]
 gi|328845921|gb|EGF95485.1| redoxin family protein [Brevundimonas diminuta ATCC 11568]
          Length = 162

 Score =  130 bits (326), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 101/171 (59%), Gaps = 15/171 (8%)

Query: 2   IRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLP 61
           +  QI   +    + T+ PDG K      V T +LF GK V LFA+PGAFTPTCS   LP
Sbjct: 1   MTIQIGDRIPDATLTTMTPDGPKP-----VTTAELFGGKTVALFAVPGAFTPTCSARHLP 55

Query: 62  GFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK---NVKLLPDGSGEFTRKMGML 118
           G+     DL  +G++ V C+SVNDAFVM AW K  ++    +V +L DG+G+FTR +G++
Sbjct: 56  GYVDHRADLAGKGVDTVACVSVNDAFVMGAWAKANDLNGADDVVMLADGNGDFTRAVGLV 115

Query: 119 VYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
           +     G G RS RY  L+KD VV+   +E+G         +++SS E++L
Sbjct: 116 LDAKGFGMGERSQRYSMLVKDGVVDQLNIEQGGE-------FKVSSAEHLL 159


>gi|4928472|gb|AAD33602.1|AF133302_1 type 2 peroxiredoxin [Brassica rapa subsp. pekinensis]
 gi|83032224|gb|ABB97029.1| unknown [Brassica rapa]
          Length = 162

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 103/166 (62%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDGS +F     Q + V+   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVVPDGSISFFDENDQLQTVSVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++E+ C SVND FVM AWGK   E K+VK + DGSGE+T+ +G+ +   + G 
Sbjct: 64  EELKSKGVDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTKLLGLELDLKDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  LI ++ V    VE G         + +SS +++LK +
Sbjct: 124 GVRSRRFALLIDNLKVTVANVESG-------GEFTVSSADDILKAL 162


>gi|255575353|ref|XP_002528579.1| peroxiredoxin, putative [Ricinus communis]
 gi|223531975|gb|EEF33787.1| peroxiredoxin, putative [Ricinus communis]
          Length = 225

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 105/176 (59%), Gaps = 15/176 (8%)

Query: 5   QIPQVVFHMRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQ 59
           Q P +   + V   LPD + ++     + +      L AGK+  LFA+PGAFTPTCS   
Sbjct: 57  QTPTITAAITVGDKLPDATLSYFDSDDELQTTTISSLTAGKKSILFAVPGAFTPTCSQKH 116

Query: 60  LPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMG-- 116
           LPGF +   +L+ +GI+ + C+SVNDAFVM AW + L IK+ V LL DG+GEFT+K+G  
Sbjct: 117 LPGFVEKSAELKAKGIDVIACVSVNDAFVMKAWKENLGIKDEVLLLSDGNGEFTKKIGCE 176

Query: 117 MLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           + +    VG G+RS RY  L +D VV+   +EEG +       +  S  +++LK++
Sbjct: 177 LDLSDKPVGLGVRSRRYAILAEDGVVKVLNLEEGGA-------FTFSGADDILKLL 225


>gi|167648445|ref|YP_001686108.1| redoxin domain-containing protein [Caulobacter sp. K31]
 gi|167350875|gb|ABZ73610.1| Redoxin domain protein [Caulobacter sp. K31]
          Length = 160

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 80/121 (66%), Gaps = 1/121 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V T DLF GK V LFA+PGAFTPTCS   LPGF+    DL+ +G+E + C+SVND FVM 
Sbjct: 25  VTTDDLFKGKTVALFAVPGAFTPTCSAKHLPGFKDHAADLKAKGVEVIACVSVNDLFVMK 84

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWG    I + V LL DG+GEFTR +G+       G GLRS RY  + KD VV++  VEE
Sbjct: 85  AWGADQGITDEVLLLADGNGEFTRAVGLEFDGSKFGMGLRSQRYSLIAKDGVVQTLNVEE 144

Query: 150 G 150
           G
Sbjct: 145 G 145


>gi|159480856|ref|XP_001698498.1| peroxiredoxin type II [Chlamydomonas reinhardtii]
 gi|158282238|gb|EDP07991.1| peroxiredoxin type II [Chlamydomonas reinhardtii]
          Length = 161

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 93/154 (60%), Gaps = 9/154 (5%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   FH+  A  +P        + + T+ LF GK+V LFA+PGA+TPTCS   LPGF 
Sbjct: 8   KVPAATFHVPDANGMP--------QPLTTEQLFGGKKVLLFAVPGAYTPTCSKQHLPGFV 59

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D L+ +G++ + CLSVNDAFVM AWG+ + + + V +L DG+  FT+ +G+      
Sbjct: 60  ESADALKAKGVDTIACLSVNDAFVMGAWGQSIGVGDKVTMLADGAAAFTKAVGLDQDLSE 119

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEEGFSDNCAT 157
            G G+RS RY  L++D VV+   VE      C++
Sbjct: 120 AGLGVRSQRYAMLVEDGVVKVLNVEPARGLTCSS 153


>gi|15231718|ref|NP_190864.1| peroxiredoxin type 2, putative [Arabidopsis thaliana]
 gi|143360522|sp|Q949U7|PRX2E_ARATH RecName: Full=Peroxiredoxin-2E, chloroplastic; AltName:
           Full=Peroxiredoxin IIE; AltName: Full=Thioredoxin
           reductase 2E; Flags: Precursor
 gi|7529720|emb|CAB86900.1| peroxiredoxin-like protein [Arabidopsis thaliana]
 gi|15451116|gb|AAK96829.1| peroxiredoxin-like protein [Arabidopsis thaliana]
 gi|18377484|gb|AAL66908.1| peroxiredoxin-like protein [Arabidopsis thaliana]
 gi|23297326|gb|AAN12942.1| putative peroxiredoxin [Arabidopsis thaliana]
 gi|332645497|gb|AEE79018.1| peroxiredoxin-2E [Arabidopsis thaliana]
          Length = 234

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 98/166 (59%), Gaps = 11/166 (6%)

Query: 4   FQIPQVVFHMRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSD 57
           F    V   + V   LPD + ++        K V    L AGK+  LFA+PGAFTPTCS 
Sbjct: 64  FATTPVTASISVGDKLPDSTLSYLDPSTGDVKTVTVSSLTAGKKTILFAVPGAFTPTCSQ 123

Query: 58  HQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMG 116
             +PGF     +LR +GI+ + C+SVNDAFVM AW K L I + V LL DG+GEFT K+G
Sbjct: 124 KHVPGFVSKAGELRSKGIDVIACISVNDAFVMEAWRKDLGINDEVMLLSDGNGEFTGKLG 183

Query: 117 M-LVYKDN-VGFGLRSWRYGALIKDMVVESWFVEEG--FSDNCATD 158
           + L  +D  VG G+RS RY  L  D VV+   +EEG  F+++ A D
Sbjct: 184 VELDLRDKPVGLGVRSRRYAILADDGVVKVLNLEEGGAFTNSSAED 229


>gi|15292893|gb|AAK92817.1| putative peroxiredoxin protein [Arabidopsis thaliana]
          Length = 234

 Score =  128 bits (321), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 98/166 (59%), Gaps = 11/166 (6%)

Query: 4   FQIPQVVFHMRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSD 57
           F    V   + V   LPD + ++        K V    L AGK+  LFA+PGAFTPTCS 
Sbjct: 64  FATTPVTASISVGDKLPDSTLSYLDPSTGDVKTVTVSSLTAGKKTILFAVPGAFTPTCSQ 123

Query: 58  HQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMG 116
             +PGF     +LR +GI+ + C+SVNDAFVM AW K L I + V LL DG+GEFT K+G
Sbjct: 124 KHVPGFVSKVGELRSKGIDVIACISVNDAFVMEAWRKDLGINDEVMLLSDGNGEFTGKLG 183

Query: 117 M-LVYKDN-VGFGLRSWRYGALIKDMVVESWFVEEG--FSDNCATD 158
           + L  +D  VG G+RS RY  L  D VV+   +EEG  F+++ A D
Sbjct: 184 VELDLRDKPVGLGVRSRRYAILADDGVVKVLNLEEGGAFTNSSAED 229


>gi|315127749|ref|YP_004069752.1| peroxiredoxin AhpC/Tsa [Pseudoalteromonas sp. SM9913]
 gi|315016263|gb|ADT69601.1| peroxiredoxin AhpC/Tsa [Pseudoalteromonas sp. SM9913]
          Length = 157

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 91/145 (62%), Gaps = 10/145 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + + + +LFA K+V LFA+PGAFTPTCS+  LPG+  + D ++ +GI  +YC+SVNDAFV
Sbjct: 22  QTLTSNELFADKKVVLFAVPGAFTPTCSNAHLPGYIALADKIKAKGINAIYCVSVNDAFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFV 147
           M AWG+    +++ +L DG   FTR +G+   KD  GF G+RS RY  ++ + VV   FV
Sbjct: 82  MKAWGESQNAEHIDMLADGDASFTRALGL--EKDTAGFGGIRSKRYAMVVDNGVVTGLFV 139

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           E+          + ISS E VL  +
Sbjct: 140 EQ-------DKEFVISSAEAVLATL 157


>gi|217071382|gb|ACJ84051.1| unknown [Medicago truncatula]
          Length = 162

 Score =  127 bits (320), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 103/166 (62%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           ++V  V+PDG+ AF     + + V    L AGK+V +FA+PGAFTPTCS   +PGF +  
Sbjct: 4   IKVGDVIPDGTLAFLDEENKPQSVTIHSLSAGKKVIIFAVPGAFTPTCSLKHVPGFIERS 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++E+ C+SVND FV+N+W K   E K+VK L DGS ++T   G+ +   + G 
Sbjct: 64  EELKGKGVDEIICISVNDPFVLNSWAKTFPENKHVKFLADGSAKYTHAPGLELDLSDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L++D+ V+   VEEG         Y IS  E ++K +
Sbjct: 124 GIRSKRFALLVEDLKVKVANVEEGGE-------YTISGAEEIIKAL 162


>gi|254420629|ref|ZP_05034353.1| Redoxin superfamily [Brevundimonas sp. BAL3]
 gi|196186806|gb|EDX81782.1| Redoxin superfamily [Brevundimonas sp. BAL3]
          Length = 161

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 93/143 (65%), Gaps = 9/143 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VNT D+FAGK V LFA+PGAFTPTCS   LPGF+   + ++ +G++ V C+SVNDAFV
Sbjct: 23  KPVNTADIFAGKTVALFAVPGAFTPTCSARHLPGFKDNLEAIKGKGVDVVACISVNDAFV 82

Query: 89  MNAWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AW +   I  +++ +L DG+G+ TR++G+++     G G RS RY  L+KD  V    
Sbjct: 83  MKAWAESQGIDDESIVMLADGNGDLTRELGLVLDGSGFGLGQRSQRYSMLVKDGTVTQLN 142

Query: 147 VEEGFSDNCATDPYEISSPENVL 169
           +E+G         +++SS E++L
Sbjct: 143 IEQG-------GEFKVSSAEHLL 158


>gi|61680402|pdb|1XIY|A Chain A, Crystal Structure Of Plasmodium Falciparum Antioxidant
           Protein (1-Cys Peroxiredoxin)
 gi|61680403|pdb|1XIY|B Chain B, Crystal Structure Of Plasmodium Falciparum Antioxidant
           Protein (1-Cys Peroxiredoxin)
          Length = 182

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 99/157 (63%), Gaps = 2/157 (1%)

Query: 21  DGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD-LRCEGIEEVY 79
           DGS    +  ++T +LF  K++ L +LPGAFTPT S   +PG+E+ YD  ++    +++Y
Sbjct: 26  DGSPN-DFTSIDTHELFNNKKILLISLPGAFTPTXSTKMIPGYEEEYDYFIKENNFDDIY 84

Query: 80  CLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           C++ ND +V+ +W K ++IK +K + DG+  FT  M MLV K N   G+R WR+ A++++
Sbjct: 85  CITNNDIYVLKSWFKSMDIKKIKYISDGNSSFTDSMNMLVDKSNFFMGMRPWRFVAIVEN 144

Query: 140 MVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
            ++   F E+    N  TDPY+IS+  NV + ++ ++
Sbjct: 145 NILVKMFQEKDKQHNIQTDPYDISTVNNVKEFLKNNQ 181


>gi|18406870|ref|NP_564763.1| peroxiredoxin type 2, putative [Arabidopsis thaliana]
 gi|84028276|sp|O22711|PRX2D_ARATH RecName: Full=Peroxiredoxin-2D; AltName: Full=Peroxiredoxin IID;
           AltName: Full=Thioredoxin reductase 2D
 gi|51970548|dbj|BAD43966.1| unknown protein [Arabidopsis thaliana]
 gi|194708796|gb|ACF88482.1| At1g60740 [Arabidopsis thaliana]
 gi|332195606|gb|AEE33727.1| peroxiredoxin-2D [Arabidopsis thaliana]
          Length = 162

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 68/166 (40%), Positives = 101/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ +F     Q + V+   + AGK+V LF +PGAFTPTCS   +PGF    
Sbjct: 4   ITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +GI+E+ C SVND FVM AWGK   E K+VK + DGSGE+T  +G+ +   + G 
Sbjct: 64  EELKSKGIDEIICFSVNDPFVMKAWGKTYQENKHVKFVADGSGEYTHLLGLELDLKDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L+ ++ V    VE G         + +SS E++LK +
Sbjct: 124 GIRSRRFALLLDNLKVTVANVENG-------GEFTVSSAEDILKAL 162


>gi|254426124|ref|ZP_05039841.1| Redoxin superfamily [Synechococcus sp. PCC 7335]
 gi|196188547|gb|EDX83512.1| Redoxin superfamily [Synechococcus sp. PCC 7335]
          Length = 186

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 93/152 (61%), Gaps = 7/152 (4%)

Query: 28  WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAF 87
           W  + T  LFA K V +FA+PGAFT   S   L G+    +D R  G++E+ C+SVND+F
Sbjct: 23  WHALTTTHLFARKTVVMFAVPGAFTSPHSSTHLSGYNVHAEDFRAYGVDEIICISVNDSF 82

Query: 88  VMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
            + AW +K +   V+ +PD +GEFT+++GM+V   + G G RSWRY  LI+D V+E  FV
Sbjct: 83  SLAAWARKEKADRVRFVPDVNGEFTKELGMMVNLSDRGMGQRSWRYSMLIRDQVIEKMFV 142

Query: 148 E-EGFSDNCATDPYEISSPENVLKVIR-ESKK 177
           E +GF       P  +S  E +L  +R E+KK
Sbjct: 143 EPDGFE-----TPPVVSDAETMLNYLRSETKK 169


>gi|297816586|ref|XP_002876176.1| hypothetical protein ARALYDRAFT_485670 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297322014|gb|EFH52435.1| hypothetical protein ARALYDRAFT_485670 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 231

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 98/166 (59%), Gaps = 11/166 (6%)

Query: 4   FQIPQVVFHMRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSD 57
           F    V   + V   LPD + ++        K V    L AGK+  LFA+PGAFTPTCS 
Sbjct: 61  FATTPVTASISVGDKLPDSTLSYLDPSTGDVKTVTVSSLTAGKKTILFAVPGAFTPTCSQ 120

Query: 58  HQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMG 116
             +PGF     +LR +GI+ + C+SVNDAFVM AW K L I + V LL DG+GEFT K+G
Sbjct: 121 KHVPGFVSKAGELRSKGIDVIACISVNDAFVMEAWRKDLGINDEVMLLSDGNGEFTGKLG 180

Query: 117 M-LVYKDN-VGFGLRSWRYGALIKDMVVESWFVEEG--FSDNCATD 158
           + L  +D  VG G+RS RY  L  D VV+   +EEG  F+++ A D
Sbjct: 181 VELDLRDKPVGLGVRSRRYAILADDGVVKVLNLEEGGAFTNSSAED 226


>gi|52851172|emb|CAH58634.1| thioredoxin-dependent peroxidase [Plantago major]
          Length = 162

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 101/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG  ++     Q + V+   L AGK+V LFA+PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVIPDGQLSYFDGEDQLQTVSIHSLAAGKKVILFAVPGAFTPTCSMKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           D+L+ +G++E+ C+SVND FVM AW K   + K+VK L DGS  +T  +G+ +     G 
Sbjct: 64  DELKSKGVDEILCISVNDPFVMKAWAKTYPDNKHVKFLADGSATYTHALGLELDLAEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L++D+ V+   VE G         + +SS E++LK +
Sbjct: 124 GVRSRRFALLVEDLKVKVANVESG-------GEFTVSSAEDILKAL 162


>gi|156095183|ref|XP_001613627.1| peroxiredoxin [Plasmodium vivax SaI-1]
 gi|148802501|gb|EDL43900.1| peroxiredoxin, putative [Plasmodium vivax]
          Length = 237

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 93/150 (62%), Gaps = 1/150 (0%)

Query: 28  WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG-IEEVYCLSVNDA 86
           +K ++T +LF  K++ L +LPGAFTPTC+   +P +E  YD    E   +++YC++ ND 
Sbjct: 87  FKAIDTHELFKNKKILLISLPGAFTPTCTSKMIPQYEDEYDFFIKENKFDDIYCITNNDI 146

Query: 87  FVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           FV+ +W K + IK VK + DG+  FT  M MLV K N   G+R WR+ A++++ ++   F
Sbjct: 147 FVLKSWFKNMNIKKVKYVSDGNSSFTESMNMLVDKSNFFMGMRPWRFVAIVENNILIKMF 206

Query: 147 VEEGFSDNCATDPYEISSPENVLKVIRESK 176
            E+    N   DPYE+SS   V + +R+++
Sbjct: 207 QEKDKQHNMQADPYEVSSVAAVKEFLRQNQ 236


>gi|326497111|dbj|BAK02140.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326525991|dbj|BAJ93172.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 235

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 93/144 (64%), Gaps = 9/144 (6%)

Query: 20  PDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVY 79
           PDG    + K V  +DL AGK+V LFA+PGAFTPTC+   LPGF     +LR +G++ V 
Sbjct: 91  PDG----ELKTVTVRDLTAGKKVVLFAVPGAFTPTCTQKHLPGFVARAGELRAKGVDTVA 146

Query: 80  CLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGM-LVYKDN-VGFGLRSWRYGAL 136
           C+SVNDAFVM AW + L + + V LL DG+GE TR MG+ L   D  VG G+RS RY  L
Sbjct: 147 CVSVNDAFVMRAWKESLGVGDEVLLLSDGNGELTRAMGVELDLSDKPVGLGVRSRRYALL 206

Query: 137 IKDMVVESWFVEEG--FSDNCATD 158
             D VV+   +EEG  F+++ A D
Sbjct: 207 ADDGVVKVLNLEEGGAFTNSSAED 230


>gi|15218876|ref|NP_176772.1| TPX2 (thioredoxin-dependent peroxidase 2); antioxidant/
           oxidoreductase [Arabidopsis thaliana]
 gi|75337580|sp|Q9SRZ4|PRX2C_ARATH RecName: Full=Peroxiredoxin-2C; AltName: Full=Peroxiredoxin IIC;
           AltName: Full=Peroxiredoxin TPx2; AltName:
           Full=Thioredoxin reductase 2C; AltName:
           Full=Thioredoxin-dependent peroxidase 2
 gi|6227021|gb|AAF06057.1|AC009513_13 Identical to gb|AF121356 peroxiredoxin TPx2 from Arabidopsis
           thaliana. ESTs gb|T43900, gb|T76320, gb|H76470,
           gb|T43099, gb|T21501 and gb|T41996 come from this gene
 gi|12083334|gb|AAG48826.1|AF332463_1 putative type 2 peroxiredoxin protein [Arabidopsis thaliana]
 gi|21536698|gb|AAM61030.1| type 2 peroxiredoxin, putative [Arabidopsis thaliana]
 gi|27764988|gb|AAO23615.1| At1g65970 [Arabidopsis thaliana]
 gi|110742929|dbj|BAE99360.1| hypothetical protein [Arabidopsis thaliana]
 gi|332196325|gb|AEE34446.1| peroxiredoxin-2C [Arabidopsis thaliana]
          Length = 162

 Score =  127 bits (319), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 68/166 (40%), Positives = 101/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ +F     Q + V+   + AGK+V LF +PGAFTPTCS   +PGF    
Sbjct: 4   ITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +GI+E+ C SVND FVM AWGK   E K+VK + DGSGE+T  +G+ +   + G 
Sbjct: 64  EELKSKGIDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L+ ++ V    VE G         + +SS E++LK +
Sbjct: 124 GIRSRRFALLLDNLKVTVANVESG-------GEFTVSSAEDILKAL 162


>gi|332304828|ref|YP_004432679.1| Redoxin domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172157|gb|AEE21411.1| Redoxin domain protein [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 157

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 90/144 (62%), Gaps = 12/144 (8%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +PQV F +R         +  +  +  T DLFA K+V LFA+PGAFTPTCS+  LPG+  
Sbjct: 8   LPQVTFSLR---------ENDESSNPTTADLFADKKVVLFAVPGAFTPTCSNAHLPGYIS 58

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + D L  +G+E + CLSVNDAFVM AWG+    ++V +L DG  EFT+ +GM   KD   
Sbjct: 59  LADKLEAQGVERIICLSVNDAFVMQAWGQSQNAEHVTMLADGGAEFTQAIGM--AKDTGT 116

Query: 126 F-GLRSWRYGALIKDMVVESWFVE 148
           F G+RS RY  L+++ VV+   VE
Sbjct: 117 FGGVRSGRYSMLVENGVVKLLNVE 140


>gi|302849676|ref|XP_002956367.1| peroxiredoxin, type II [Volvox carteri f. nagariensis]
 gi|300258273|gb|EFJ42511.1| peroxiredoxin, type II [Volvox carteri f. nagariensis]
          Length = 198

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 104/172 (60%), Gaps = 16/172 (9%)

Query: 7   PQVVFHMRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLP 61
           PQ +    V   LPD    +     Q +DV T++L  GK+V LFA+PGAFTPTCS   +P
Sbjct: 36  PQAI---AVGQKLPDAKFKYFDGEGQMRDVTTEELCKGKKVVLFAVPGAFTPTCSLKHVP 92

Query: 62  GFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVY 120
           GF    D+L+ +G++ + C+SVNDAFVM AWGK L+  + V +L DG+G+FT+ +G+ + 
Sbjct: 93  GFVDKADELKNKGVDTIACVSVNDAFVMAAWGKDLKAGDKVLMLADGNGQFTKALGVELD 152

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
             + G G RS RY   + D VV+   +EEG +       + +SS E++L  +
Sbjct: 153 LIDKGLGTRSRRYSMFVDDQVVKILHLEEGGA-------FTVSSAEDMLAAL 197


>gi|18654477|gb|AAL35363.2|AF442385_1 thioredoxin peroxidase [Capsicum annuum]
          Length = 162

 Score =  127 bits (318), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 99/166 (59%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ ++     Q + V+   L  GK+V +FA+PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVIPDGTVSYFDEQDQLQSVSVHSLAKGKKVIMFAVPGAFTPTCSTKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           D L+ +G+EE+ C+SVND FVM AW K   E K+VK L DG+G++T  +G+ +     G 
Sbjct: 64  DLLKSKGVEEILCVSVNDPFVMKAWAKTFPENKHVKFLADGAGKYTHALGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS RY  L+ D+ V+   VE G         + +S  + +LK +
Sbjct: 124 GVRSRRYALLVDDLKVKVANVESG-------GEFTVSGADEILKAL 162


>gi|221052469|ref|XP_002257810.1| antioxidant protein [Plasmodium knowlesi strain H]
 gi|193807641|emb|CAQ38146.1| antioxidant protein, putative [Plasmodium knowlesi strain H]
          Length = 237

 Score =  127 bits (318), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 88/138 (63%), Gaps = 1/138 (0%)

Query: 28  WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG-IEEVYCLSVNDA 86
           +K ++T +LF  K++ L +LPGAFTPTC+   +P +E  YD    E   +++YC++ ND 
Sbjct: 87  FKAIDTHELFKNKKILLISLPGAFTPTCTSKMIPQYEAEYDFFIKENKFDDIYCITNNDI 146

Query: 87  FVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           FV+ +W K ++IK VK + DG+  FT  M MLV K N   G+R WR+ A++++ ++   F
Sbjct: 147 FVLKSWFKDMKIKKVKYVSDGNSSFTESMNMLVDKSNFFMGMRPWRFVAIVENNILIKMF 206

Query: 147 VEEGFSDNCATDPYEISS 164
            E+    N  TDPYE+SS
Sbjct: 207 QEKDKQHNIQTDPYEVSS 224


>gi|119469102|ref|ZP_01612086.1| Peroxiredoxin, AhpC/Tsa family protein [Alteromonadales bacterium
           TW-7]
 gi|119447354|gb|EAW28622.1| Peroxiredoxin, AhpC/Tsa family protein [Alteromonadales bacterium
           TW-7]
          Length = 157

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 90/143 (62%), Gaps = 10/143 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + +  ++LF GK+V LFA+PGAFTPTCS+  LP F  + D ++ +G++ +YC+SVNDAFV
Sbjct: 22  QTLTNKELFDGKKVVLFAVPGAFTPTCSNAHLPEFITLADKIKAKGVDAIYCVSVNDAFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFV 147
           M AWG     + + +L DG   FT+ +G+   KD  GF G+RS RY  ++ + VV   FV
Sbjct: 82  MKAWGDSQNAEEILMLADGDASFTKALGL--EKDTAGFGGIRSSRYAMIVNNAVVTGLFV 139

Query: 148 EEGFSDNCATDPYEISSPENVLK 170
           EEG         + +S  E+VL+
Sbjct: 140 EEG-------KEFTVSRAEHVLE 155


>gi|159462450|ref|XP_001689455.1| peroxiredoxin, type II [Chlamydomonas reinhardtii]
 gi|158283443|gb|EDP09193.1| peroxiredoxin, type II [Chlamydomonas reinhardtii]
          Length = 194

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 106/173 (61%), Gaps = 15/173 (8%)

Query: 3   RFQIPQVVFHMRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSD 57
           R Q+  V   + V   LP+G   +     Q +DV T +L  GK+V LFA+PGAFTPTCS 
Sbjct: 27  RVQV--VTRAIAVGQKLPEGKFKYFDGEGQMRDVTTDELCKGKKVVLFAVPGAFTPTCSL 84

Query: 58  HQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMG 116
             +PGF    D+ + +G++ + C+SVNDAFVM AWGK L+  + V +L DG+G+FT+ +G
Sbjct: 85  KHVPGFVDKADEFKTKGVDTIACVSVNDAFVMAAWGKDLKAGDKVLMLADGNGQFTKALG 144

Query: 117 MLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
           + +   + G GLRS RY   ++D VV+   +EEG +       + +SS E++L
Sbjct: 145 VELDLVDKGLGLRSRRYSMYVEDGVVKVLHLEEGGA-------FTVSSAEDML 190


>gi|15218877|ref|NP_176773.1| TPX1 (thioredoxin-dependent peroxidase 1); antioxidant/
           oxidoreductase [Arabidopsis thaliana]
 gi|75338536|sp|Q9XEX2|PRX2B_ARATH RecName: Full=Peroxiredoxin-2B; AltName: Full=Peroxiredoxin IIB;
           AltName: Full=Peroxiredoxin TPx1; AltName:
           Full=Thioredoxin reductase 2B; AltName:
           Full=Thioredoxin-dependent peroxidase 1
 gi|4704730|gb|AAD28242.1|AF121355_1 peroxiredoxin TPx1 [Arabidopsis thaliana]
 gi|6227022|gb|AAF06058.1|AC009513_14 Identical to gb|AF121355 peroxiredoxin TPx1 from Arabidopsis
           thaliana. ESTs gb|T43667, gb|T21559, gb|Z17702,
           gb|T46437, gb|T22793, gb|H36300, gb|AA712887, gb|N96902,
           gb|H76959, gb|T45886 and gb|Z17703 come from this gene
 gi|12083336|gb|AAG48827.1|AF332464_1 putative type 2 peroxiredoxin protein [Arabidopsis thaliana]
 gi|18086474|gb|AAL57690.1| At1g65980/F12P19_14 [Arabidopsis thaliana]
 gi|332196326|gb|AEE34447.1| peroxiredoxin-2B [Arabidopsis thaliana]
          Length = 162

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 101/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ +F     Q +  +   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++E+ C SVND FVM AWGK   E K+VK + DGSGE+T  +G+ +   + G 
Sbjct: 64  EELKSKGVDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L+ D+ V    VE G         + +SS +++LK +
Sbjct: 124 GVRSRRFALLLDDLKVTVANVESG-------GEFTVSSADDILKAL 162


>gi|226502632|ref|NP_001148437.1| LOC100282052 [Zea mays]
 gi|195619268|gb|ACG31464.1| peroxiredoxin-5 [Zea mays]
          Length = 233

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/147 (49%), Positives = 94/147 (63%), Gaps = 9/147 (6%)

Query: 17  TVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIE 76
           T  PDG    + K V  +DL AGK+V LFA+PGAFTPTC+   LPGF     +LR +G++
Sbjct: 86  TSSPDG----ELKTVTVRDLTAGKKVVLFAVPGAFTPTCTQKHLPGFVAKAGELRAKGVD 141

Query: 77  EVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGM-LVYKDN-VGFGLRSWRY 133
            V C+SVNDAFVM AW + L I + V LL DG+GE  R MG+ L   D  VG G+RS RY
Sbjct: 142 TVACVSVNDAFVMRAWKESLGIGDEVLLLSDGNGELARAMGVELDLSDKPVGLGVRSRRY 201

Query: 134 GALIKDMVVESWFVEEG--FSDNCATD 158
             L +D VV+   +EEG  F+++ A D
Sbjct: 202 ALLAEDGVVKVINLEEGGAFTNSSAED 228


>gi|90416592|ref|ZP_01224523.1| antioxidant, AhpC/Tsa family protein [marine gamma proteobacterium
           HTCC2207]
 gi|90331791|gb|EAS47019.1| antioxidant, AhpC/Tsa family protein [marine gamma proteobacterium
           HTCC2207]
          Length = 158

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 87/142 (61%), Gaps = 8/142 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+T D+F+GK+V LFA+PGAFTPTCS   LPGF    DD++ +G++ V C+SVND FVM+
Sbjct: 25  VSTADIFSGKKVVLFAVPGAFTPTCSAAHLPGFVVHVDDIKAKGVDTVACMSVNDVFVMH 84

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           AWG+    +++ +L DG+  FT  +G+++     G G RS R+  ++ D VV    V+ G
Sbjct: 85  AWGQSANAEHLMMLADGNATFTEALGLVLDGSGFGMGTRSQRFAMIVDDGVVSLLNVDAG 144

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                     E SS E +L  +
Sbjct: 145 --------ALEASSAEAILAAL 158


>gi|224126457|ref|XP_002319843.1| type II peroxiredoxin [Populus trichocarpa]
 gi|118484088|gb|ABK93929.1| unknown [Populus trichocarpa]
 gi|222858219|gb|EEE95766.1| type II peroxiredoxin [Populus trichocarpa]
          Length = 162

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/164 (40%), Positives = 98/164 (59%), Gaps = 13/164 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  VLPDG  A+     Q +DV+   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVLPDGKLAYFDEQDQLQDVSVHSLAAGKKVILFGVPGAFTPTCSLKHVPGFVEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G+ E+ C+SVND FVM AW K   E K+VK L DGS  +T  +G+ +     G 
Sbjct: 64  EELKSKGVAEILCISVNDPFVMKAWAKTYPENKHVKFLADGSATYTHALGLELDLQEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           G RS R+  L+ D+ V++  +E G         + +SS +++LK
Sbjct: 124 GTRSRRFALLVDDLKVKAANIEGG-------GEFTVSSADDILK 160


>gi|262198298|ref|YP_003269507.1| redoxin [Haliangium ochraceum DSM 14365]
 gi|262081645|gb|ACY17614.1| Redoxin domain protein [Haliangium ochraceum DSM 14365]
          Length = 162

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 88/130 (67%), Gaps = 1/130 (0%)

Query: 25  AFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVN 84
           A   K+++T  LF+GK+V LFA+PGAFTP+CS   LPG+    D+L+ +G++E+ C++VN
Sbjct: 19  AEGLKELSTDTLFSGKKVVLFAVPGAFTPSCSKTHLPGYVNNADELKGKGVDEIVCMAVN 78

Query: 85  DAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVE 143
           D FVM+AW ++   K  V +LPDG+GE T K+G+ +     G G R  R+  L++D V++
Sbjct: 79  DPFVMDAWAEQQSAKGKVTMLPDGNGELTEKLGLGMDGSGAGLGTRCKRFSMLVEDGVIK 138

Query: 144 SWFVEEGFSD 153
           S  VEE  SD
Sbjct: 139 SLDVEEKASD 148


>gi|109896686|ref|YP_659941.1| redoxin [Pseudoalteromonas atlantica T6c]
 gi|109698967|gb|ABG38887.1| Redoxin [Pseudoalteromonas atlantica T6c]
          Length = 159

 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 99/169 (58%), Gaps = 19/169 (11%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P+V F +R         +  +  +  T DLFA K+V LFA+PGAFTPTCS+  LPG+  
Sbjct: 8   LPEVTFSLR---------ENGEASNPTTVDLFADKKVVLFAVPGAFTPTCSNTHLPGYIA 58

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + D L  +G++ + CLSVNDAFVM AWGK    +NV +L DG   F++ +G+   KD   
Sbjct: 59  LADKLAAKGVDSIICLSVNDAFVMEAWGKSQNAENVTMLADGGAAFSQAIGL--AKDTGT 116

Query: 126 F-GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           F GLRS RY  L+++ VV++  +E       A   +E+S  + +L  + 
Sbjct: 117 FGGLRSGRYSMLVENGVVKALNIE-------APGKFEVSDAQTMLAALN 158


>gi|332995095|gb|AEF05150.1| AhpC/Tsa family antioxidant [Alteromonas sp. SN2]
          Length = 157

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/140 (45%), Positives = 92/140 (65%), Gaps = 12/140 (8%)

Query: 33  TQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW 92
           T +LF  KRV +FA+PGAFTPTCS   LPG+  + D ++ +G++ V CLSVNDAFVM+AW
Sbjct: 26  TAELFNDKRVVVFAVPGAFTPTCSQAHLPGYVALADKIKAKGVDTVICLSVNDAFVMDAW 85

Query: 93  GKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           GK    + + +L DG+G FT+++G+ +   + G GLRS RY  L++D VV+   VE    
Sbjct: 86  GKANNAEEIMMLADGNGHFTKQIGLDMNTSDFG-GLRSMRYAMLVEDCVVKKISVE---- 140

Query: 153 DNCATDP--YEISSPENVLK 170
                DP  +E+S  E++LK
Sbjct: 141 -----DPGRFEVSDAESMLK 155


>gi|297841179|ref|XP_002888471.1| thioredoxin-dependent peroxidase 2 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297334312|gb|EFH64730.1| thioredoxin-dependent peroxidase 2 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 162

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 101/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+P+G+ +F     Q + V+   + AGK+V LF +PGAFTPTCS   +PGF    
Sbjct: 4   ITVGDVVPNGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +GI+E+ C SVND FVM AWGK   E K+VK + DGSGE+T  +G+ +   + G 
Sbjct: 64  EELKSKGIDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L+ ++ V    VE G         + +SS E++LK +
Sbjct: 124 GIRSRRFALLLDNLKVTVANVESG-------GEFTVSSAEDILKAL 162


>gi|260778307|ref|ZP_05887200.1| putative antioxidant [Vibrio coralliilyticus ATCC BAA-450]
 gi|260606320|gb|EEX32605.1| putative antioxidant [Vibrio coralliilyticus ATCC BAA-450]
          Length = 157

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 89/141 (63%), Gaps = 8/141 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           NT++LFA KRV LFA+PGAFTPTCS+  LPG+  + +D++ +GI+ + C+SVNDAFVM A
Sbjct: 25  NTEELFANKRVVLFAVPGAFTPTCSEAHLPGYVVLANDIKAKGIDIIACVSVNDAFVMQA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+      + +L DG   FT+ +G+ +     G G+RS RY  +I++ VV    VEE  
Sbjct: 85  WGEVQNATEIMMLADGDASFTKALGLEMDTATFG-GIRSQRYAMVIENGVVTQLNVEE-- 141

Query: 152 SDNCATDPYEISSPENVLKVI 172
                   +E+S  EN+L  +
Sbjct: 142 -----PKQFEVSKAENILATL 157


>gi|88858744|ref|ZP_01133385.1| antioxidant, AhpC/Tsa family protein [Pseudoalteromonas tunicata
           D2]
 gi|88818970|gb|EAR28784.1| antioxidant, AhpC/Tsa family protein [Pseudoalteromonas tunicata
           D2]
          Length = 157

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 86/141 (60%), Gaps = 8/141 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
            T DLFAGK+V +FALPGAFTPTCS   LPG+  + D+L+ +G++ + CLSVNDAFVM A
Sbjct: 25  TTADLFAGKKVVMFALPGAFTPTCSAAHLPGYVVLADELKAKGVDSIICLSVNDAFVMKA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+    + + +L DG   F++ +G+       G G R+ RY  ++ D VV    VEEG 
Sbjct: 85  WGQSQNAEQLIMLADGDASFSQALGLAQETGAFG-GTRALRYAMIVDDGVVSYLAVEEG- 142

Query: 152 SDNCATDPYEISSPENVLKVI 172
                   +E+S  E++L  I
Sbjct: 143 ------KEFEVSKAEHILAQI 157


>gi|71281610|ref|YP_266909.1| anti-oxidant AhpCTSA family protein [Colwellia psychrerythraea 34H]
 gi|71147350|gb|AAZ27823.1| antioxidant, AhpC/Tsa family [Colwellia psychrerythraea 34H]
          Length = 157

 Score =  125 bits (314), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 88/138 (63%), Gaps = 8/138 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           NT +LFA K+V LFA+PGAFTPTCS   LPG+    D+L+ +G++ + CLSVNDAFVMNA
Sbjct: 25  NTAELFAAKKVVLFAVPGAFTPTCSAAHLPGYVVSADELKAKGVDAIICLSVNDAFVMNA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+    +N+ +L DG G +T+ +G+ +     G G+RS RY  +I +  V S  VEE  
Sbjct: 85  WGESQNAENIMMLADGDGSYTKALGLSMDTATFG-GVRSQRYAMIIDNGEVISLHVEEPK 143

Query: 152 SDNCATDPYEISSPENVL 169
           S       +E+S  E +L
Sbjct: 144 S-------FEVSKAEVIL 154


>gi|66360171|pdb|1TP9|A Chain A, Prx D (Type Ii) From Populus Tremula
 gi|66360172|pdb|1TP9|B Chain B, Prx D (Type Ii) From Populus Tremula
 gi|66360173|pdb|1TP9|C Chain C, Prx D (Type Ii) From Populus Tremula
 gi|66360174|pdb|1TP9|D Chain D, Prx D (Type Ii) From Populus Tremula
 gi|19548660|gb|AAL90751.1| peroxiredoxin [Populus tremula x Populus tremuloides]
          Length = 162

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 67/164 (40%), Positives = 97/164 (59%), Gaps = 13/164 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  VLPDG  A+     Q ++V+   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVLPDGKLAYFDEQDQLQEVSVHSLVAGKKVILFGVPGAFTPTCSLKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            +L+ +G+ E+ C+SVND FVM AW K   E K+VK L DGS  +T  +G+ +     G 
Sbjct: 64  GELKSKGVTEILCISVNDPFVMKAWAKSYPENKHVKFLADGSATYTHALGLELDLQEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           G RS R+  L+ D+ V++  +E G         + +SS E++LK
Sbjct: 124 GTRSRRFALLVDDLKVKAANIEGG-------GEFTVSSAEDILK 160


>gi|289664140|ref|ZP_06485721.1| peroxiredoxin [Xanthomonas campestris pv. vasculorum NCPPB702]
 gi|289667509|ref|ZP_06488584.1| peroxiredoxin [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 160

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/147 (47%), Positives = 91/147 (61%), Gaps = 14/147 (9%)

Query: 5   QIPQVVF-HMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGF 63
           +IP+VV   MR      DG +A     V+T  LFAG++V LFA+PGAFTPTCS   LPG+
Sbjct: 8   RIPEVVLKRMR------DGIEA-----VDTHTLFAGRKVLLFAVPGAFTPTCSAKHLPGY 56

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKD 122
            + +D+ R  GI EV C +VND FVM AWG+   I + + LLPDG+ E  R +G+ +   
Sbjct: 57  VEHFDEFRKRGI-EVLCTAVNDPFVMQAWGRSQLIPDGLHLLPDGNAELARALGLEIDAS 115

Query: 123 NVGFGLRSWRYGALIKDMVVESWFVEE 149
             G GLRS RY     D VV++ FVEE
Sbjct: 116 GSGMGLRSRRYALYADDAVVKALFVEE 142


>gi|119367465|gb|ABL67649.1| putative thioredoxin-dependent peroxidase [Citrus hybrid cultivar]
          Length = 162

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 99/166 (59%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   LPDG+ A+     Q + V+   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDPLPDGTLAYFDEQDQLQQVSVHSLAAGKKVILFGVPGAFTPTCSLKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           D+L  +G++E+ C+SVND FVM AW K   E K++K L DGS ++T  +G+ +     G 
Sbjct: 64  DELNSKGVDEILCISVNDPFVMKAWAKTFPENKSMKFLADGSAKYTHALGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G RS R+  L+ D+ V++  VE G         + +SS +++LK +
Sbjct: 124 GTRSRRFALLVDDLKVKAANVESGGD-------FTVSSADDILKAL 162


>gi|332139568|ref|YP_004425306.1| antioxidant, AhpC/Tsa family protein [Alteromonas macleodii str.
           'Deep ecotype']
 gi|327549590|gb|AEA96308.1| antioxidant, AhpC/Tsa family protein [Alteromonas macleodii str.
           'Deep ecotype']
          Length = 157

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 93/144 (64%), Gaps = 10/144 (6%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P+V F + V     DG    +  +  T +LF+ KRV LFA+PGAFTPTCS   LPG+  
Sbjct: 8   LPEVDFGLLV-----DG----EMTNPGTNELFSDKRVVLFAVPGAFTPTCSQAHLPGYVA 58

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
           + D ++ +GI+ + CLSVNDAFVM+AWGK    + + +L DG+G FT+++G+ +   N G
Sbjct: 59  LADKIKAKGIDSIICLSVNDAFVMDAWGKANNAEEIIMLADGNGHFTKQIGLDMNTSNFG 118

Query: 126 FGLRSWRYGALIKDMVVESWFVEE 149
            GLRS RY  LI+D  V+   VE+
Sbjct: 119 -GLRSLRYSMLIEDGEVKKINVED 141


>gi|242064344|ref|XP_002453461.1| hypothetical protein SORBIDRAFT_04g006270 [Sorghum bicolor]
 gi|241933292|gb|EES06437.1| hypothetical protein SORBIDRAFT_04g006270 [Sorghum bicolor]
          Length = 231

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 103/173 (59%), Gaps = 16/173 (9%)

Query: 9   VVFHMRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG 62
           VV  + V   LPD + ++      + K V   +L AGK+  LFA+PGAFTPTCS   LPG
Sbjct: 65  VVATIAVGDKLPDATLSYFDPSDGELKTVTVAELTAGKKAILFAVPGAFTPTCSQKHLPG 124

Query: 63  FEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMG--MLV 119
           F +   +L+ +G+E V C+SVNDAFVM AW + L + ++V LL DG+ E TR +G  M +
Sbjct: 125 FVEKAGELKAKGVETVACVSVNDAFVMKAWKEALGLGEDVTLLSDGNLELTRALGVEMDL 184

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
               VG G+RS RY  L +D VV+   +E+G +       +  SS E +LKV+
Sbjct: 185 SDKPVGLGVRSRRYALLAEDGVVKVLNLEDGGA-------FTTSSAEEMLKVL 230


>gi|134294653|ref|YP_001118388.1| redoxin domain-containing protein [Burkholderia vietnamiensis G4]
 gi|134137810|gb|ABO53553.1| Redoxin domain protein [Burkholderia vietnamiensis G4]
          Length = 168

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 100/174 (57%), Gaps = 21/174 (12%)

Query: 13  MRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++V   LPD ++ F++ D            V+ ++  AGKRV +F LPGAFTPTCS   +
Sbjct: 2   IQVGEALPD-AQLFEYVDDAREGCTLGPNAVSVREQVAGKRVVIFGLPGAFTPTCSAQHV 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
           PG+ +  + LR  GI+E++C+SVNDAFVM AWG+ L     V+++ DGS  FT  +G+  
Sbjct: 61  PGYVEHAEQLRAAGIDELWCVSVNDAFVMGAWGRDLHTAGKVRMIADGSAAFTHALGLTQ 120

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
                G G+RS RY  ++ D VV++  VE       A   +E+S   +VL  +R
Sbjct: 121 DLSARGMGIRSLRYAMVVDDGVVKTLAVE-------APGKFEVSDAASVLATLR 167


>gi|118484484|gb|ABK94117.1| unknown [Populus trichocarpa]
          Length = 162

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 97/164 (59%), Gaps = 13/164 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  VLPDG  A+     Q ++V+   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVLPDGKLAYFDEQDQLQEVSVHSLVAGKKVILFGVPGAFTPTCSLKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            +L+ +G+ E+ C+SVND FVM AW K   E K+VK L DGS  +T  +G+ +     G 
Sbjct: 64  GELKSKGVTEILCISVNDPFVMKAWAKSYPENKHVKFLADGSATYTHALGLELNLQEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           G RS R+  L+ D+ V++  +E G         + +SS +++LK
Sbjct: 124 GTRSRRFALLVDDLKVKAANIEGG-------GEFTVSSADDILK 160


>gi|323492873|ref|ZP_08098015.1| antioxidant putative [Vibrio brasiliensis LMG 20546]
 gi|323312944|gb|EGA66066.1| antioxidant putative [Vibrio brasiliensis LMG 20546]
          Length = 158

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 89/143 (62%), Gaps = 10/143 (6%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           NT +LFA KRV LFA+PGAFTPTCS+  LPG+  + D+++  G++ + C+SVNDAFVMNA
Sbjct: 25  NTDELFANKRVVLFAVPGAFTPTCSEAHLPGYVVLADEIKAAGVDIIACVSVNDAFVMNA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   FT+ +G+ +  D  GF G+RS RY  ++ + VV    +EE 
Sbjct: 85  WGEAQNASEILMLGDGDASFTKALGLEM--DTAGFGGVRSKRYAMVVDNGVVTELNIEE- 141

Query: 151 FSDNCATDPYEISSPENVLKVIR 173
                    +E+S  E +L  +R
Sbjct: 142 ------PKQFEVSKAEAILAALR 158


>gi|4704732|gb|AAD28243.1|AF121356_1 peroxiredoxin TPx2 [Arabidopsis thaliana]
          Length = 162

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 100/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ +F     Q + V+   + AGK+V LF +PGAFTPTCS   +PGF    
Sbjct: 4   ITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +GI+E+ C SVND FVM AWGK   E K+VK + DGSGE+T  +G+ +   + G 
Sbjct: 64  EELKSKGIDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGS 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+ S R+  L+ ++ V    VE G         + +SS E++LK +
Sbjct: 124 GISSGRFALLLDNLKVTVANVESG-------GEFTVSSAEDILKAL 162


>gi|325518022|gb|EGC97830.1| redoxin domain-containing protein [Burkholderia sp. TJI49]
          Length = 168

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 87/142 (61%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + +D  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  SVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRSAGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VLK +
Sbjct: 150 -----APGKFEVSDAASVLKTL 166


>gi|21553913|gb|AAM62996.1| peroxiredoxin, putative [Arabidopsis thaliana]
          Length = 162

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 100/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ +F     Q + V+   + AGK+V LF +PGAFTPTCS   +PGF    
Sbjct: 4   ITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKK-LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ + I+E+ C SVND FVM AWGK   E K+VK + DGSGE+T  +G+ +   + G 
Sbjct: 64  EELKSKVIDEIICFSVNDPFVMKAWGKTYTENKHVKFVADGSGEYTHLLGLELDLKDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L+ ++ V    VE G         + +SS E++LK +
Sbjct: 124 GIRSRRFALLLDNLKVTVANVENG-------GEFTVSSAEDILKAL 162


>gi|115469028|ref|NP_001058113.1| Os06g0625500 [Oryza sativa Japonica Group]
 gi|75119143|sp|Q69TY4|PR2E1_ORYSJ RecName: Full=Peroxiredoxin-2E-1, chloroplastic; AltName:
           Full=Peroxiredoxin IIE-1; AltName: Full=Thioredoxin
           reductase 2E-1; Flags: Precursor
 gi|51091051|dbj|BAD35693.1| putative thioredoxin peroxidase 1 [Oryza sativa Japonica Group]
 gi|51535721|dbj|BAD37738.1| putative thioredoxin peroxidase 1 [Oryza sativa Japonica Group]
 gi|113596153|dbj|BAF20027.1| Os06g0625500 [Oryza sativa Japonica Group]
 gi|125556133|gb|EAZ01739.1| hypothetical protein OsI_23767 [Oryza sativa Indica Group]
 gi|215679011|dbj|BAG96441.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215765004|dbj|BAG86701.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 232

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 95/156 (60%), Gaps = 14/156 (8%)

Query: 20  PDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVY 79
           PDG    + K V  +DL AGK+V LFA+PGAFTPTC+   +PGF     +LR +G++ V 
Sbjct: 88  PDG----ELKTVTVRDLTAGKKVVLFAVPGAFTPTCTQKHVPGFVAKAGELRAKGVDAVA 143

Query: 80  CLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGM-LVYKDN-VGFGLRSWRYGAL 136
           C+SVNDAFVM AW + L + + V LL DG+GE  R MG+ L   D   G G+RS RY  L
Sbjct: 144 CVSVNDAFVMRAWKESLGVGDEVLLLSDGNGELARAMGVELDLSDKPAGLGVRSRRYALL 203

Query: 137 IKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            +D VV+   +EEG +       +  SS E +LK +
Sbjct: 204 AEDGVVKVLNLEEGGA-------FTTSSAEEMLKAL 232


>gi|125597912|gb|EAZ37692.1| hypothetical protein OsJ_22032 [Oryza sativa Japonica Group]
          Length = 232

 Score =  124 bits (310), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 95/156 (60%), Gaps = 14/156 (8%)

Query: 20  PDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVY 79
           PDG    + K V  +DL AGK+V LFA+PGAFTPTC+   +PGF     +LR +G++ V 
Sbjct: 88  PDG----KLKTVTVRDLTAGKKVVLFAVPGAFTPTCTQKHVPGFVAKAGELRAKGVDAVA 143

Query: 80  CLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGM-LVYKDN-VGFGLRSWRYGAL 136
           C+SVNDAFVM AW + L + + V LL DG+GE  R MG+ L   D   G G+RS RY  L
Sbjct: 144 CVSVNDAFVMRAWKESLGVGDEVLLLSDGNGELARAMGVELDLSDKPAGLGVRSRRYALL 203

Query: 137 IKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            +D VV+   +EEG +       +  SS E +LK +
Sbjct: 204 AEDGVVKVLNLEEGGA-------FTTSSAEEMLKAL 232


>gi|224143583|ref|XP_002325005.1| type II peroxiredoxin [Populus trichocarpa]
 gi|222866439|gb|EEF03570.1| type II peroxiredoxin [Populus trichocarpa]
          Length = 162

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 97/164 (59%), Gaps = 13/164 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  VLPDG  A+     Q ++V+   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVLPDGKLAYFDEQDQLQEVSVHSLVAGKKVILFGVPGAFTPTCSLKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            +L+ +G+ E+ C+SVND FVM AW K   E K+VK L DGS  +T  +G+ +     G 
Sbjct: 64  GELKSKGVTEILCISVNDPFVMKAWAKSYPENKHVKFLADGSATYTHALGLELDLQEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           G RS R+  L+ D+ V++  +E G         + +SS +++LK
Sbjct: 124 GTRSRRFALLVDDLKVKAANIEGG-------GEFTVSSADDILK 160


>gi|295687740|ref|YP_003591433.1| Redoxin domain-containing protein [Caulobacter segnis ATCC 21756]
 gi|295429643|gb|ADG08815.1| Redoxin domain protein [Caulobacter segnis ATCC 21756]
          Length = 160

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 86/141 (60%), Gaps = 8/141 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++T D+F GK V LFA+PGAFTPTCS   LPGF+    DL+ +G++ + C+SVND FVM 
Sbjct: 25  ISTDDIFKGKTVALFAVPGAFTPTCSAKHLPGFKDHAADLKAKGVDTIACVSVNDVFVMK 84

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWGK   I   V LL DG+G+FTR +G+       G G RS RY  + KD VV    VEE
Sbjct: 85  AWGKDQGIDGEVLLLADGNGDFTRAIGLDFDGSKFGMGARSQRYSLIAKDSVVTQLNVEE 144

Query: 150 GFSDNCATDPYEISSPENVLK 170
                     +++SS E +L+
Sbjct: 145 -------AGQFKVSSAEYLLE 158


>gi|87120723|ref|ZP_01076616.1| antioxidant, AhpC/Tsa family protein [Marinomonas sp. MED121]
 gi|86163951|gb|EAQ65223.1| antioxidant, AhpC/Tsa family protein [Marinomonas sp. MED121]
          Length = 159

 Score =  123 bits (309), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 89/142 (62%), Gaps = 7/142 (4%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K +   + F+ K+V +FALPGAFTPTCS   +PGF   +D+L+ +G++EV CLSVNDAFV
Sbjct: 23  KTIQVAEFFSNKKVVMFALPGAFTPTCSASHVPGFVVSFDELKEKGVDEVVCLSVNDAFV 82

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           M+AWG+    +N+ +  DG  EFT  MG+ +   +  FG+RS RY  L+ + VV   + E
Sbjct: 83  MHAWGEAQNAENLVMAADGMAEFTLAMGLELDLSSAKFGMRSSRYAMLVDNGVVTQLWRE 142

Query: 149 EGFSDNCATDPYEISSPENVLK 170
           E          +++SS E+VL 
Sbjct: 143 E-------PGEFKVSSAEHVLS 157


>gi|297841181|ref|XP_002888472.1| thioredoxin-dependent peroxidase 1 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297334313|gb|EFH64731.1| thioredoxin-dependent peroxidase 1 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 162

 Score =  123 bits (309), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 101/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ +F     Q +  +   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   ITVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++++ C SVND FVM AWGK   E K+VK + DGSGE+T  +G+ +   + G 
Sbjct: 64  EELKSKGVDDIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L+ ++ V    VE G         + +SS +++LK +
Sbjct: 124 GVRSRRFALLLDNLKVTVANVESG-------GEFTVSSADDILKAL 162


>gi|21241904|ref|NP_641486.1| peroxiredoxin [Xanthomonas axonopodis pv. citri str. 306]
 gi|294624330|ref|ZP_06703031.1| peroxiredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|294665751|ref|ZP_06731024.1| peroxiredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|21107291|gb|AAM36022.1| peroxiredoxin [Xanthomonas axonopodis pv. citri str. 306]
 gi|292601376|gb|EFF45412.1| peroxiredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292604487|gb|EFF47865.1| peroxiredoxin [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 160

 Score =  123 bits (309), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/146 (46%), Positives = 89/146 (60%), Gaps = 12/146 (8%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP+VV        L DG +A     V+T  LFAG++V LFA+PGAFTPTCS   LPG+ 
Sbjct: 8   RIPEVVLKR-----LRDGIEA-----VDTHSLFAGRKVLLFAVPGAFTPTCSAKHLPGYV 57

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           + ++  R  GI EV C +VND FVM AWG+   I + + LLPDG+ E  R +G+ +    
Sbjct: 58  EHFEQFRKRGI-EVLCTAVNDPFVMQAWGRSQLIPDGLHLLPDGNAELARALGLEIDASG 116

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G GLRS RY     D VV++ FVEE
Sbjct: 117 SGMGLRSRRYALYADDAVVKALFVEE 142


>gi|326501648|dbj|BAK02613.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 162

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/164 (40%), Positives = 94/164 (57%), Gaps = 13/164 (7%)

Query: 15  VATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           V + LPDG   +     Q + V+   L AGK+V LF +PGAFTPTCS+  +PGF    +D
Sbjct: 6   VGSTLPDGQLGWFDENDQLQQVSIHSLAAGKKVILFGVPGAFTPTCSNQHVPGFITQAED 65

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
           L+ +G+EE+  +SVND FVM AW K   E K+VK L DG+  +T+ +G+ +     G GL
Sbjct: 66  LKAKGVEEILLVSVNDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELDLTEKGLGL 125

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           RS R+  L  D+ V    +EEG         + IS  E +LK +
Sbjct: 126 RSKRFALLADDLKVTVANIEEG-------GQFTISGAEEILKAL 162


>gi|189094613|emb|CAQ56034.1| peroxiredoxin [Pisum sativum]
          Length = 162

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 103/166 (62%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   +PDG+ A+     + + V+   L AGK+V +F +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDAIPDGTLAYLDEENKPQSVSIHSLSAGKKVIIFGVPGAFTPTCSLKHVPGFIERA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++E+ C+SVND FV+N+W K   E K+VK L DGS ++T  +G+ +   + G 
Sbjct: 64  EELKGKGVDEIICISVNDPFVLNSWAKTFPENKHVKFLADGSAKYTHALGLELDLTDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L++D+ V+   VE G         + ISS E++LK +
Sbjct: 124 GIRSRRFALLVEDLKVKVANVEGG-------GEFTISSAEDILKAL 162


>gi|239995994|ref|ZP_04716518.1| antioxidant, AhpC/Tsa family protein [Alteromonas macleodii ATCC
           27126]
          Length = 157

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 82/117 (70%), Gaps = 1/117 (0%)

Query: 33  TQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW 92
           T +LF+ KRV LFA+PGAFTPTCS   LPG+  + D L+ +GI+ + CLSVNDAFVM+AW
Sbjct: 26  TNELFSDKRVVLFAVPGAFTPTCSQAHLPGYVALADKLKAKGIDSIICLSVNDAFVMDAW 85

Query: 93  GKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           GK    + + +L DG+G FT+++G+ +   N G GLRS RY  L++D  V+   VE+
Sbjct: 86  GKASNAEEIIMLADGNGFFTKQIGLDMSTGNFG-GLRSLRYSMLVEDGEVKKLNVED 141


>gi|211906454|gb|ACJ11720.1| peroxiredoxin [Gossypium hirsutum]
          Length = 162

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 100/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  VLPDG+ ++     + + V+   L AGK+V +F +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVLPDGTLSYFDADDKLQQVSVHSLAAGKKVIIFGVPGAFTPTCSLKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            +L+ +G++E+ C+SVND FVM AW K   E K+VK L DGS  +T  +G+ +   + G 
Sbjct: 64  GELKSKGVDEIICISVNDPFVMKAWAKTYPENKDVKFLADGSATYTHALGLELNLGDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G RS R+  L+ D+ V++  VE G         + +SS +++LK +
Sbjct: 124 GTRSRRFALLVDDLKVKAANVESG-------GEFTVSSADDILKAL 162


>gi|325925280|ref|ZP_08186683.1| peroxiredoxin [Xanthomonas perforans 91-118]
 gi|325544271|gb|EGD15651.1| peroxiredoxin [Xanthomonas perforans 91-118]
          Length = 160

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/146 (45%), Positives = 89/146 (60%), Gaps = 12/146 (8%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           +IP+VV        L DG +A     ++T  LFAG++V LFA+PGAFTPTCS   LPG+ 
Sbjct: 8   RIPEVVLKR-----LRDGIEA-----IDTHSLFAGRKVLLFAVPGAFTPTCSAKHLPGYV 57

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           + ++  R  GI EV C +VND FVM AWG+   I + + LLPDG+ E  R +G+ +    
Sbjct: 58  EHFEQFRKRGI-EVLCTAVNDPFVMQAWGRSQLIPDGLHLLPDGNAELARALGLEIDASG 116

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G GLRS RY     D VV++ FVEE
Sbjct: 117 SGMGLRSRRYALYADDAVVKALFVEE 142


>gi|27367181|ref|NP_762708.1| antioxidant [Vibrio vulnificus CMCP6]
 gi|37676896|ref|NP_937292.1| peroxiredoxin [Vibrio vulnificus YJ016]
 gi|320158988|ref|YP_004191366.1| antioxidant [Vibrio vulnificus MO6-24/O]
 gi|27358749|gb|AAO07698.1| Antioxidant, putative [Vibrio vulnificus CMCP6]
 gi|37201440|dbj|BAC97262.1| peroxiredoxin [Vibrio vulnificus YJ016]
 gi|319934300|gb|ADV89163.1| antioxidant, putative [Vibrio vulnificus MO6-24/O]
          Length = 157

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 88/139 (63%), Gaps = 10/139 (7%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           +LFAGK+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C+SVNDAFVM AWG+
Sbjct: 28  ELFAGKKVVLFAVPGAFTPTCSEAHLPGYIVLADQLKAKGVDLIACVSVNDAFVMKAWGE 87

Query: 95  KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEGFSD 153
               + + +L DG   FT+ +G+    D  GF GLRS RY  +I + VV +  VE     
Sbjct: 88  AQNAEEILMLADGDASFTKALGL--EMDTAGFGGLRSQRYAMIIDNGVVTTLNVE----- 140

Query: 154 NCATDPYEISSPENVLKVI 172
             A   +E+S+ E +L  +
Sbjct: 141 --APKSFEVSNAETILAAL 157


>gi|296283892|ref|ZP_06861890.1| AhpC/TSA family protein [Citromicrobium bathyomarinum JL354]
          Length = 159

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 57/119 (47%), Positives = 81/119 (68%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V++++ FAG++V LFA+PGAFTPTCS   LPGF +  D+L+ +GI+E+ C+SVNDAFVM 
Sbjct: 25  VDSREYFAGRKVALFAVPGAFTPTCSAKHLPGFAEKADELKAKGIDEIACISVNDAFVMG 84

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW K    K+V +L DG+G+F   +G+ +   + G G RS RY  L+ D  V    VE+
Sbjct: 85  AWQKADGSKDVTMLADGNGDFAEAVGLTMDGSSFGMGQRSQRYSMLVDDGQVRKLNVEK 143


>gi|332524563|ref|ZP_08400767.1| redoxin domain-containing protein [Rubrivivax benzoatilyticus JA2]
 gi|332107876|gb|EGJ09100.1| redoxin domain-containing protein [Rubrivivax benzoatilyticus JA2]
          Length = 169

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 91/145 (62%), Gaps = 8/145 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+ +   AG+ + +F LPGAFTPTCS+  +PG+ +   +LR  G++EV+C+SVNDAFVM 
Sbjct: 31  VDVRAAAAGRTIVVFGLPGAFTPTCSERHVPGYVEKAAELRAAGVDEVWCVSVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWG++L  +  V+++ DG+G+F R  G+ +     G GLRS RY  L+ D +V S  VE 
Sbjct: 91  AWGRQLGARGAVRMMGDGNGDFARAAGLTLDLTARGMGLRSARYAMLVVDGIVRSLDVE- 149

Query: 150 GFSDNCATDPYEISSPENVLKVIRE 174
                 A   +E SS E +L+ +R 
Sbjct: 150 ------APGKFEASSAEAMLQRVRS 168


>gi|254253329|ref|ZP_04946647.1| Peroxiredoxin [Burkholderia dolosa AUO158]
 gi|124895938|gb|EAY69818.1| Peroxiredoxin [Burkholderia dolosa AUO158]
          Length = 213

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 103/183 (56%), Gaps = 24/183 (13%)

Query: 3   RFQIPQVVFHMRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGA 50
           R++ P ++   +V   LPD ++ F++ D               +D  AGKRV +F LPGA
Sbjct: 40  RYEGPAMI---QVGDALPD-AQLFEFVDDARAGCTPGPNAFGVRDQVAGKRVVIFGLPGA 95

Query: 51  FTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSG 109
           FTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM AWG+ L     V+++ DGS 
Sbjct: 96  FTPTCSAQHVPGYVEHAERLRSAGIDEIWCVSVNDAFVMGAWGRDLHTAGKVRMIADGSA 155

Query: 110 EFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            FT  +G+       G G+RS RY  ++ D VV++  VE       A   +E+S   +VL
Sbjct: 156 AFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVE-------APGKFEVSDAASVL 208

Query: 170 KVI 172
           K +
Sbjct: 209 KTL 211


>gi|145588361|ref|YP_001154958.1| redoxin domain-containing protein [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|145046767|gb|ABP33394.1| Redoxin domain protein [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 166

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 98/150 (65%), Gaps = 13/150 (8%)

Query: 22  GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCL 81
           G  AF+      + L AGK++ +FALPGAFTPTCS   +PG+ + YD+++ +G++E++C+
Sbjct: 27  GPNAFE-----VEKLAAGKKIVIFALPGAFTPTCSAKHVPGYVEHYDEIKAKGVDEIWCI 81

Query: 82  SVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
           SVND FVM AWG+  ++ K +++L DGS EFT+KMG+ +     G G+RS RY  +++D 
Sbjct: 82  SVNDPFVMGAWGRDQKVGKKIRMLGDGSCEFTKKMGLELDLVARGLGVRSDRYAMIVEDG 141

Query: 141 VVESWFVEEGFSDNCATDPYEISSPENVLK 170
           V+++        D  A   +E+S   ++LK
Sbjct: 142 VIKTL-------DREAPGKFEVSDAASILK 164


>gi|167997561|ref|XP_001751487.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162697468|gb|EDQ83804.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 396

 Score =  122 bits (307), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/181 (40%), Positives = 99/181 (54%), Gaps = 21/181 (11%)

Query: 10  VFHMRVATVLPDGSK----AFQWKD-------VNTQDLFAGKRVFLFALPGAFTPTCSDH 58
            F  R AT + +GSK       + D       V   DL   K+V LFA+PGAFTPTCS  
Sbjct: 144 TFGSRAATTIAEGSKLPDAELSYFDKEGNVNIVKVSDLMRAKKVVLFAVPGAFTPTCSTQ 203

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGM 117
            LPGF    D LR  G + + C+SVNDAFVM AWG+   + ++V LL DG G+FT  MG 
Sbjct: 204 HLPGFVAKADKLRKAGADLLACVSVNDAFVMRAWGENQNVGESVLLLSDGLGKFTHAMGA 263

Query: 118 LVYKDN--VGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES 175
            V   +  VG G+RS RY  L+ D VV++  +EEG         +  S  +++LK + + 
Sbjct: 264 SVDLSDKPVGLGVRSRRYAMLVDDGVVKTLHMEEG-------GAFTSSGADDILKALLKR 316

Query: 176 K 176
           K
Sbjct: 317 K 317


>gi|116781285|gb|ABK22037.1| unknown [Picea sitchensis]
          Length = 239

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 105/178 (58%), Gaps = 20/178 (11%)

Query: 8   QVVFHMRVATV-----LPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSD 57
               H   AT+     LP+ + ++     + + +   +L  GK+V L A+PGAFTPTCS 
Sbjct: 69  STTLHTVRATISVGDKLPEATLSYFDKEGEIQTIKVSELTKGKKVVLLAVPGAFTPTCSQ 128

Query: 58  HQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMG 116
             LPGF +  D+L+ +G++ + C+SVNDAFVM AWG+ L + + V LL DG  EFT+ +G
Sbjct: 129 KHLPGFVEKADELKAKGVDTIACVSVNDAFVMRAWGENLNVGDKVLLLADGIQEFTKALG 188

Query: 117 MLVYKDN--VGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           + +   +  VG G+RS RY  L +D VV+   +EEG +       + +SS E++LK +
Sbjct: 189 VTLDLSDKPVGLGVRSRRYALLAEDGVVKVLNLEEGGA-------FTVSSAEDILKAL 239


>gi|260773833|ref|ZP_05882748.1| antioxidant AhpC/Tsa family [Vibrio metschnikovii CIP 69.14]
 gi|260610794|gb|EEX35998.1| antioxidant AhpC/Tsa family [Vibrio metschnikovii CIP 69.14]
          Length = 157

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 88/142 (61%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N Q+LFAGK+V LFA+PGAFTPTCS+  LPG+    D  + +G++ + C++VNDAFVM A
Sbjct: 25  NVQELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVHADTFKAKGVDLIACVAVNDAFVMKA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   FT+ +G+ +  D  GF G+RS RY  +I+D VV +  VEE 
Sbjct: 85  WGEAQNASELLMLADGDASFTKALGLEM--DTAGFGGIRSQRYAMIIEDGVVTTLNVEEA 142

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                    +E S  E +L ++
Sbjct: 143 -------KTFEASKAETLLTLL 157


>gi|325917818|ref|ZP_08180000.1| peroxiredoxin [Xanthomonas vesicatoria ATCC 35937]
 gi|325535992|gb|EGD07806.1| peroxiredoxin [Xanthomonas vesicatoria ATCC 35937]
          Length = 160

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 69/147 (46%), Positives = 90/147 (61%), Gaps = 14/147 (9%)

Query: 5   QIPQVVF-HMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGF 63
            IP+VV   MR      DG +A     V+T  LFAG++V LFA+PGAFTPTCS   LPG+
Sbjct: 8   SIPEVVLKRMR------DGIEA-----VDTHSLFAGRKVLLFAVPGAFTPTCSAKHLPGY 56

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK-KLEIKNVKLLPDGSGEFTRKMGMLVYKD 122
            + +++ R  GI EV C +VND FVM AWG+ +L    + LLPDG+ E  R +G+ +   
Sbjct: 57  VEHFEEFRKRGI-EVLCTAVNDPFVMQAWGRSQLVPDGLHLLPDGNAELVRALGLEIDAS 115

Query: 123 NVGFGLRSWRYGALIKDMVVESWFVEE 149
             G GLRS RY     D VV++ FVEE
Sbjct: 116 GSGMGLRSRRYALYADDGVVKALFVEE 142


>gi|90578646|ref|ZP_01234456.1| putative antioxidant [Vibrio angustum S14]
 gi|90439479|gb|EAS64660.1| putative antioxidant [Vibrio angustum S14]
          Length = 158

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 88/142 (61%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +T +LFA KRV LFA+PGAFTPTCS+  LPG+  + D+++  G++ + C+SVNDAFVM A
Sbjct: 25  DTAELFANKRVVLFAVPGAFTPTCSEAHLPGYVVLADEIKATGVDIIACVSVNDAFVMQA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+      + +L DG G FT+ +G+ +  +N G G+RS RY  ++ + VV    VEE  
Sbjct: 85  WGEAQNASEIMMLGDGDGSFTKALGLEMDTENFG-GIRSQRYAMVVDNGVVTQLNVEE-- 141

Query: 152 SDNCATDPYEISSPENVLKVIR 173
                   +E S  E +L  ++
Sbjct: 142 -----PKQFEASKAETILASLK 158


>gi|119504215|ref|ZP_01626295.1| AhpC/TSA family protein [marine gamma proteobacterium HTCC2080]
 gi|119459723|gb|EAW40818.1| AhpC/TSA family protein [marine gamma proteobacterium HTCC2080]
          Length = 159

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 83/140 (59%), Gaps = 7/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+T +LF GK+V LFA+PGAFTP CS   LPG+    D ++  GI+ + CLSVNDAFVM 
Sbjct: 25  VSTSELFDGKKVLLFAVPGAFTPGCSMTHLPGYVAHADQIKAAGIDSIICLSVNDAFVMG 84

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           AWG+     ++ +L DG+GE T K+G+ +     G G RS RY  ++ +  V    +EEG
Sbjct: 85  AWGQAHNADHITMLADGNGELTGKLGLELDGSGFGLGTRSQRYAMVVDNGTVTHLNIEEG 144

Query: 151 FSDNCATDPYEISSPENVLK 170
                     ++SS E +L 
Sbjct: 145 PG-------VDVSSAETMLA 157


>gi|254507065|ref|ZP_05119203.1| peroxiredoxin-2E-2 [Vibrio parahaemolyticus 16]
 gi|219550060|gb|EED27047.1| peroxiredoxin-2E-2 [Vibrio parahaemolyticus 16]
          Length = 138

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           NT +LFA KR  LFA+PGAFTPTCS+  LPG+  + D+++  G++ + C+SVNDAFVM A
Sbjct: 5   NTDELFANKRAVLFAVPGAFTPTCSEAHLPGYVVLADEIKAAGVDIIACVSVNDAFVMQA 64

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+      + +L DG   FT+ +G+ +     G G+RS RY  +I+D VV    VEE  
Sbjct: 65  WGEAQNATEIMMLADGDASFTKALGLEMDTATFG-GIRSQRYAMIIEDGVVTQLNVEE-- 121

Query: 152 SDNCATDPYEISSPENVLKVIR 173
                   +E S  E +L  ++
Sbjct: 122 -----PKQFEASKAETILAALK 138


>gi|152997944|ref|YP_001342779.1| redoxin domain-containing protein [Marinomonas sp. MWYL1]
 gi|150838868|gb|ABR72844.1| Redoxin domain protein [Marinomonas sp. MWYL1]
          Length = 159

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 93/160 (58%), Gaps = 17/160 (10%)

Query: 18  VLPDGSKAFQW------KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLR 71
           +LP G  AFQ       + V+  + F+GK V +FA+PGAFTPTCS   LPG+   YD L+
Sbjct: 8   MLPHG--AFQVMGEEGPETVDVTEFFSGKTVLMFAVPGAFTPTCSASHLPGYVVHYDALK 65

Query: 72  CEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSW 131
            +G++EV CLSVND FVMNAWGK    +N+ +  DG  EFT  MG+ +       G+RS 
Sbjct: 66  EKGVDEVVCLSVNDVFVMNAWGKANNAENLIMAADGLAEFTCSMGLELDISAAKMGIRSR 125

Query: 132 RYGALIKDMVVES-WFVEEGFSDNCATDPYEISSPENVLK 170
           RY  L+ + +V+  W  E G         Y++SS E VL 
Sbjct: 126 RYAMLVTNGIVQQLWLDEPG--------EYKVSSAEYVLS 157


>gi|302762366|ref|XP_002964605.1| hypothetical protein SELMODRAFT_28066 [Selaginella moellendorffii]
 gi|300168334|gb|EFJ34938.1| hypothetical protein SELMODRAFT_28066 [Selaginella moellendorffii]
          Length = 161

 Score =  122 bits (305), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 65/168 (38%), Positives = 102/168 (60%), Gaps = 15/168 (8%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   +PDG  ++       + +   DL + K+V +FA+PGAFTPTCS   +PGF    
Sbjct: 1   IAVGERIPDGELSYFDESGAIQSIKVSDLTSKKKVVIFAVPGAFTPTCSSKHVPGFIDKA 60

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV-YKDNV- 124
           D+L+ +G++ + C+SVNDAFVM +WG+ L +   + +L DG+G+FTR +G+ V   D V 
Sbjct: 61  DELKSKGVDTIACVSVNDAFVMKSWGEALGVNGKILMLSDGNGKFTRDLGVTVDLSDKVE 120

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G G+RS RY  L +D +V+   +EEG +       Y +SS + +LK +
Sbjct: 121 GLGVRSRRYSLLAEDGIVKVLNLEEGGA-------YTVSSADEILKAL 161


>gi|302381927|ref|YP_003817750.1| redoxin [Brevundimonas subvibrioides ATCC 15264]
 gi|302192555|gb|ADL00127.1| Redoxin domain protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 161

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/143 (44%), Positives = 87/143 (60%), Gaps = 9/143 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V T + F GK V LFA+PGAFTPTCS   LPGF      L  +G++ + CLSVNDAFV
Sbjct: 23  RPVQTDEFFKGKTVALFAVPGAFTPTCSARHLPGFVDNKSALADKGVDTIACLSVNDAFV 82

Query: 89  MNAWG--KKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           + AW   + L   +V +L DGSG+FTR +G+ +     G G RS RY  L+KD VVE   
Sbjct: 83  LKAWAESQSLTEADVVMLADGSGDFTRTLGLTLDARGFGMGERSQRYSMLVKDGVVEQLN 142

Query: 147 VEEGFSDNCATDPYEISSPENVL 169
           +E+G         +++SS E++L
Sbjct: 143 IEQG-------GEFKVSSAEHLL 158


>gi|255626437|gb|ACU13563.1| unknown [Glycine max]
          Length = 162

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 102/166 (61%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG  A+     + + V+   L AGK+V +F +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVIPDGILAYLDEENKPQTVSIHSLAAGKKVIIFGVPGAFTPTCSLKHVPGFIERA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++E+ C+SVND FVMN+W K   E K+VK L DG+ ++T  +G+ +   + G 
Sbjct: 64  EELKGKGVDEIICISVNDPFVMNSWAKTFPENKHVKFLADGAAKYTNALGLELDLTDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L++D+ V+   VE G         + ISS E ++K +
Sbjct: 124 GVRSKRFALLVEDLKVKVANVESG-------GEFTISSAEEIIKAL 162


>gi|16127624|ref|NP_422188.1| AhpC/TSA family protein [Caulobacter crescentus CB15]
 gi|221236441|ref|YP_002518878.1| peroxiredoxin [Caulobacter crescentus NA1000]
 gi|13425104|gb|AAK25356.1| AhpC/TSA family protein [Caulobacter crescentus CB15]
 gi|220965614|gb|ACL96970.1| peroxiredoxin [Caulobacter crescentus NA1000]
          Length = 160

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 88/141 (62%), Gaps = 8/141 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++T D+F GK V LFA+PGAFTPTCS   LPGF++  D+L+ +G++ + C+SVND FVM 
Sbjct: 25  ISTDDIFKGKTVALFAVPGAFTPTCSAKHLPGFKEKADELKAKGVDSIVCVSVNDVFVMK 84

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWGK   I   V L+ DG+G+FT+ +G+       G G RS RY  + KD VV    VE+
Sbjct: 85  AWGKDQGIDGEVLLIADGNGDFTKAIGLDFDGSKFGMGARSQRYSLVAKDGVVTQLHVED 144

Query: 150 GFSDNCATDPYEISSPENVLK 170
                     +++SS E +L+
Sbjct: 145 -------AGQFKVSSAEYLLE 158


>gi|114561403|ref|YP_748916.1| redoxin domain-containing protein [Shewanella frigidimarina NCIMB
           400]
 gi|114332696|gb|ABI70078.1| Redoxin domain protein [Shewanella frigidimarina NCIMB 400]
          Length = 157

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 88/142 (61%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  +LFAGK+V LFA+PGAFTPTCS+  LPGF  + D+ + +G++ + C+SVNDAFVM A
Sbjct: 25  DVTELFAGKKVVLFAVPGAFTPTCSEAHLPGFVVLADEFKAKGVDLIACVSVNDAFVMKA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   F + +G+    D  GF G+RS RY  +I + VV    VEEG
Sbjct: 85  WGEAQNASELMMLADGDASFAKALGL--EMDTAGFGGVRSQRYAMVIDNGVVTLLNVEEG 142

Query: 151 FSDNCATDPYEISSPENVLKVI 172
            S       +E+S+ E V+  +
Sbjct: 143 KS-------FEVSTAEAVMAAL 157


>gi|171462993|ref|YP_001797106.1| Redoxin domain protein [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|171192531|gb|ACB43492.1| Redoxin domain protein [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 166

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 97/150 (64%), Gaps = 13/150 (8%)

Query: 22  GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCL 81
           G  AF+      ++L AGK++ LFALPGAFTPTCS   +PG+ + +D ++ +G++E++C+
Sbjct: 27  GPNAFE-----VEELAAGKKIVLFALPGAFTPTCSAKHVPGYVEHFDAIKAKGVDEIWCV 81

Query: 82  SVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
           SVND FVM AWG+  ++ K +++L DGS EFT+ +G+ +     G G+RS RY  +I+D 
Sbjct: 82  SVNDPFVMGAWGRDQKVGKKIRMLGDGSAEFTKMLGLELDLTARGLGVRSDRYAMIIEDG 141

Query: 141 VVESWFVEEGFSDNCATDPYEISSPENVLK 170
           +V+S        D  A   +E+S   ++LK
Sbjct: 142 IVKSL-------DREAPGKFEVSDAASILK 164


>gi|148260898|ref|YP_001235025.1| redoxin domain-containing protein [Acidiphilium cryptum JF-5]
 gi|146402579|gb|ABQ31106.1| Redoxin domain protein [Acidiphilium cryptum JF-5]
          Length = 161

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 90/145 (62%), Gaps = 8/145 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           ++++T +LFAGK V LFA+PGAFTPTCS   +PGF + YD L+ +G++E+ C++VND FV
Sbjct: 22  QEIDTGELFAGKTVVLFAVPGAFTPTCSAKHVPGFLEHYDALKAKGVDEIACIAVNDVFV 81

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AW +  +    V  L DGSG FTR +G+ +     G G+RS RY  + +D +V    +
Sbjct: 82  MTAWAESQKAGGKVTFLADGSGAFTRALGLELDLIARGLGVRSQRYALVAQDGLVTHLAI 141

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           E+          +E+S  E VL+ +
Sbjct: 142 EQ-------PGGFEVSRAEAVLEAL 159


>gi|309783027|ref|ZP_07677746.1| antioxidant, AhpC/Tsa family [Ralstonia sp. 5_7_47FAA]
 gi|308918135|gb|EFP63813.1| antioxidant, AhpC/Tsa family [Ralstonia sp. 5_7_47FAA]
          Length = 166

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 88/142 (61%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + Q L  GK + +F LPGAFTPTCS   +PG+   YD LR +G++E++C+SVNDAFVM A
Sbjct: 32  SVQHLAEGKTIVIFGLPGAFTPTCSARHVPGYLANYDALRAKGVDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           W +     + +++L DGS EFT K+G+       G G+RS RY  ++KD VV +  VE  
Sbjct: 92  WARTQGTDDKIRMLGDGSAEFTSKLGLDQDLSKRGMGVRSQRYAMVVKDGVVTALQVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   + +SS E++L V+
Sbjct: 150 -----APGQFSVSSAESILAVL 166


>gi|115350523|ref|YP_772362.1| redoxin domain-containing protein [Burkholderia ambifaria AMMD]
 gi|115280511|gb|ABI86028.1| Redoxin domain protein [Burkholderia ambifaria AMMD]
          Length = 168

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + +D  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  SVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRSAGIDELWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VL  +
Sbjct: 150 -----APGKFEVSDAASVLATL 166


>gi|30841938|gb|AAP34571.1| thioredoxin peroxidase 1 [Solanum lycopersicum]
          Length = 162

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 92/144 (63%), Gaps = 6/144 (4%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ ++     Q + V+   L  GK+V +FA+PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVIPDGTVSYFDEQDQMQTVSVYSLAKGKKVIIFAVPGAFTPTCSMKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            +L+ +G++E+ C+SVND FVM AW K   E K+VK L DG+G++T  +G+ +   + G 
Sbjct: 64  AELKSKGVDEILCISVNDPFVMKAWAKTYPENKHVKFLADGAGKYTHALGLELDLSDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEG 150
           G+RS RY  L+ D+ V+   +E G
Sbjct: 124 GVRSRRYALLVDDLEVKVANIESG 147


>gi|332531710|ref|ZP_08407595.1| peroxiredoxin, AhpC/Tsa [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038686|gb|EGI75128.1| peroxiredoxin, AhpC/Tsa [Pseudoalteromonas haloplanktis ANT/505]
          Length = 157

 Score =  121 bits (304), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 82/122 (67%), Gaps = 3/122 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + +  ++LF GK+V LFA+PGAFTPTCS+  LP F  + D ++ +G++ +YC+SVNDAFV
Sbjct: 22  QSLTNKELFEGKKVVLFAVPGAFTPTCSNAHLPEFITLADKIKAKGVDAIYCVSVNDAFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFV 147
           M AWG     + + +L DG G FT+ +G+   KD   F G+RS RY  +I++ +V   FV
Sbjct: 82  MKAWGDSQNAQEITMLGDGDGSFTKSLGL--DKDTASFGGIRSTRYAMIIENALVIGLFV 139

Query: 148 EE 149
           E+
Sbjct: 140 EQ 141


>gi|241664301|ref|YP_002982661.1| Redoxin domain-containing protein [Ralstonia pickettii 12D]
 gi|240866328|gb|ACS63989.1| Redoxin domain protein [Ralstonia pickettii 12D]
          Length = 166

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 88/142 (61%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + Q L  GK + +F LPGAFTPTCS   +PG+   YD LR +G++E++C+SVNDAFVM A
Sbjct: 32  SVQHLAEGKTIVIFGLPGAFTPTCSARHVPGYLANYDALRAKGVDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           W +     + +++L DGS EFT K+G+       G G+RS RY  ++KD VV +  VE  
Sbjct: 92  WARTQGTDDKIRMLGDGSAEFTSKLGLDQDLSKRGMGVRSQRYAMVVKDGVVTALQVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   + +SS E++L V+
Sbjct: 150 -----APGQFSVSSAESILAVL 166


>gi|21593881|gb|AAM65848.1| type 2 peroxiredoxin, putative [Arabidopsis thaliana]
          Length = 162

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 102/166 (61%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ +F     Q + V+   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVVPDGTISFFDENDQLQTVSVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++++ C SVND F+M AWGK   E K+VK + DGSGE+T  +G+ +   + G 
Sbjct: 64  EELKSKGVDDIICFSVNDPFLMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L+ ++ V    +E G         + +SS +++L+ +
Sbjct: 124 GIRSRRFALLLDNLKVTVANLESGGG-------FTVSSADDILEAL 162


>gi|88798533|ref|ZP_01114117.1| antioxidant, putative [Reinekea sp. MED297]
 gi|88778633|gb|EAR09824.1| antioxidant, putative [Reinekea sp. MED297]
          Length = 162

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 81/120 (67%), Gaps = 1/120 (0%)

Query: 27  QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDA 86
           Q + ++T  LFA +RV LFALPGAFTPTCS   LPGF    D ++ +GI+++ CLSVNDA
Sbjct: 21  QPQPLSTDSLFANRRVVLFALPGAFTPTCSAAHLPGFVVAADQIKQQGIDDILCLSVNDA 80

Query: 87  FVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           +VM+AWG++   + ++++ DGS + +  M + V     G G+RS RY  +I D +VE WF
Sbjct: 81  WVMHAWGEQQNAEAIRMIADGSADLSEAMDLAVDLTERGMGVRSQRYAMVINDGIVE-WF 139


>gi|225441002|ref|XP_002283652.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 212

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 94/151 (62%), Gaps = 10/151 (6%)

Query: 25  AFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVN 84
           A + +     DL  GK+  LFA+PGAFTPTCS   LPGF +   +L+ +G+E + C+SVN
Sbjct: 69  AGELQTTTVSDLTKGKKAILFAVPGAFTPTCSQKHLPGFVEKSGELKSKGVETIACISVN 128

Query: 85  DAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMG--MLVYKDNVGFGLRSWRYGALIKDMV 141
           DAFVM AW   L+I++ V LL DG+G+FT+ +G  + +    VG G+RS RY  L+ D V
Sbjct: 129 DAFVMKAWKADLKIEDQVLLLSDGNGDFTKAIGCELDLSDKPVGLGVRSRRYAMLVDDGV 188

Query: 142 VESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           V+   +EEG +       +  S  E++LK++
Sbjct: 189 VKVLNLEEGGA-------FTFSGAEDILKLL 212


>gi|170724517|ref|YP_001758543.1| redoxin domain-containing protein [Shewanella woodyi ATCC 51908]
 gi|169809864|gb|ACA84448.1| Redoxin domain protein [Shewanella woodyi ATCC 51908]
          Length = 158

 Score =  121 bits (303), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 63/139 (45%), Positives = 85/139 (61%), Gaps = 10/139 (7%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           DLFAGK+V LFA+PGAFTPTCS   LPGF  + D  + +G++ + C+SVNDAFVM AWG 
Sbjct: 29  DLFAGKKVVLFAVPGAFTPTCSQSHLPGFVVLADQFKAKGVDLIACVSVNDAFVMKAWGD 88

Query: 95  KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEGFSD 153
                 V +L DG   FT+ +G+ V  D  GF G+RS RY  +++D VV    VE     
Sbjct: 89  SQNASEVMMLADGDASFTKAIGLQV--DTAGFGGIRSQRYAMVLEDGVVTDLNVE----- 141

Query: 154 NCATDPYEISSPENVLKVI 172
             A   +E+S  E +L ++
Sbjct: 142 --APKMFEVSKAEVILDLL 158


>gi|168019168|ref|XP_001762117.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162686834|gb|EDQ73221.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 179

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 97/159 (61%), Gaps = 10/159 (6%)

Query: 8   QVVFHMRVATVLPDGSKAFQWKDVNTQ-----DLFAGKRVFLFALPGAFTPTCSDHQLPG 62
           QVV  + V   LP+   ++  KD N Q     +L  GK+V LFA+PGAFTPTCS   LPG
Sbjct: 14  QVVATISVGDKLPEAQLSYFDKDGNVQSVSVSELTKGKKVVLFAVPGAFTPTCSSKHLPG 73

Query: 63  FEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV-Y 120
           F    D+LR  G++ + C+SVNDAFVM AWGK   + + V +L DG  +FT+ +G  V  
Sbjct: 74  FVAKADELRKAGVDTLACVSVNDAFVMQAWGKSAGVGDSVLMLSDGLAKFTQALGTAVDL 133

Query: 121 KDNV-GFGLRSWRYGALIKDMVVESWFVEEG--FSDNCA 156
            D V G G+RS RY  L++D VV+   +E G  F+++ A
Sbjct: 134 TDKVEGLGIRSRRYSMLVEDGVVKVLNLEVGGAFTNSSA 172


>gi|326404295|ref|YP_004284377.1| putative peroxiredoxin [Acidiphilium multivorum AIU301]
 gi|325051157|dbj|BAJ81495.1| putative peroxiredoxin [Acidiphilium multivorum AIU301]
          Length = 161

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 90/145 (62%), Gaps = 8/145 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           ++++T +LFAGK V LFA+PGAFTPTCS   +PGF + YD L+ +G++E+ C++VND FV
Sbjct: 22  QEIDTGELFAGKTVVLFAVPGAFTPTCSAKHVPGFLEHYDALKAKGVDEIACIAVNDVFV 81

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AW +  +    +  L DGSG FTR +G+ +     G G+RS RY  + +D +V    +
Sbjct: 82  MTAWAESQKAGGKITFLADGSGAFTRALGLELDLIARGLGVRSQRYALVAQDGLVTHLAI 141

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           E+          +E+S  E VL+ +
Sbjct: 142 EQ-------PGGFEVSRAEAVLEAL 159


>gi|146294930|ref|YP_001185354.1| redoxin domain-containing protein [Shewanella putrefaciens CN-32]
 gi|145566620|gb|ABP77555.1| Redoxin domain protein [Shewanella putrefaciens CN-32]
 gi|319424528|gb|ADV52602.1| Redoxin domain protein [Shewanella putrefaciens 200]
          Length = 157

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 96/159 (60%), Gaps = 14/159 (8%)

Query: 19  LPDGSKAFQWKD--VNTQ--DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           LP G+ + Q KD  VN +  +LFAGK+V LFA+PGAFTPTCS+  LPG+  + D  + +G
Sbjct: 8   LPAGTLSQQTKDGTVNHKVTELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADQFKAKG 67

Query: 75  IEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRY 133
           ++ + C++VNDAFVM AWG+      + +L DG   FT+ +G+ +  D  GF G+RS RY
Sbjct: 68  VDLIACVAVNDAFVMKAWGEAQNASELMMLADGDASFTKALGLEM--DTAGFGGIRSQRY 125

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
             +I + VV    VE       A   +E+S  E VL  +
Sbjct: 126 AMIIDNGVVTLLNVE-------APKSFEVSKAEVVLAAL 157


>gi|294138929|ref|YP_003554907.1| AhpC/TSA family antioxidant [Shewanella violacea DSS12]
 gi|293325398|dbj|BAJ00129.1| antioxidant, AhpC/TSA family [Shewanella violacea DSS12]
          Length = 136

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 86/142 (60%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N  +LFAGK+V LFA+PGAFTPTCS+  LPG+  + D  + +GI+ + C+SVNDAFVM A
Sbjct: 4   NVAELFAGKKVVLFAVPGAFTPTCSESHLPGYVVLADQFQAKGIDIIACVSVNDAFVMKA 63

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   FT+ +G+ +  D  GF G+RS RY  +I + VV    VE  
Sbjct: 64  WGQAQNASELMMLADGDASFTKALGLEM--DTAGFGGVRSQRYAMVIDNGVVTQLNVE-- 119

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S  E VL  +
Sbjct: 120 -----APKSFEVSKAEAVLAAL 136


>gi|171316215|ref|ZP_02905438.1| Redoxin domain protein [Burkholderia ambifaria MEX-5]
 gi|171098629|gb|EDT43426.1| Redoxin domain protein [Burkholderia ambifaria MEX-5]
          Length = 168

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
             +D  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  GVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRSAGIDELWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VL  +
Sbjct: 150 -----APGKFEVSDAASVLATL 166


>gi|332285342|ref|YP_004417253.1| antioxidant [Pusillimonas sp. T7-7]
 gi|330429295|gb|AEC20629.1| antioxidant [Pusillimonas sp. T7-7]
          Length = 168

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 84/117 (71%), Gaps = 1/117 (0%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           DL  GK++ LFA+PGAFTPTCS   LPG+ +++D+L+ +G++E++C++VND FVM AWG+
Sbjct: 36  DLVKGKKIALFAVPGAFTPTCSAKHLPGYLQLHDELKAKGVDEIWCVAVNDPFVMGAWGR 95

Query: 95  -KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
            +   + V++L DGS  +TR++G+ +     G G+RS RY A++ D VV    VEEG
Sbjct: 96  DQGANERVRMLADGSANWTRELGLELDLTARGMGIRSQRYSAVLDDGVVTQLNVEEG 152


>gi|83748773|ref|ZP_00945788.1| Probable peroxiredoxin [Ralstonia solanacearum UW551]
 gi|207744395|ref|YP_002260787.1| thioredoxin fold-haboring protein [Ralstonia solanacearum IPO1609]
 gi|83724594|gb|EAP71757.1| Probable peroxiredoxin [Ralstonia solanacearum UW551]
 gi|206595800|emb|CAQ62727.1| thioredoxin fold-haboring protein [Ralstonia solanacearum IPO1609]
          Length = 171

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 87/139 (62%), Gaps = 8/139 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  DL  GK + +F LPGAFTPTCS   +PG+   YD LR +G++E++C+SVNDAFVM A
Sbjct: 37  SAADLAQGKTILIFGLPGAFTPTCSARHVPGYLAHYDALRAKGVDEIWCVSVNDAFVMGA 96

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           W +  +    V++L DGS EFTRK+G+       G G+RS RY  ++++ VV +  VE  
Sbjct: 97  WARAQDTDGRVRMLADGSAEFTRKLGLEQDLSKRGMGVRSQRYAMIVRNGVVTALQVE-- 154

Query: 151 FSDNCATDPYEISSPENVL 169
                A   + +S+ E++L
Sbjct: 155 -----APGQFAVSNAESML 168


>gi|78065127|ref|YP_367896.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Burkholderia sp. 383]
 gi|77965872|gb|ABB07252.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Burkholderia sp. 383]
          Length = 168

 Score =  120 bits (302), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 97/173 (56%), Gaps = 21/173 (12%)

Query: 13  MRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++V   LPD ++ F++ D             + +D  AGKRV +F LPGAFTPTCS   +
Sbjct: 2   IQVGDALPD-AQLFEYIDDAREGCTLGPNAYSVRDQVAGKRVVIFGLPGAFTPTCSAQHV 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
           PG+ +  + LR  GI+E++C+SVNDAFVM AWG+ L     V+++ DGS  FT  +G+  
Sbjct: 61  PGYVEHAEQLRAAGIDEIWCVSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQ 120

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
                G G+RS RY  +I   VV++  VE       A   +E+S   +VL  +
Sbjct: 121 DLSARGMGIRSLRYAMVIDGGVVKTLAVE-------APGKFEVSDAASVLATL 166


>gi|330446022|ref|ZP_08309674.1| ahpC/TSA family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490213|dbj|GAA04171.1| ahpC/TSA family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 158

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 87/142 (61%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +T +LFA KRV LFA+PGAFTPTCS+  LPG+  + D+++  G++ + C+SVNDAFVM A
Sbjct: 25  DTAELFANKRVVLFAVPGAFTPTCSEAHLPGYVVLADEIKATGVDIIACVSVNDAFVMQA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+      + +L DG   FT+ +G+ +  +N G G+RS RY  +I + VV    VE+  
Sbjct: 85  WGEAQNASEIMMLADGDASFTKALGLEMDTENFG-GIRSQRYAMVIDNGVVTQLNVEQ-- 141

Query: 152 SDNCATDPYEISSPENVLKVIR 173
                   +E S  E +L  ++
Sbjct: 142 -----PKQFEASKAETILASLK 158


>gi|114570772|ref|YP_757452.1| redoxin domain-containing protein [Maricaulis maris MCS10]
 gi|114341234|gb|ABI66514.1| Redoxin domain protein [Maricaulis maris MCS10]
          Length = 160

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 90/140 (64%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++T D+FAGK V LFA+PGAFTPTCS   LPGF +   ++R +G++ + CLSVND FVM+
Sbjct: 25  LSTDDVFAGKTVALFAVPGAFTPTCSAKHLPGFVEKAAEIRGKGVDTIACLSVNDVFVMD 84

Query: 91  AWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWGK      +V +L DG+GEF + +G+ +     G G+R+ R+  L+KD VV    VE 
Sbjct: 85  AWGKSQNAGDDVVMLADGNGEFAKAVGLEMDGTGFGMGVRAQRFSILVKDGVVAELNVE- 143

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A   +++SS +++L
Sbjct: 144 ------APGEFKVSSADHIL 157


>gi|172059555|ref|YP_001807207.1| redoxin domain-containing protein [Burkholderia ambifaria MC40-6]
 gi|171992072|gb|ACB62991.1| Redoxin domain protein [Burkholderia ambifaria MC40-6]
          Length = 168

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + +D  AGKRV +F LPGAFTPTCS   +PG+ +    LR  GI+E++C+SVNDAFVM A
Sbjct: 32  SVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAGQLRSAGIDELWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VL  +
Sbjct: 150 -----APGKFEVSDAASVLATL 166


>gi|24376113|ref|NP_720156.1| anti-oxidant AhpCTSA family protein [Shewanella oneidensis MR-1]
 gi|24351145|gb|AAN57600.1|AE015895_9 antioxidant, AhpC/Tsa family [Shewanella oneidensis MR-1]
          Length = 158

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 68/160 (42%), Positives = 95/160 (59%), Gaps = 14/160 (8%)

Query: 19  LPDGSKAFQWKD--VNTQ--DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           LP  + +   KD  VN Q  +LFAGK+V LFA+PGAFTPTCS+  LPG+  + D+L+ +G
Sbjct: 8   LPAATLSQLTKDGMVNHQVTELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADELKAKG 67

Query: 75  IEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRY 133
           ++ + C+SVNDAFVM AWG+      + +L DG   FT+ +G+    D  GF G+RS RY
Sbjct: 68  VDLIACVSVNDAFVMKAWGEAQNASELLMLADGDASFTKALGL--EMDTAGFGGVRSQRY 125

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
             +I + VV    VE       A   +E+S  E VL  + 
Sbjct: 126 AMIIDNGVVTLLNVE-------APKSFEVSKAEVVLAALS 158


>gi|111608943|gb|ABH11029.1| peroxiredoxin II [Polytomella parva]
          Length = 148

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 88/140 (62%), Gaps = 5/140 (3%)

Query: 18  VLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEE 77
           +L DG      + + + D+FA K+V +F LPGAFTPTCS   +PGF +   + + +G++ 
Sbjct: 4   ILKDG----DLQTITSDDIFAKKKVVIFGLPGAFTPTCSKSHVPGFVERAAEFKAKGVDT 59

Query: 78  VYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGAL 136
           + C+SVNDAFVM AWG  L + +NV +L DG   FT+  G+  Y +  G GLRS RY A+
Sbjct: 60  IACISVNDAFVMKAWGDSLGVGENVLMLADGLATFTKAAGLDQYLEPNGLGLRSKRYAAV 119

Query: 137 IKDMVVESWFVEEGFSDNCA 156
           ++D VV    +EEG +  C+
Sbjct: 120 VEDGVVTRINIEEGRAFVCS 139


>gi|209966892|ref|YP_002299807.1| peroxiredoxin, putative [Rhodospirillum centenum SW]
 gi|209960358|gb|ACJ00995.1| peroxiredoxin, putative [Rhodospirillum centenum SW]
          Length = 160

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 92/146 (63%), Gaps = 8/146 (5%)

Query: 28  WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAF 87
            +++ T ++FAG++V LFA+PGAFTPTCS   LPGF +  + +R +G++++ C++VND F
Sbjct: 22  MQEIGTDEIFAGRKVVLFAVPGAFTPTCSAKHLPGFVEQAEAIRAKGVDQIVCMAVNDPF 81

Query: 88  VMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           VM+AW K   +   + +LPDG+G  TR +G+ +       GLR  R+  + +D VV +  
Sbjct: 82  VMHAWAKANNVNGRILMLPDGNGTLTRALGLEMDGTAYNLGLRCQRFALVAEDGVVTALN 141

Query: 147 VEEGFSDNCATDPYEISSPENVLKVI 172
           VE+          +E+SS E VLK++
Sbjct: 142 VEK-------PGAFEVSSAEAVLKLL 160


>gi|255546427|ref|XP_002514273.1| peroxiredoxin, putative [Ricinus communis]
 gi|223546729|gb|EEF48227.1| peroxiredoxin, putative [Ricinus communis]
          Length = 162

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 95/161 (59%), Gaps = 13/161 (8%)

Query: 18  VLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC 72
            LPDG+ A+     Q + V+   L AGK+V +  +PGAFTPTCS   +PGF +  ++L+ 
Sbjct: 9   TLPDGTLAYFDEQDQLQQVSIHSLAAGKKVVIVGVPGAFTPTCSLKHVPGFIEKAEELKS 68

Query: 73  EGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSW 131
           +G+ E+ CLSVND FVM AW K   E K+VK L DGS  +T  +G+ +     G G RS 
Sbjct: 69  KGVAEILCLSVNDPFVMKAWAKTYPENKHVKFLADGSATYTHALGLELDLKEKGLGTRSR 128

Query: 132 RYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           R+  L+ D+ V++  +EEG         + +SS + +LK +
Sbjct: 129 RFALLVDDLKVKAANLEEG-------GEFTVSSVDEILKAL 162


>gi|331694167|ref|YP_004330406.1| Redoxin domain-containing protein [Pseudonocardia dioxanivorans
           CB1190]
 gi|326948856|gb|AEA22553.1| Redoxin domain protein [Pseudonocardia dioxanivorans CB1190]
          Length = 161

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 90/141 (63%), Gaps = 7/141 (4%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V +++      V LF +PGAFTP CSD  LP +    D+LR +G++ V C+SVNDAFVM+
Sbjct: 25  VASREALGTGTVVLFGVPGAFTPACSDRHLPEYVLRADELRAKGVDTVACVSVNDAFVMD 84

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWG+  E+ + V +L DG+G+FTR +G+ +    +G GLRS RY A+++D VV+  +VE 
Sbjct: 85  AWGRSREVGDSVVMLADGNGDFTRAVGLELDATGLGLGLRSKRYAAVLRDGVVQDIWVEA 144

Query: 150 GFSDNCATDPYEISSPENVLK 170
             SD        +SS + VLK
Sbjct: 145 VPSD------VVVSSADAVLK 159


>gi|206561793|ref|YP_002232558.1| putative thioredoxin reductase [Burkholderia cenocepacia J2315]
 gi|198037835|emb|CAR53779.1| putative thioredoxin reductase [Burkholderia cenocepacia J2315]
          Length = 168

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 97/173 (56%), Gaps = 21/173 (12%)

Query: 13  MRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++V   LPD ++ F++ D             + +D  AGKRV +F LPGAFTPTCS   +
Sbjct: 2   IQVGDALPD-AQLFEFIDDAREGCTLGPNACSVRDQVAGKRVVIFGLPGAFTPTCSAQHV 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
           PG+ +  + LR  GI+E++C+SVNDAFVM AWG+ L     V+++ DGS  FT  +G+  
Sbjct: 61  PGYVEHAEQLRAAGIDEIWCVSVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQ 120

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
                G G+RS RY  +I   VV++  VE       A   +E+S   +VL  +
Sbjct: 121 DLSARGMGIRSLRYAMVIDGGVVKTLAVE-------APGKFEVSDAASVLATL 166


>gi|107021644|ref|YP_619971.1| redoxin [Burkholderia cenocepacia AU 1054]
 gi|116688589|ref|YP_834212.1| redoxin domain-containing protein [Burkholderia cenocepacia HI2424]
 gi|105891833|gb|ABF74998.1| Redoxin [Burkholderia cenocepacia AU 1054]
 gi|116646678|gb|ABK07319.1| Redoxin domain protein [Burkholderia cenocepacia HI2424]
          Length = 168

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + +D  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  SVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  +I   VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VL  +
Sbjct: 150 -----APGKFEVSDAASVLATL 166


>gi|285017445|ref|YP_003375156.1| peroxiredoxin oxidoreductase [Xanthomonas albilineans GPE PC73]
 gi|283472663|emb|CBA15168.1| putative peroxiredoxin oxidoreductase protein [Xanthomonas
           albilineans]
          Length = 160

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 94/143 (65%), Gaps = 9/143 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V+T  LF G+R  LFA+PGAFTPTCS+  LPG+ + +++ R  GI EVYC++VND FV
Sbjct: 22  EQVDTHTLFDGRRALLFAVPGAFTPTCSEKHLPGYVEHFEEFRKRGI-EVYCMAVNDPFV 80

Query: 89  MNAWGK-KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AWGK +L    +++L DG+G+FT+ +G+ +   + G GLR+ R+    ++ VV S FV
Sbjct: 81  MQAWGKSQLVPDGLQMLSDGNGDFTKALGLELDASHYGMGLRARRFALYAENGVVRSLFV 140

Query: 148 EEGFSDNCATDPYEISSPENVLK 170
           E       A   +++S+ + VL+
Sbjct: 141 E-------APGEFKVSAADYVLQ 156


>gi|170695295|ref|ZP_02886441.1| Redoxin domain protein [Burkholderia graminis C4D1M]
 gi|170139695|gb|EDT07877.1| Redoxin domain protein [Burkholderia graminis C4D1M]
          Length = 167

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 87/142 (61%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  DVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHAEQLRAAGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FTR +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLSVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   ++L  +
Sbjct: 150 -----AAGKFEVSDAGSILATL 166


>gi|148555582|ref|YP_001263164.1| redoxin domain-containing protein [Sphingomonas wittichii RW1]
 gi|148500772|gb|ABQ69026.1| Redoxin domain protein [Sphingomonas wittichii RW1]
          Length = 160

 Score =  120 bits (301), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V + DLFAG++V LF++PGAFTPTCS   LPG+    D +R  G++E+ C +VNDAFV
Sbjct: 23  RPVASADLFAGRKVALFSVPGAFTPTCSAKHLPGYVDKADAIRARGVDEIVCTAVNDAFV 82

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AWG        V +L DG+G+F R +G+ +     G G+R  R+  L++D VV    V
Sbjct: 83  MGAWGVSAGADGKVSMLADGNGDFVRALGLEMDARGAGMGVRGQRFSMLVEDGVVTRLNV 142

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           EE          Y++SS E++L
Sbjct: 143 EE-------PREYKVSSAEHLL 157


>gi|300690347|ref|YP_003751342.1| peroxiredoxin [Ralstonia solanacearum PSI07]
 gi|299077407|emb|CBJ50032.1| peroxiredoxin [Ralstonia solanacearum PSI07]
          Length = 166

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 85/139 (61%), Gaps = 8/139 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  DL  GK + +F LPGAFTPTCS   +PG+   YD LR +G++E++C+SVNDAFVM A
Sbjct: 32  SAADLVQGKTILIFGLPGAFTPTCSARHVPGYLAHYDALRAKGVDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           W +       V++L DGS EFTRK+G+       G G+RS RY  ++K+ VV +  VE  
Sbjct: 92  WARAQGTDGRVRMLADGSAEFTRKLGLEQDLSKRGMGVRSQRYAMIVKNGVVTALQVE-- 149

Query: 151 FSDNCATDPYEISSPENVL 169
                A   + +S  E++L
Sbjct: 150 -----APGQFAVSDAESML 163


>gi|170731889|ref|YP_001763836.1| redoxin domain-containing protein [Burkholderia cenocepacia MC0-3]
 gi|169815131|gb|ACA89714.1| Redoxin domain protein [Burkholderia cenocepacia MC0-3]
          Length = 168

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + +D  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  SVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  +I   VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VL  +
Sbjct: 150 -----APGKFEVSDAASVLATL 166


>gi|170700189|ref|ZP_02891207.1| Redoxin domain protein [Burkholderia ambifaria IOP40-10]
 gi|170134921|gb|EDT03231.1| Redoxin domain protein [Burkholderia ambifaria IOP40-10]
          Length = 168

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + +D  AGKRV +F LPGAFTPTCS   +PG+ +    LR  GI+E++C+SVNDAFVM A
Sbjct: 32  SVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAAQLRSAGIDELWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGVRSLRYAMVVDDGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VL  +
Sbjct: 150 -----APGKFEVSDAASVLATL 166


>gi|239817863|ref|YP_002946773.1| redoxin [Variovorax paradoxus S110]
 gi|239804440|gb|ACS21507.1| Redoxin domain protein [Variovorax paradoxus S110]
          Length = 168

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 86/144 (59%), Gaps = 8/144 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+     AGK + LFALPGAFTPTCS   +PG+ + YDD +  G++E++C+SVNDAFVM 
Sbjct: 31  VDVSKATAGKTIALFALPGAFTPTCSAKHVPGYVQHYDDFKAAGVDEIWCVSVNDAFVMG 90

Query: 91  AWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DGS +F +  G+ +     G GLRS RY  L+KD  V +  VE 
Sbjct: 91  AWARDQKTGAKVRMLADGSADFAKATGLTLDLTGRGMGLRSNRYSMLVKDGKVATLNVE- 149

Query: 150 GFSDNCATDPYEISSPENVLKVIR 173
                 A   +E+S+ E +L   R
Sbjct: 150 ------APGKFEVSNAETLLAQAR 167


>gi|221202521|ref|ZP_03575551.1| antioxidant, AhpC/TSA family [Burkholderia multivorans CGD2M]
 gi|221208157|ref|ZP_03581162.1| antioxidant, AhpC/TSA family [Burkholderia multivorans CGD2]
 gi|221172060|gb|EEE04502.1| antioxidant, AhpC/TSA family [Burkholderia multivorans CGD2]
 gi|221177616|gb|EEE10033.1| antioxidant, AhpC/TSA family [Burkholderia multivorans CGD2M]
          Length = 168

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  SVREQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAERLRAAGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VL  +
Sbjct: 150 -----APGKFEVSDAASVLATL 166


>gi|161525999|ref|YP_001581011.1| redoxin domain-containing protein [Burkholderia multivorans ATCC
           17616]
 gi|189349284|ref|YP_001944912.1| putative redoxin [Burkholderia multivorans ATCC 17616]
 gi|221213271|ref|ZP_03586246.1| antioxidant, AhpC/TSA family [Burkholderia multivorans CGD1]
 gi|160343428|gb|ABX16514.1| Redoxin domain protein [Burkholderia multivorans ATCC 17616]
 gi|189333306|dbj|BAG42376.1| putative redoxin [Burkholderia multivorans ATCC 17616]
 gi|221166723|gb|EED99194.1| antioxidant, AhpC/TSA family [Burkholderia multivorans CGD1]
          Length = 168

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  SVREQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAERLRAAGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VL  +
Sbjct: 150 -----APGKFEVSDAASVLATL 166


>gi|254515475|ref|ZP_05127535.1| peroxiredoxin-2D [gamma proteobacterium NOR5-3]
 gi|219675197|gb|EED31563.1| peroxiredoxin-2D [gamma proteobacterium NOR5-3]
          Length = 143

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 87/142 (61%), Gaps = 7/142 (4%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++T +LFAGK+V LFA+PGAFTP CS   LPG+    D +   G++ + CLSVNDAFVM+
Sbjct: 9   ISTDELFAGKKVVLFAVPGAFTPGCSMTHLPGYVVNADKILAAGVDTIACLSVNDAFVMD 68

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           AWGK    +++ +L DG+G+FT+ + + +     G GLRS RY  ++ D  V    VE G
Sbjct: 69  AWGKAQNAEHIMMLADGNGDFTKALDLELDGRGFGMGLRSQRYAMIVDDGKVTVLNVEPG 128

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                     ++S+ EN++  +
Sbjct: 129 AG-------VDVSAAENIMAAL 143


>gi|149927139|ref|ZP_01915396.1| probable type 2 peroxiredoxin protein [Limnobacter sp. MED105]
 gi|149824078|gb|EDM83299.1| probable type 2 peroxiredoxin protein [Limnobacter sp. MED105]
          Length = 167

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 85/137 (62%), Gaps = 8/137 (5%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
            AGK V + ALPGA+TPTCS   +PGF   YD  + +G++E++C+SVNDAFVM  WGK L
Sbjct: 38  LAGKTVAILALPGAYTPTCSAKHVPGFIANYDAFKAKGVDEIWCISVNDAFVMGMWGKSL 97

Query: 97  EIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNC 155
             +  V++L DGS EFT+K+GM +     G G+RS RY  L+KD VV    VE       
Sbjct: 98  GAEGKVRMLADGSAEFTKKIGMELDLTARGMGVRSNRYSMLVKDGVVTQLNVE------- 150

Query: 156 ATDPYEISSPENVLKVI 172
           A   +E S+ E +L  I
Sbjct: 151 APGVFENSTAEKLLSQI 167


>gi|124385055|ref|YP_001027307.1| AhpC/TSA family protein [Burkholderia mallei NCTC 10229]
 gi|238561279|ref|ZP_00442368.2| peroxiredoxin TPx2 (Thioredoxin reductase) [Burkholderia mallei GB8
           horse 4]
 gi|251766630|ref|ZP_02264488.2| AhpC/TSA family protein [Burkholderia mallei PRL-20]
 gi|124293075|gb|ABN02344.1| AhpC/TSA family protein [Burkholderia mallei NCTC 10229]
 gi|238525001|gb|EEP88431.1| peroxiredoxin TPx2 (Thioredoxin reductase) [Burkholderia mallei GB8
           horse 4]
 gi|243065310|gb|EES47496.1| AhpC/TSA family protein [Burkholderia mallei PRL-20]
          Length = 190

 Score =  120 bits (300), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 101/180 (56%), Gaps = 24/180 (13%)

Query: 3   RFQIPQVVFHMRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGA 50
           R++ P ++   +V   LPD ++ F++ D               ++  AGKRV +F LPGA
Sbjct: 17  RYEGPGMI---QVGDTLPD-AQLFEYLDDARAGCTLGPNAFGVREQTAGKRVVIFGLPGA 72

Query: 51  FTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSG 109
           FTPTCS   +PG+    + LR  GI+E++C++VNDAFVM AWG+ L     V+++ DGS 
Sbjct: 73  FTPTCSAQHVPGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSA 132

Query: 110 EFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            FT  +G+       G G+RS RY  ++ D VV++ FVE       A   +E+S   +VL
Sbjct: 133 AFTHALGLTQDLSARGMGIRSRRYAMVVDDGVVKTLFVE-------APGKFEVSDAASVL 185


>gi|289467895|gb|ADC95632.1| type II peroxiredoxin [Bruguiera gymnorhiza]
          Length = 162

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 98/166 (59%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   LP+G+ A+     + +  +   L AGK+V +  +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDKLPEGTLAYFDEDDELQQASIHSLAAGKKVVVIGVPGAFTPTCSLKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           DDL+ +GI E+ C+SVND FVM AW K   E K+VK L DGS  +T  +G+ +     G 
Sbjct: 64  DDLKSKGIAEIICISVNDPFVMKAWSKTYPENKHVKFLADGSATYTHALGLELDLKEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L+ D+ V++  +EEG +       + +SS + +LK +
Sbjct: 124 GIRSRRFALLVDDLQVKAANLEEGGN-------FTVSSVDEILKAL 162


>gi|167564193|ref|ZP_02357109.1| AhpC/TSA family protein [Burkholderia oklahomensis EO147]
 gi|167571343|ref|ZP_02364217.1| AhpC/TSA family protein [Burkholderia oklahomensis C6786]
          Length = 168

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 83/136 (61%), Gaps = 8/136 (5%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE 97
           AG+RV +F LPGAFTPTCS   +PG+    + LR  GI+E++C++VNDAFVM AWG+ L 
Sbjct: 38  AGRRVVIFGLPGAFTPTCSAQHVPGYVAHAEQLRSAGIDEIWCVAVNDAFVMGAWGRDLH 97

Query: 98  IKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               V+++ DGS  FT  +G+       G G+RS RY  +I D VV++ FVE       A
Sbjct: 98  TAGKVRMMADGSAAFTHALGLAQDLSARGMGIRSRRYAMVIDDGVVKTLFVE-------A 150

Query: 157 TDPYEISSPENVLKVI 172
              +E+S   +VL  +
Sbjct: 151 PGKFEVSDAASVLASL 166


>gi|149184285|ref|ZP_01862603.1| AhpC/TSA family protein [Erythrobacter sp. SD-21]
 gi|148831605|gb|EDL50038.1| AhpC/TSA family protein [Erythrobacter sp. SD-21]
          Length = 159

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 84/139 (60%), Gaps = 7/139 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V + D FAGK V LFA+PGAFTPTCS   LPGF    D+L+ +G++E+   SVNDAFVM 
Sbjct: 25  VQSSDYFAGKTVALFAVPGAFTPTCSAKHLPGFVDKADELKAKGVDEIVATSVNDAFVMG 84

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           AW +     ++ +L DG+GEF ++ G+       G G RS RY  L++D VV+   VE  
Sbjct: 85  AWKQSAGSDDITMLADGNGEFAKETGLDADFTGFGMGHRSQRYSMLVEDGVVKQLNVE-- 142

Query: 151 FSDNCATDPYEISSPENVL 169
                A   + +SS E++L
Sbjct: 143 -----APGDFSVSSAEHML 156


>gi|83945316|ref|ZP_00957664.1| AhpC/TSA family protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851150|gb|EAP89007.1| AhpC/TSA family protein [Oceanicaulis alexandrii HTCC2633]
          Length = 160

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/168 (39%), Positives = 97/168 (57%), Gaps = 17/168 (10%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P V F     T+  DG +      ++T D+F GKRV LFA+PGA+TPTCS   LPGF +
Sbjct: 9   LPDVTFM----TMTADGPQP-----MSTDDVFGGKRVALFAVPGAYTPTCSAKHLPGFIE 59

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNV 124
              +L+ +G++ + C SVND FVM AWGK      +V +L DG+G+F   +G+ +     
Sbjct: 60  KAAELQAKGVDRIACTSVNDVFVMGAWGKDQGAGDDVLMLADGNGDFASALGLEMDGSAF 119

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G G RS RY  ++ D  VE  FV+E          +E+SS E++LK +
Sbjct: 120 GMGKRSQRYALVVNDKKVEHVFVDE-------PGNFEVSSAEHMLKAL 160


>gi|53726049|ref|YP_104087.1| AhpC/TSA family protein [Burkholderia mallei ATCC 23344]
 gi|121598876|ref|YP_991814.1| AhpC/TSA family protein [Burkholderia mallei SAVP1]
 gi|52429472|gb|AAU50065.1| AhpC/TSA family protein [Burkholderia mallei ATCC 23344]
 gi|121227686|gb|ABM50204.1| AhpC/TSA family protein [Burkholderia mallei SAVP1]
          Length = 214

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 101/180 (56%), Gaps = 24/180 (13%)

Query: 3   RFQIPQVVFHMRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGA 50
           R++ P ++   +V   LPD ++ F++ D               ++  AGKRV +F LPGA
Sbjct: 41  RYEGPGMI---QVGDTLPD-AQLFEYLDDARAGCTLGPNAFGVREQTAGKRVVIFGLPGA 96

Query: 51  FTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSG 109
           FTPTCS   +PG+    + LR  GI+E++C++VNDAFVM AWG+ L     V+++ DGS 
Sbjct: 97  FTPTCSAQHVPGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSA 156

Query: 110 EFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            FT  +G+       G G+RS RY  ++ D VV++ FVE       A   +E+S   +VL
Sbjct: 157 AFTHALGLTQDLSARGMGIRSRRYAMVVDDGVVKTLFVE-------APGKFEVSDAASVL 209


>gi|254246413|ref|ZP_04939734.1| Alkyl hydroperoxide reductase [Burkholderia cenocepacia PC184]
 gi|124871189|gb|EAY62905.1| Alkyl hydroperoxide reductase [Burkholderia cenocepacia PC184]
          Length = 168

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + +D  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  G++E++C+SVNDAFVM A
Sbjct: 32  SVRDQVAGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLRAAGVDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FT  +G+       G G+RS RY  +I   VV++  VE  
Sbjct: 92  WGRDLHTAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVIDGGVVKTLAVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   +VL  +
Sbjct: 150 -----APGKFEVSDAASVLATL 166


>gi|126450084|ref|YP_001082756.1| AhpC/TSA family protein [Burkholderia mallei NCTC 10247]
 gi|126242954|gb|ABO06047.1| AhpC/TSA family protein [Burkholderia mallei NCTC 10247]
          Length = 185

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 101/180 (56%), Gaps = 24/180 (13%)

Query: 3   RFQIPQVVFHMRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGA 50
           R++ P ++   +V   LPD ++ F++ D               ++  AGKRV +F LPGA
Sbjct: 12  RYEGPGMI---QVGDTLPD-AQLFEYLDDARAGCTLGPNAFGVREQTAGKRVVIFGLPGA 67

Query: 51  FTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSG 109
           FTPTCS   +PG+    + LR  GI+E++C++VNDAFVM AWG+ L     V+++ DGS 
Sbjct: 68  FTPTCSAQHVPGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSA 127

Query: 110 EFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            FT  +G+       G G+RS RY  ++ D VV++ FVE       A   +E+S   +VL
Sbjct: 128 AFTHALGLTQDLSARGMGIRSRRYAMVVDDGVVKTLFVE-------APGKFEVSDAASVL 180


>gi|254283298|ref|ZP_04958266.1| peroxiredoxin-2E-1 [gamma proteobacterium NOR51-B]
 gi|219679501|gb|EED35850.1| peroxiredoxin-2E-1 [gamma proteobacterium NOR51-B]
          Length = 159

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 88/142 (61%), Gaps = 7/142 (4%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           + T +LF GK+V LFA+PGAFTP CS   LPGF    D ++  G++ + C+SVNDAFVM+
Sbjct: 25  ITTGELFNGKKVLLFAVPGAFTPGCSMTHLPGFVVNADKIKASGVDSIICMSVNDAFVMD 84

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           AWGK+   + + +L DG+G+FT  +G+++     G G RS R+  +++D  V +  ++E 
Sbjct: 85  AWGKQQNAEAITMLADGNGDFTEALGLVLDARGFGLGTRSKRFAMIVEDGTVTALNIDE- 143

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                     ++SS E ++ ++
Sbjct: 144 ------DGGVDVSSAETMMALL 159


>gi|207721497|ref|YP_002251937.1| thioredoxin fold-haboring protein [Ralstonia solanacearum MolK2]
 gi|206586657|emb|CAQ17243.1| thioredoxin fold-haboring protein [Ralstonia solanacearum MolK2]
          Length = 171

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 86/139 (61%), Gaps = 8/139 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  DL  GK + +F LPGAFTPTCS   +PG+   YD LR +G++E++C+SVNDAFVM A
Sbjct: 37  SAADLAQGKTILIFGLPGAFTPTCSARHVPGYLAHYDALRAKGVDEIWCVSVNDAFVMGA 96

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           W +       V++L DGS EFTRK+G+       G G+RS RY  ++++ VV +  VE  
Sbjct: 97  WARAQGTDGRVRMLADGSAEFTRKLGLEQDLSKRGMGVRSQRYAMIVRNGVVTALQVE-- 154

Query: 151 FSDNCATDPYEISSPENVL 169
                A   + +S+ E++L
Sbjct: 155 -----APGQFAVSNAESML 168


>gi|300702968|ref|YP_003744570.1| peroxiredoxin [Ralstonia solanacearum CFBP2957]
 gi|299070631|emb|CBJ41926.1| peroxiredoxin [Ralstonia solanacearum CFBP2957]
          Length = 171

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 86/139 (61%), Gaps = 8/139 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  DL  GK + +F LPGAFTPTCS   +PG+   YD LR +G++E++C+SVNDAFVM A
Sbjct: 37  SAADLAQGKTILIFGLPGAFTPTCSARHVPGYLTHYDALRAKGVDEIWCVSVNDAFVMGA 96

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           W +       V++L DGS EFTRK+G+       G G+RS RY  ++++ VV +  VE  
Sbjct: 97  WARAQGTDGRVRMLADGSAEFTRKLGLEQDLSKRGMGVRSQRYAMIVRNGVVTALQVE-- 154

Query: 151 FSDNCATDPYEISSPENVL 169
                A   + +S+ E++L
Sbjct: 155 -----APGQFAVSNAESML 168


>gi|167837997|ref|ZP_02464856.1| AhpC/TSA family protein [Burkholderia thailandensis MSMB43]
          Length = 168

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/173 (37%), Positives = 97/173 (56%), Gaps = 21/173 (12%)

Query: 13  MRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++V   LPD ++ F++ D               ++  AGKRV +F LPGAFTPTCS   +
Sbjct: 2   IQVGDTLPD-AQLFEYLDDARAGCTLGPNAFGVREQAAGKRVVIFGLPGAFTPTCSAQHV 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
           PG+    + LR  GI+E++C++VNDAFVM AWG+ L     V+++ DGS  FT  +G+  
Sbjct: 61  PGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQ 120

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
                G G+RS RY  ++ D VV++ FVE       A   +E+S   +VL  +
Sbjct: 121 DLSARGMGIRSRRYAMVVDDGVVKTLFVE-------APGKFEVSDAASVLASL 166


>gi|76809917|ref|YP_334908.1| AhpC/TSA family protein [Burkholderia pseudomallei 1710b]
 gi|217425692|ref|ZP_03457182.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 576]
 gi|237813913|ref|YP_002898364.1| AhpC/TSA family protein [Burkholderia pseudomallei MSHR346]
 gi|254261496|ref|ZP_04952550.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 1710a]
 gi|76579370|gb|ABA48845.1| AhpC/TSA family protein [Burkholderia pseudomallei 1710b]
 gi|217391280|gb|EEC31312.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 576]
 gi|237504361|gb|ACQ96679.1| AhpC/TSA family protein [Burkholderia pseudomallei MSHR346]
 gi|254220185|gb|EET09569.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 1710a]
          Length = 214

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 101/180 (56%), Gaps = 24/180 (13%)

Query: 3   RFQIPQVVFHMRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGA 50
           R++ P ++   +V   LPD ++ F++ D               ++  AGKRV +F LPGA
Sbjct: 41  RYEGPGMI---QVGDTLPD-AQLFEYLDDARAGCTPGPNAFGVREQTAGKRVVIFGLPGA 96

Query: 51  FTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSG 109
           FTPTCS   +PG+    + LR  GI+E++C++VNDAFVM AWG+ L     V+++ DGS 
Sbjct: 97  FTPTCSAQHVPGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSA 156

Query: 110 EFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            FT  +G+       G G+RS RY  ++ D VV++ FVE       A   +E+S   +VL
Sbjct: 157 AFTHALGLTQDLSARGMGIRSRRYAMVVDDGVVKTLFVE-------APGKFEVSDAASVL 209


>gi|226505300|ref|NP_001149765.1| LOC100283392 [Zea mays]
 gi|194698866|gb|ACF83517.1| unknown [Zea mays]
 gi|195610864|gb|ACG27262.1| peroxiredoxin-5 [Zea mays]
 gi|195633067|gb|ACG36717.1| peroxiredoxin-5 [Zea mays]
          Length = 162

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 94/166 (56%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   LPDG   +     Q + V+   L AGK+V LF +PGAFTPTCS+  +PGF    
Sbjct: 4   IAVGDALPDGQLGWFDENDQLQQVSVHALAAGKKVILFGVPGAFTPTCSNQHVPGFITQA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           + L+ +G++E+  +SVND FVM AW K   E K+VK L DGSG +T+ + + +   + G 
Sbjct: 64  EQLKAKGVDEILLISVNDPFVMKAWAKTYPENKHVKFLADGSGAYTKALDLELDLTDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L  D+ V    +EEG         + IS  E +LK +
Sbjct: 124 GVRSKRFALLADDLTVTVANIEEGGQ-------FTISGAEEILKAL 162


>gi|167721333|ref|ZP_02404569.1| antioxidant, AhpC/TSA family protein [Burkholderia pseudomallei
           DM98]
          Length = 168

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 96/170 (56%), Gaps = 21/170 (12%)

Query: 13  MRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++V   LPD ++ F++ D               ++  AGKRV +F LPGAFTPTCS   +
Sbjct: 2   IQVGDTLPD-AQLFEYLDDARAGRTPGPNAFGVREQTAGKRVVIFGLPGAFTPTCSAQHV 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
           PG+    + LR  GI+E++C++VNDAFVM AWG+ L     V+++ DGS  FT  +G+  
Sbjct: 61  PGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQ 120

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
                G G+RS RY  ++ D VV++ FVE       A   +E+S   +VL
Sbjct: 121 DLSARGMGIRSRRYAMVVDDGVVKTLFVE-------APGKFEVSDAASVL 163


>gi|92113257|ref|YP_573185.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Chromohalobacter salexigens DSM 3043]
 gi|91796347|gb|ABE58486.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Chromohalobacter salexigens DSM 3043]
          Length = 158

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 77/121 (63%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           +D++T + FAGKRV LFA+PGAFTP CS+  +PGF    DD+  +G++ + CL+VNDAFV
Sbjct: 23  EDLDTGEFFAGKRVVLFAVPGAFTPGCSNTHMPGFVINADDILAKGVDAIACLAVNDAFV 82

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           + AW +    + + +L DG  +FTR +GM       G G RS RY  ++ D VV    V+
Sbjct: 83  LGAWQQDQNAQAITMLADGHADFTRAIGMEKDASGAGMGTRSQRYAMIVDDGVVSYLGVD 142

Query: 149 E 149
           E
Sbjct: 143 E 143


>gi|281398224|gb|ADA67935.1| putative thioredoxin-dependent peroxidase [Wolffia arrhiza]
          Length = 162

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/164 (39%), Positives = 94/164 (57%), Gaps = 13/164 (7%)

Query: 15  VATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           V   +PDG+  +       K V+   L AGK++ LF +PGAFTPTCS   +PGF +  D+
Sbjct: 6   VGDTIPDGNLGWFDENDDLKQVSVHSLAAGKKIVLFGVPGAFTPTCSMKHVPGFIEGADE 65

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
           L+ +G++++ C+SVND FVM AW K   E K+VK L DGS  +T  +G+ +     G G 
Sbjct: 66  LKSKGVDQILCISVNDPFVMKAWAKTYPENKDVKFLADGSATYTHALGLELDLSEKGLGT 125

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           RS R+  L+ D+ V+   VEEG         + IS  E +LK +
Sbjct: 126 RSRRFALLVDDLKVKVANVEEGGQ-------FTISGAEEILKAL 162


>gi|90420107|ref|ZP_01228015.1| peroxiredoxin, ahpC/TSA family [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90335441|gb|EAS49191.1| peroxiredoxin, ahpC/TSA family [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 161

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 83/121 (68%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           D++T ++FAGK+V LFA+PGAFTPTCS + LPGF    D++R +G++ +  ++VND FVM
Sbjct: 24  DLSTDEIFAGKKVVLFAVPGAFTPTCSMNHLPGFLTHNDEIRAKGVDTIAVVAVNDIFVM 83

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW K  E    +  L DG+GEFT+ +G+ +     G GLRS RY  ++++ VV+S  VE
Sbjct: 84  GAWEKANEAAGKILFLSDGNGEFTKALGLDIDLSVAGLGLRSKRYSMIVENGVVKSLNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|307731066|ref|YP_003908290.1| Redoxin domain-containing protein [Burkholderia sp. CCGE1003]
 gi|307585601|gb|ADN58999.1| Redoxin domain protein [Burkholderia sp. CCGE1003]
          Length = 167

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 87/142 (61%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  G++E++C+SVNDAFVM A
Sbjct: 32  DVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHAEQLRAAGVDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FTR +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLNVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   ++L  +
Sbjct: 150 -----AAGKFEVSDAGSILATL 166


>gi|254178960|ref|ZP_04885614.1| AhpC/TSA family protein [Burkholderia mallei ATCC 10399]
 gi|254202809|ref|ZP_04909172.1| AhpC/TSA family protein [Burkholderia mallei FMH]
 gi|254208151|ref|ZP_04914501.1| AhpC/TSA family protein [Burkholderia mallei JHU]
 gi|254357645|ref|ZP_04973919.1| AhpC/TSA family protein [Burkholderia mallei 2002721280]
 gi|147747056|gb|EDK54133.1| AhpC/TSA family protein [Burkholderia mallei FMH]
 gi|147752045|gb|EDK59112.1| AhpC/TSA family protein [Burkholderia mallei JHU]
 gi|148026709|gb|EDK84794.1| AhpC/TSA family protein [Burkholderia mallei 2002721280]
 gi|160694874|gb|EDP84882.1| AhpC/TSA family protein [Burkholderia mallei ATCC 10399]
          Length = 168

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 96/170 (56%), Gaps = 21/170 (12%)

Query: 13  MRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++V   LPD ++ F++ D               ++  AGKRV +F LPGAFTPTCS   +
Sbjct: 2   IQVGDTLPD-AQLFEYLDDARAGCTLGPNAFGVREQTAGKRVVIFGLPGAFTPTCSAQHV 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
           PG+    + LR  GI+E++C++VNDAFVM AWG+ L     V+++ DGS  FT  +G+  
Sbjct: 61  PGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQ 120

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
                G G+RS RY  ++ D VV++ FVE       A   +E+S   +VL
Sbjct: 121 DLSARGMGIRSRRYAMVVDDGVVKTLFVE-------APGKFEVSDAASVL 163


>gi|171060659|ref|YP_001793008.1| redoxin domain-containing protein [Leptothrix cholodnii SP-6]
 gi|170778104|gb|ACB36243.1| Redoxin domain protein [Leptothrix cholodnii SP-6]
          Length = 168

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 85/134 (63%), Gaps = 8/134 (5%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK-KL 96
           AGK V +FALPGAFTPTCS   +PG+ +  D L+  G++E++CLSVNDAFVM AWG+ + 
Sbjct: 38  AGKTVAIFALPGAFTPTCSAQHVPGYVQAADALKAAGVDEIWCLSVNDAFVMGAWGRDQG 97

Query: 97  EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               V+++ DGSG FT+  G+ +     G GLRS RY  L+ D VV++  VE       A
Sbjct: 98  TAGKVRMMADGSGTFTQATGLTLDLVARGMGLRSQRYSMLVVDGVVKTLNVE-------A 150

Query: 157 TDPYEISSPENVLK 170
              +E+S  + +L+
Sbjct: 151 PGKFEVSDAQTMLR 164


>gi|167034084|ref|YP_001669315.1| redoxin domain-containing protein [Pseudomonas putida GB-1]
 gi|166860572|gb|ABY98979.1| Redoxin domain protein [Pseudomonas putida GB-1]
          Length = 166

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/172 (38%), Positives = 97/172 (56%), Gaps = 15/172 (8%)

Query: 5   QIPQVVFHM--RVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG 62
           Q+P V  +     A     G  AF  ++   Q     K+V +FALPGAFTPTCS+  +PG
Sbjct: 7   QLPDVTLYQYNTDAGACAIGPNAFSIRERCKQ-----KKVLIFALPGAFTPTCSERHVPG 61

Query: 63  FEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYK 121
           +      L   GI+E+ C+SVNDAFVMNAWG  L++ + VK++ DG+GEF+  +G++   
Sbjct: 62  YVAEAPALFAAGIDEILCVSVNDAFVMNAWGNSLQVGDAVKMIGDGNGEFSEALGLIQDL 121

Query: 122 DNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
              G G RS RY  L+ D+VV+   VE       A   +E+S   ++L  +R
Sbjct: 122 SARGMGRRSQRYAMLVDDLVVKHIAVE-------APGKFEVSDAASMLAALR 166


>gi|294463633|gb|ADE77344.1| unknown [Picea sitchensis]
          Length = 261

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 81/123 (65%), Gaps = 3/123 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           +   DL  GK+V L A+PGAFTPTCS   LPGF +  D+L+ +GI+ + C+SVNDAFVM 
Sbjct: 124 ITVSDLTRGKKVVLLAVPGAFTPTCSQKHLPGFVQRADELKSKGIDTIACISVNDAFVMK 183

Query: 91  AWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDN--VGFGLRSWRYGALIKDMVVESWFV 147
           AWG  L +  NV LL DG+G FT+ MG+ +   +   G G+RS RY  + +D +V+   +
Sbjct: 184 AWGDNLNVDDNVLLLADGNGYFTKAMGVALDLSDKPAGLGVRSKRYALVAEDGIVKILKL 243

Query: 148 EEG 150
           EEG
Sbjct: 244 EEG 246


>gi|312115956|ref|YP_004013552.1| redoxin [Rhodomicrobium vannielii ATCC 17100]
 gi|311221085|gb|ADP72453.1| Redoxin domain protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 161

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           DV+T +LF GK+  LFA+PGAFTPTCS   LPGF +  DD + +G++ V C +VND FV+
Sbjct: 24  DVSTDELFGGKKAVLFAVPGAFTPTCSLAHLPGFIEHADDFKAKGVDVVACTAVNDVFVL 83

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AW K     + +  L DGSG+F + +G+ +     G GLRS RY  L++D VV++  VE
Sbjct: 84  DAWAKSTGAGDKIVFLADGSGDFAKAIGLDLDAGGFGLGLRSKRYAMLLEDGVVKALHVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|328471027|gb|EGF41938.1| putative antioxidant [Vibrio parahaemolyticus 10329]
          Length = 157

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 89/142 (62%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C++VNDAFVMNA
Sbjct: 25  DVTELFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADQLKAKGVDLIACVAVNDAFVMNA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   FT+ +G+    D  GF G+RS RY  LI++ VV +  VE+ 
Sbjct: 85  WGEAQNASEILMLGDGDASFTKALGL--EMDTGGFGGVRSQRYAMLIENGVVTTLNVEK- 141

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                    +E+S+ E +L  +
Sbjct: 142 ------PSEFEVSNAETILAAL 157


>gi|53720629|ref|YP_109615.1| putative redoxin [Burkholderia pseudomallei K96243]
 gi|126440786|ref|YP_001060529.1| anti-oxidant AhpCTSA family protein [Burkholderia pseudomallei 668]
 gi|126454386|ref|YP_001067780.1| anti-oxidant AhpCTSA family protein [Burkholderia pseudomallei
           1106a]
 gi|134280543|ref|ZP_01767254.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 305]
 gi|167740303|ref|ZP_02413077.1| AhpC/TSA family protein [Burkholderia pseudomallei 14]
 gi|167817522|ref|ZP_02449202.1| AhpC/TSA family protein [Burkholderia pseudomallei 91]
 gi|167825922|ref|ZP_02457393.1| AhpC/TSA family protein [Burkholderia pseudomallei 9]
 gi|167847408|ref|ZP_02472916.1| AhpC/TSA family protein [Burkholderia pseudomallei B7210]
 gi|167895996|ref|ZP_02483398.1| AhpC/TSA family protein [Burkholderia pseudomallei 7894]
 gi|167904383|ref|ZP_02491588.1| AhpC/TSA family protein [Burkholderia pseudomallei NCTC 13177]
 gi|167912643|ref|ZP_02499734.1| AhpC/TSA family protein [Burkholderia pseudomallei 112]
 gi|167920610|ref|ZP_02507701.1| AhpC/TSA family protein [Burkholderia pseudomallei BCC215]
 gi|226199589|ref|ZP_03795145.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei Pakistan 9]
 gi|242317845|ref|ZP_04816861.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 1106b]
 gi|254180552|ref|ZP_04887150.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 1655]
 gi|254191006|ref|ZP_04897512.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei Pasteur
           52237]
 gi|254199018|ref|ZP_04905433.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei S13]
 gi|254299360|ref|ZP_04966810.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 406e]
 gi|52211043|emb|CAH37031.1| putative redoxin [Burkholderia pseudomallei K96243]
 gi|126220279|gb|ABN83785.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 668]
 gi|126228028|gb|ABN91568.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 1106a]
 gi|134248550|gb|EBA48633.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 305]
 gi|157808757|gb|EDO85927.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 406e]
 gi|157938680|gb|EDO94350.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei Pasteur
           52237]
 gi|169656848|gb|EDS88245.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei S13]
 gi|184211091|gb|EDU08134.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 1655]
 gi|225928335|gb|EEH24366.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei Pakistan 9]
 gi|242141084|gb|EES27486.1| antioxidant, AhpC/TSA family [Burkholderia pseudomallei 1106b]
          Length = 168

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 96/170 (56%), Gaps = 21/170 (12%)

Query: 13  MRVATVLPDGSKAFQWKD------------VNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           ++V   LPD ++ F++ D               ++  AGKRV +F LPGAFTPTCS   +
Sbjct: 2   IQVGDTLPD-AQLFEYLDDARAGCTPGPNAFGVREQTAGKRVVIFGLPGAFTPTCSAQHV 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
           PG+    + LR  GI+E++C++VNDAFVM AWG+ L     V+++ DGS  FT  +G+  
Sbjct: 61  PGYVAHAEPLRSAGIDEIWCVAVNDAFVMGAWGRDLHTAGKVRMMADGSAAFTHALGLTQ 120

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
                G G+RS RY  ++ D VV++ FVE       A   +E+S   +VL
Sbjct: 121 DLSARGMGIRSRRYAMVVDDGVVKTLFVE-------APGKFEVSDAASVL 163


>gi|330815449|ref|YP_004359154.1| AhpC/TSA family protein [Burkholderia gladioli BSR3]
 gi|327367842|gb|AEA59198.1| AhpC/TSA family protein [Burkholderia gladioli BSR3]
          Length = 168

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 87/144 (60%), Gaps = 8/144 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++ ++  AGKRV +F LPGAFTPTCS   +PG+ + +D  R  GI+E++C+SVNDAFVM 
Sbjct: 31  LDVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEQFDAFRAAGIDEIWCVSVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWG+       V+++ DGS  FT  +G+       G G+RS RY  ++ D VV++  VE 
Sbjct: 91  AWGRDQHTAGKVRMIADGSAAFTHALGLTQDLSARGMGIRSQRYAMVVDDGVVKTLAVE- 149

Query: 150 GFSDNCATDPYEISSPENVLKVIR 173
                 A   +E+S   ++L  ++
Sbjct: 150 ------APGKFEVSDAASILAAVK 167


>gi|91794888|ref|YP_564539.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Shewanella denitrificans OS217]
 gi|91716890|gb|ABE56816.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Shewanella denitrificans OS217]
          Length = 157

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 95/165 (57%), Gaps = 14/165 (8%)

Query: 13  MRVATVLPDGSKAFQWKD--VNTQ--DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           + V   LP  +     KD  VN Q  DLFAGK+V LFA+PGAFTPTCS+  LPG+  + D
Sbjct: 2   ISVGQQLPSATLGQLTKDGMVNHQVSDLFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLAD 61

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-G 127
           + + +G++ + C+SVNDAFVM AWG+      + +L DG   FT+ +G+ +  D   F G
Sbjct: 62  EFKAKGVDMIACISVNDAFVMKAWGEAQNASELMMLADGDASFTKALGLEM--DTAAFGG 119

Query: 128 LRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           +RS RY  +I++  V    VE       A   +E+S  E +L  +
Sbjct: 120 VRSQRYAMVIENGKVTMLNVE-------AAKSFEVSKAEAILAAL 157


>gi|167586027|ref|ZP_02378415.1| Redoxin domain protein [Burkholderia ubonensis Bu]
          Length = 168

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 83/137 (60%), Gaps = 8/137 (5%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE 97
           AGKRV +F LPGAFTPTCS   +PG+ +  + L   GI+E++C+SVNDAFVM AWG+ L 
Sbjct: 38  AGKRVVIFGLPGAFTPTCSAQHVPGYVEHAEQLHAAGIDEIWCVSVNDAFVMGAWGRDLH 97

Query: 98  IKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               V+++ DGS  FT  +G+       G G+RS RY  ++ D VV++  VE       A
Sbjct: 98  TAGKVRMMADGSAAFTHALGLTQDLSARGMGIRSLRYAMVVDDGVVKTLAVE-------A 150

Query: 157 TDPYEISSPENVLKVIR 173
              +E+S   +VL  ++
Sbjct: 151 PGKFEVSDAASVLATLK 167


>gi|197104020|ref|YP_002129397.1| peroxiredoxin [Phenylobacterium zucineum HLK1]
 gi|196477440|gb|ACG76968.1| peroxiredoxin [Phenylobacterium zucineum HLK1]
          Length = 160

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 85/123 (69%), Gaps = 1/123 (0%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V++++ F GK V LFA+PGAFTPTCS   LPGF++    L+ +G++E+ CLSVNDAFV
Sbjct: 23  RPVSSEEFFKGKTVALFAVPGAFTPTCSAKHLPGFKQEAGALKGKGVDEIACLSVNDAFV 82

Query: 89  MNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AW +   + +++ +L DG+G+FT+ +G+ +     G G RS RY  +++D VV+   V
Sbjct: 83  MRAWAEDQAVGEDITMLADGNGDFTKAIGLEMDGSKFGMGPRSQRYSMIVEDGVVKQLNV 142

Query: 148 EEG 150
           E+G
Sbjct: 143 EQG 145


>gi|77361565|ref|YP_341140.1| peroxiredoxin AhpC/Tsa [Pseudoalteromonas haloplanktis TAC125]
 gi|76876476|emb|CAI87698.1| Peroxiredoxin, AhpC/Tsa family [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 157

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 81/122 (66%), Gaps = 3/122 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + +   +LFA K+V LFA+PGAFTPTCS+  LP F  + D ++ +G++ +YC+SVNDAFV
Sbjct: 22  QTLTNSELFADKKVVLFAVPGAFTPTCSNAHLPEFITLADKIKAKGVDAIYCVSVNDAFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFV 147
           M AWG     + + +L DG   FT+ +G+ +  +  GF G+RS RY  ++++ VV   FV
Sbjct: 82  MKAWGASQNAQKIAMLADGDASFTKALGLDM--NTAGFGGVRSKRYAMIVENSVVTGLFV 139

Query: 148 EE 149
           E+
Sbjct: 140 EQ 141


>gi|323500022|ref|ZP_08104976.1| antioxidant putative [Vibrio sinaloensis DSM 21326]
 gi|323314878|gb|EGA67935.1| antioxidant putative [Vibrio sinaloensis DSM 21326]
          Length = 158

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 84/143 (58%), Gaps = 10/143 (6%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           NT  LFA KRV LFA+PGAFTPTCS+  LPG+  + D L+  G++ + C+SVNDAFVM A
Sbjct: 25  NTDALFANKRVVLFAVPGAFTPTCSEAHLPGYVVLADQLKAAGVDLIACVSVNDAFVMKA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG       + +L DG   FT+ +G+ +  D  GF G+RS RY  ++ + VV    VEE 
Sbjct: 85  WGDAQNASEIMMLGDGDASFTKALGLDM--DTAGFGGVRSQRYAMVVDNGVVTILNVEE- 141

Query: 151 FSDNCATDPYEISSPENVLKVIR 173
                    +E S  E +L  ++
Sbjct: 142 ------PKQFEASKAETILAALK 158


>gi|119776645|ref|YP_929385.1| anti-oxidant AhpCTSA family protein [Shewanella amazonensis SB2B]
 gi|119769145|gb|ABM01716.1| antioxidant, AhpC/Tsa family [Shewanella amazonensis SB2B]
          Length = 157

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 86/141 (60%), Gaps = 8/141 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + Q LFAGK+  +FA+PGAFTPTCS   LPG+  + D+++ +G++ + C+SVNDAFVM A
Sbjct: 25  DVQSLFAGKKAVVFAVPGAFTPTCSAAHLPGYVVLADEIKAKGVDFIACISVNDAFVMKA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG       +K+L DG G+FT+ +G+ +     G G+RS RY  ++ + VV    VE   
Sbjct: 85  WGDAQNAAEIKMLADGDGQFTQALGLTMDTGAFG-GVRSQRYAMVVDNGVVTLLNVE--- 140

Query: 152 SDNCATDPYEISSPENVLKVI 172
               A   +E+S  E VL  +
Sbjct: 141 ----APKAFEVSKAEVVLAAL 157


>gi|114800089|ref|YP_759774.1| anti-oxidant AhpCTSA family protein [Hyphomonas neptunium ATCC
           15444]
 gi|114740263|gb|ABI78388.1| antioxidant, AhpC/TSA family [Hyphomonas neptunium ATCC 15444]
          Length = 160

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 77/123 (62%), Gaps = 1/123 (0%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K V T  +F GK V LFA+PGA+TPTCS   LPG+     D + +G++E+ C SVND FV
Sbjct: 23  KPVTTAQVFGGKTVALFAVPGAYTPTCSARHLPGYVDKAGDFKAKGVDEIVCTSVNDVFV 82

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AWGK  + +  V++L DG+G F + +G+ +     G G RS RY  L+KD VV    V
Sbjct: 83  MGAWGKSSKAEEAVRMLADGNGAFAQSLGLELDASGFGMGKRSQRYSMLVKDGVVAELNV 142

Query: 148 EEG 150
           E+G
Sbjct: 143 EQG 145


>gi|238026138|ref|YP_002910369.1| AhpC/TSA family protein [Burkholderia glumae BGR1]
 gi|237875332|gb|ACR27665.1| AhpC/TSA family protein [Burkholderia glumae BGR1]
          Length = 168

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 87/143 (60%), Gaps = 8/143 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           +  ++  AGKRV +F LPGAFTPTCS   +PG+ ++ + LR  G++EV+C+SVNDAFVM 
Sbjct: 31  LGVREQTAGKRVVIFGLPGAFTPTCSARHVPGYVELAEPLRAAGVDEVWCVSVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWG+ L     V+++ DGS   T+ +G+       G G+RS RY  ++ D VV++  VE 
Sbjct: 91  AWGRDLHTAGKVRMIADGSAALTQALGLTQDLSARGMGIRSQRYAMVVDDGVVKTLAVE- 149

Query: 150 GFSDNCATDPYEISSPENVLKVI 172
                 A   +E+S   ++L  +
Sbjct: 150 ------APGKFEVSDAASILAAL 166


>gi|255640689|gb|ACU20629.1| unknown [Glycine max]
          Length = 232

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 96/157 (61%), Gaps = 8/157 (5%)

Query: 2   IRFQIPQVVFHMRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCS 56
           +RF    +   + V   LP+ + ++     + +     +L  GK+  LFA+PGAFTPTCS
Sbjct: 44  LRFSSSTITATISVGDKLPEATFSYLDSSGEVQTTTVSELTKGKKAVLFAVPGAFTPTCS 103

Query: 57  DHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKM 115
              +PGF +   +LR +GI+ + C+SVNDAFVM AW + L++ + V LL DG+G FT+ +
Sbjct: 104 QKHVPGFVEKSGELRAKGIDTIACISVNDAFVMKAWKEDLKVNEEVLLLSDGNGTFTKAI 163

Query: 116 GM-LVYKDN-VGFGLRSWRYGALIKDMVVESWFVEEG 150
           G+ L   D  VG G+RS RY  L +D VV+ + +EEG
Sbjct: 164 GVELDLSDKPVGLGVRSRRYALLAEDGVVKLFNLEEG 200


>gi|260770331|ref|ZP_05879264.1| antioxidant AhpC/Tsa family [Vibrio furnissii CIP 102972]
 gi|260615669|gb|EEX40855.1| antioxidant AhpC/Tsa family [Vibrio furnissii CIP 102972]
 gi|315181400|gb|ADT88313.1| Peroxiredoxin [Vibrio furnissii NCTC 11218]
          Length = 157

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/159 (39%), Positives = 94/159 (59%), Gaps = 14/159 (8%)

Query: 19  LPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           LP+ + +   KD     N  +LFAGK+V LFA+PGAFTPTCS+  LPG+    D L+ +G
Sbjct: 8   LPEATLSQLTKDGMVHHNVNELFAGKKVVLFAVPGAFTPTCSEEHLPGYVVQADKLKAKG 67

Query: 75  IEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRY 133
           ++ + C++VNDAFVM +WG+      + +L DG   FT+ +G+ +  D  GF G+RS RY
Sbjct: 68  VDIIACVAVNDAFVMKSWGEAQNASELMMLADGDASFTKALGLEM--DTAGFGGVRSQRY 125

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
             +I + VV +  VE       A   +E+S  E +L  +
Sbjct: 126 AMIIDNGVVTTLNVE-------APKSFEVSKAEAILAAL 157


>gi|85711542|ref|ZP_01042600.1| Peroxiredoxin, AhpC/Tsa family protein [Idiomarina baltica OS145]
 gi|85694694|gb|EAQ32634.1| Peroxiredoxin, AhpC/Tsa family protein [Idiomarina baltica OS145]
          Length = 162

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 101/165 (61%), Gaps = 15/165 (9%)

Query: 18  VLPDGSKAFQW----KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE 73
           +LP GS   +     +  + Q+LFA     LFA+PGAFTPTCS+  LPG+  + ++L  +
Sbjct: 7   LLPAGSLTSKGELGIQHYDPQELFAKGTHILFAVPGAFTPTCSEKHLPGYVSLANELAEQ 66

Query: 74  GIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSW 131
           G++ + C+SVNDAFVM AWG  L I + V+LL DG+GE+++ +G+    D   F G+RS 
Sbjct: 67  GVQSINCVSVNDAFVMKAWGDHLGIGDEVRLLSDGNGEYSQTLGLA--NDTGAFGGIRSK 124

Query: 132 RYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           RY  +I D +VE  FVE+          +E+S+ + VL V++  +
Sbjct: 125 RYAMIIVDGIVEHLFVED-------EKQFEVSAAKYVLNVLKSEQ 162


>gi|88705528|ref|ZP_01103238.1| AhpC/TSA family protein [Congregibacter litoralis KT71]
 gi|88700041|gb|EAQ97150.1| AhpC/TSA family protein [Congregibacter litoralis KT71]
          Length = 159

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 89/142 (62%), Gaps = 7/142 (4%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+T +LF+GK+V LFA+PGAFTP CS   LPG+    D +   G++ + CLSVNDAFVM+
Sbjct: 25  VSTDELFSGKKVVLFAVPGAFTPGCSMTHLPGYVVNADKILASGVDTIACLSVNDAFVMD 84

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           AWGK    +++ +L DG+G+FT+ + + +     G GLRS RY  ++++  + +  VE G
Sbjct: 85  AWGKAQNAEHIMMLADGNGDFTKALDLELDGRGFGMGLRSQRYAMIVENGTITTLNVEPG 144

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                     ++S+ E +++ +
Sbjct: 145 AG-------VDVSAAETIMEAL 159


>gi|21230504|ref|NP_636421.1| peroxiredoxin [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66769502|ref|YP_244264.1| peroxiredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|188992693|ref|YP_001904703.1| putative peroxiredoxin [Xanthomonas campestris pv. campestris str.
           B100]
 gi|21112072|gb|AAM40345.1| peroxiredoxin [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66574834|gb|AAY50244.1| peroxiredoxin [Xanthomonas campestris pv. campestris str. 8004]
 gi|167734453|emb|CAP52663.1| putative peroxiredoxin [Xanthomonas campestris pv. campestris]
          Length = 160

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 90/147 (61%), Gaps = 14/147 (9%)

Query: 5   QIPQVVF-HMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGF 63
           +IP+VV  H+R      +G +A     V+T  LF G++V LFA+PGAFTPTCS   LPG+
Sbjct: 8   RIPEVVLKHLR------EGIEA-----VDTHTLFTGRKVVLFAVPGAFTPTCSAKHLPGY 56

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK-KLEIKNVKLLPDGSGEFTRKMGMLVYKD 122
            + ++  R  GI EV C +VND FVM AWG+ +L    + L+PDG+ E  R +G+ +   
Sbjct: 57  VEQFEAFRKRGI-EVLCTAVNDPFVMQAWGRSQLVPDGLHLVPDGNAELARALGLEIDAS 115

Query: 123 NVGFGLRSWRYGALIKDMVVESWFVEE 149
             G GLRS RY     D VV++ FVEE
Sbjct: 116 GSGMGLRSRRYALYADDGVVKALFVEE 142


>gi|311696512|gb|ADP99385.1| antioxidant, AhpC/Tsa family protein [marine bacterium HP15]
          Length = 158

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 72/113 (63%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V T +LFAGK+  LFA+PGAFTPTCS   LPGF    D LR +GI+ + C SVNDAFVM+
Sbjct: 25  VRTSELFAGKKAVLFAVPGAFTPTCSAAHLPGFVVNADKLRAKGIDSIVCTSVNDAFVMD 84

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVE 143
           AWGK    + + +L DG  EF + + +   +   G G+RS RY  ++ D  VE
Sbjct: 85  AWGKAHNAEEIVMLADGVAEFAKALDLTQDRTANGMGIRSQRYAMIVNDGKVE 137


>gi|288958380|ref|YP_003448721.1| peroxiredoxin [Azospirillum sp. B510]
 gi|288910688|dbj|BAI72177.1| peroxiredoxin [Azospirillum sp. B510]
          Length = 160

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 87/145 (60%), Gaps = 8/145 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           ++V T +LF GK+V LF++PGAFTPTCS   LPGF +  D L+ +G++ + CL+VND FV
Sbjct: 23  QEVTTDELFKGKKVVLFSVPGAFTPTCSAKHLPGFVQQADALKAKGVDSIICLAVNDPFV 82

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AWG K  + + V +LPDG+  FT  +G+ +     G G R  R+  + +D  V    V
Sbjct: 83  MRAWGDKGSVGDKVTMLPDGNATFTGALGLTMDGSGYGLGTRGQRFALVAEDGKVTHVAV 142

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           E       A   +E+SS E VL+ +
Sbjct: 143 E-------APGKFEVSSAEAVLETL 160


>gi|254482482|ref|ZP_05095721.1| Redoxin superfamily protein [marine gamma proteobacterium HTCC2148]
 gi|214037173|gb|EEB77841.1| Redoxin superfamily protein [marine gamma proteobacterium HTCC2148]
          Length = 171

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 86/144 (59%), Gaps = 7/144 (4%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           +D+ T D+FAGK+V LFA+PGAFTP CS   +PG+    D ++  G++ + C+SVND FV
Sbjct: 35  QDLATADIFAGKKVLLFAVPGAFTPGCSITHMPGYVVNADKIKAAGVDTIACMSVNDVFV 94

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           M AWG+    + + +L DG GEFT  +G+ +     G G RS R+  + +D V++   VE
Sbjct: 95  MGAWGQAQNAEEILMLADGMGEFTAALGLELDGSAFGLGTRSQRFALIAEDGVIKHLNVE 154

Query: 149 EGFSDNCATDPYEISSPENVLKVI 172
            G          ++SS E ++ ++
Sbjct: 155 PGAG-------VDVSSAETMMALL 171


>gi|326793894|ref|YP_004311714.1| redoxin [Marinomonas mediterranea MMB-1]
 gi|326544658|gb|ADZ89878.1| Redoxin domain protein [Marinomonas mediterranea MMB-1]
          Length = 159

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 88/144 (61%), Gaps = 7/144 (4%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           ++V+  + F+GKRV +FA+PGAFTPTCS   LPGF   +D  + + I+E+ CLSVND FV
Sbjct: 23  ENVDVTEFFSGKRVIMFAVPGAFTPTCSISHLPGFVVHFDAFKEKCIDEIVCLSVNDVFV 82

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           M+AWGK    +N+ +  DG  E T  +G+ +       G+RS RY  L+ + +V + ++E
Sbjct: 83  MDAWGKANNAENLVMAADGLAELTTSLGLELDISTAKLGIRSRRYAMLVDNGIVSNLWLE 142

Query: 149 EGFSDNCATDPYEISSPENVLKVI 172
           E          Y+ISS E+VL  I
Sbjct: 143 E-------PGEYKISSAEHVLSQI 159


>gi|28901148|ref|NP_800803.1| putative antioxidant [Vibrio parahaemolyticus RIMD 2210633]
 gi|260362710|ref|ZP_05775579.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus K5030]
 gi|260879996|ref|ZP_05892351.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus AN-5034]
 gi|260894671|ref|ZP_05903167.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [Vibrio
           parahaemolyticus Peru-466]
 gi|260900528|ref|ZP_05908923.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus AQ4037]
 gi|28809661|dbj|BAC62636.1| putative antioxidant [Vibrio parahaemolyticus RIMD 2210633]
 gi|308086512|gb|EFO36207.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [Vibrio
           parahaemolyticus Peru-466]
 gi|308092713|gb|EFO42408.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus AN-5034]
 gi|308106960|gb|EFO44500.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus AQ4037]
 gi|308111975|gb|EFO49515.1| hybrid peroxiredoxin hyPrx5 [Vibrio parahaemolyticus K5030]
          Length = 157

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 89/142 (62%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C++VNDAFVMNA
Sbjct: 25  DVTELFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADQLKAKGVDLIACVAVNDAFVMNA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   FT+ +G+    D  GF G+RS RY  +I++ VV +  VE+ 
Sbjct: 85  WGEAQNASEILMLGDGDASFTKALGL--EMDTGGFGGVRSQRYAMIIENGVVTTLNVEK- 141

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                    +E+S+ E +L  +
Sbjct: 142 ------PSEFEVSNAETILAAL 157


>gi|115444771|ref|NP_001046165.1| Os02g0192700 [Oryza sativa Japonica Group]
 gi|75139348|sp|Q7F8S5|PR2E2_ORYSJ RecName: Full=Peroxiredoxin-2E-2, chloroplastic; AltName:
           Full=Peroxiredoxin IIE-2; AltName: Full=Thioredoxin
           reductase 2E-2; Flags: Precursor
 gi|46389828|dbj|BAD15391.1| putative thioredoxin peroxidase [Oryza sativa Japonica Group]
 gi|50726415|dbj|BAD34026.1| putative thioredoxin peroxidase [Oryza sativa Japonica Group]
 gi|113535696|dbj|BAF08079.1| Os02g0192700 [Oryza sativa Japonica Group]
 gi|215686880|dbj|BAG89730.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215692623|dbj|BAG88043.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 225

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 99/175 (56%), Gaps = 17/175 (9%)

Query: 8   QVVFHMRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLP 61
            VV  + V   LPD + ++      + K V   +L AG++  LFA+PGAFTPTCS   LP
Sbjct: 58  TVVATIAVGDKLPDATLSYFDPADGELKTVTVAELTAGRKAVLFAVPGAFTPTCSQKHLP 117

Query: 62  GFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI--KNVKLLPDGSGEFTRKMG--M 117
           GF +   +L  +G++ + C+SVNDAFVM AW + L +   +V LL DG+ E TR +G  M
Sbjct: 118 GFIEKAGELHAKGVDAIACVSVNDAFVMRAWKESLGLGDADVLLLSDGNLELTRALGVEM 177

Query: 118 LVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            +    +G G+RS RY  L  D VV+   +EEG +       +  SS E +LK +
Sbjct: 178 DLSDKPMGLGVRSRRYALLADDGVVKVLNLEEGGA-------FTTSSAEEMLKAL 225


>gi|308809728|ref|XP_003082173.1| putative thioredoxin peroxidase 1 (ISS) [Ostreococcus tauri]
 gi|116060641|emb|CAL57119.1| putative thioredoxin peroxidase 1 (ISS) [Ostreococcus tauri]
          Length = 177

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 88/144 (61%), Gaps = 9/144 (6%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           DL+A +RV +FA+PGAFTPTCS+  LPG+ ++ ++ R  G+++V C+SVNDAFVMNAWG+
Sbjct: 41  DLWAKRRVVVFAVPGAFTPTCSNKHLPGYVRLAEEFRARGVDDVMCVSVNDAFVMNAWGE 100

Query: 95  KLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
               +   V+++ DGS    R MG  +     G G RS R+  +  D VVE   +E G  
Sbjct: 101 TAGARKARVRMVADGSATLARAMGTDLDLSEQGMGTRSRRFAMIAYDGVVEYLAMENGTK 160

Query: 153 DNCATDPYEISSPENVLKVIRESK 176
                  YE S  + VL+ +++S+
Sbjct: 161 -------YETSGADEVLEHLKKSR 177


>gi|94496369|ref|ZP_01302946.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Sphingomonas sp. SKA58]
 gi|94424115|gb|EAT09139.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Sphingomonas sp. SKA58]
          Length = 160

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 79/120 (65%), Gaps = 1/120 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V++ D F+GK V +F++PGAFTPTCS   LPGF +  D L+ +G++E+ C +VNDAFVM 
Sbjct: 25  VSSDDYFSGKTVAIFSVPGAFTPTCSAKHLPGFIEKADALKAKGVDEIACTAVNDAFVMG 84

Query: 91  AWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWGK     + V +L DG+G+F + +G+ +     G G R  R+  ++KD VVE   VEE
Sbjct: 85  AWGKSAGADEKVTMLADGNGDFAKAVGLTMDGSKFGLGTRGQRFSMIVKDGVVEDLNVEE 144


>gi|323527424|ref|YP_004229577.1| Redoxin domain-containing protein [Burkholderia sp. CCGE1001]
 gi|323384426|gb|ADX56517.1| Redoxin domain protein [Burkholderia sp. CCGE1001]
          Length = 167

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +    LR  G++E++C+SVNDAFVM A
Sbjct: 32  DVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHAAQLRAAGVDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+ L     V+++ DGS  FTR +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDLHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLNVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   ++L  +
Sbjct: 150 -----AAGKFEVSDAGSILATL 166


>gi|296125055|gb|ADG95957.1| peroxiredoxin [Panax ginseng]
          Length = 162

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 96/166 (57%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   LPDG+ AF     Q + V+   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDSLPDGTLAFFDAEDQLQQVSVHSLAAGKKVVLFGVPGAFTPTCSVKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKK-LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++ + +G++E+  +SVND FVM AW K   + K VK L DGS ++T  +G+ +     G 
Sbjct: 64  EEFKAKGVDEILLISVNDPFVMKAWAKTYTDTKFVKFLADGSAKYTHALGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G RS R+  L+ D+ V++  +E G         + +S  E++LK +
Sbjct: 124 GTRSRRFALLVDDLKVKTANIETG-------GEFTVSGSEDLLKTL 162


>gi|295677756|ref|YP_003606280.1| Redoxin domain protein [Burkholderia sp. CCGE1002]
 gi|295437599|gb|ADG16769.1| Redoxin domain protein [Burkholderia sp. CCGE1002]
          Length = 167

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  DVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHAEQLRAAGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+       V+++ DGS  FTR +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDQHTSGKVRMMADGSAAFTRALGLEQDLSARGMGIRSLRYAMVVDDGVVKTLNVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   ++L  +
Sbjct: 150 -----AAGKFEVSDAASILATL 166


>gi|225445188|ref|XP_002284177.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297738798|emb|CBI28043.3| unnamed protein product [Vitis vinifera]
          Length = 162

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 96/166 (57%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ A+     Q +  +   L AGK+V +F +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVIPDGTLAYFDEQDQLQQASVHSLAAGKKVIIFGVPGAFTPTCSVKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            +L+ +GI+E+  +SVND FVM AW K   + K+VK L DGS  +T  +G+ +     G 
Sbjct: 64  GELKSKGIDEILLVSVNDPFVMKAWAKTYPDNKDVKFLADGSATYTHALGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G RS R+  L+ D+ V+   VE G         + +SS +++LK I
Sbjct: 124 GTRSRRFALLVDDLKVKVANVEAG-------GEFTVSSADDILKAI 162


>gi|153838860|ref|ZP_01991527.1| redoxin domain protein [Vibrio parahaemolyticus AQ3810]
 gi|149747688|gb|EDM58598.1| redoxin domain protein [Vibrio parahaemolyticus AQ3810]
          Length = 157

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 89/142 (62%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C++VNDAFVMNA
Sbjct: 25  DVTELFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADQLKAKGVDLIACVAVNDAFVMNA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   FT+ +G+    D  GF G+RS RY  +I++ VV +  VE+ 
Sbjct: 85  WGEAQNASEILMLGDGDASFTKALGL--EMDTGGFGGVRSQRYAMIIENGVVTTLNVEK- 141

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                    +E+S+ E +L  +
Sbjct: 142 ------PSEFEVSNAETILAAL 157


>gi|113972141|ref|YP_735934.1| redoxin domain-containing protein [Shewanella sp. MR-4]
 gi|114049389|ref|YP_739939.1| redoxin domain-containing protein [Shewanella sp. MR-7]
 gi|117922451|ref|YP_871643.1| redoxin domain-containing protein [Shewanella sp. ANA-3]
 gi|113886825|gb|ABI40877.1| Redoxin domain protein [Shewanella sp. MR-4]
 gi|113890831|gb|ABI44882.1| Redoxin domain protein [Shewanella sp. MR-7]
 gi|117614783|gb|ABK50237.1| Redoxin domain protein [Shewanella sp. ANA-3]
          Length = 157

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 93/159 (58%), Gaps = 14/159 (8%)

Query: 19  LPDGSKAFQWKD--VNTQ--DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           LP  + +   KD  VN Q  +LFAGK+V LFA+PGAFTPTCS+  LPG+  + D  + +G
Sbjct: 8   LPAATLSQLTKDGMVNHQVTELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADQFKAKG 67

Query: 75  IEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRY 133
           ++ + C+SVNDAFVM AWG+      + +L DG   FT+ +G+    D  GF G+RS RY
Sbjct: 68  VDLIACVSVNDAFVMKAWGEAQNASELLMLADGDASFTKALGL--EMDTAGFGGVRSQRY 125

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
             +I + VV    VE       A   +E+S  E VL  +
Sbjct: 126 AMIIDNGVVTLLNVE-------APKSFEVSKAEVVLAAL 157


>gi|209519101|ref|ZP_03267907.1| Redoxin domain protein [Burkholderia sp. H160]
 gi|209500473|gb|EEA00523.1| Redoxin domain protein [Burkholderia sp. H160]
          Length = 167

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  DVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHVEQLRAAGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+       V+++ DGS  FTR +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDQHTSGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLNVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   ++L  +
Sbjct: 150 -----AAGKFEVSDAASILATL 166


>gi|167580480|ref|ZP_02373354.1| AhpC/TSA family protein [Burkholderia thailandensis TXDOH]
          Length = 168

 Score =  118 bits (295), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/133 (43%), Positives = 81/133 (60%), Gaps = 8/133 (6%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE 97
           AGKRV +F LPGAFTPTCS   +PG+    + LR  GI+E++C++VNDAFVM AWG+ L 
Sbjct: 38  AGKRVVIFGLPGAFTPTCSAQHVPGYVAHAERLRSAGIDEIWCVAVNDAFVMGAWGRDLH 97

Query: 98  IKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               V+++ DG   FT  +G+       G G+RS RY  ++ D VV++ FVE       A
Sbjct: 98  TAGKVRMMADGGAAFTHALGLTQDLSARGMGIRSRRYAMVVDDGVVKTLFVE-------A 150

Query: 157 TDPYEISSPENVL 169
              +E+S   +VL
Sbjct: 151 PGKFEVSDAASVL 163


>gi|256708473|gb|ACV20868.1| thioredoxin-dependent peroxidase [Leymus chinensis]
          Length = 162

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 93/164 (56%), Gaps = 13/164 (7%)

Query: 15  VATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           V + LPDG   +     Q + V+   L  GK+V LF +PGAFTPTCS+  +PGF    ++
Sbjct: 6   VGSTLPDGQLGWFDENDQLQQVSIHSLATGKKVILFGVPGAFTPTCSNQHVPGFITQAEE 65

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
           L+ +G++E+  +SVND FVM AW K   E K+VK L DG+  +T+ +G+ +     G GL
Sbjct: 66  LKAKGVDEILLVSVNDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELDLTEKGLGL 125

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           RS R+  L  D+ V    +EEG         + IS  E ++K +
Sbjct: 126 RSRRFALLADDLKVTVANIEEG-------GQFTISGAEEIMKAL 162


>gi|120596937|ref|YP_961511.1| redoxin domain-containing protein [Shewanella sp. W3-18-1]
 gi|120557030|gb|ABM22957.1| Redoxin domain protein [Shewanella sp. W3-18-1]
          Length = 157

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/159 (41%), Positives = 95/159 (59%), Gaps = 14/159 (8%)

Query: 19  LPDGSKAFQWKD--VNTQ--DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           LP G+ + Q KD  VN +  +LFAGK+V LFA+PGAFTPTCS+  LPG+  + D  + + 
Sbjct: 8   LPAGTLSQQTKDGTVNHKVTELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADQFKAKD 67

Query: 75  IEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRY 133
           ++ + C++VNDAFVM AWG+      + +L DG   FT+ +G+ +  D  GF G+RS RY
Sbjct: 68  VDLIACVAVNDAFVMKAWGEAQNASELMMLADGDASFTKALGLEM--DTAGFGGIRSQRY 125

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
             +I + VV    VE       A   +E+S  E VL  +
Sbjct: 126 AMIIDNGVVTLLNVE-------APKSFEVSKAEVVLAAL 157


>gi|17547557|ref|NP_520959.1| type 2 peroxiredoxin protein [Ralstonia solanacearum GMI1000]
 gi|17429861|emb|CAD16545.1| putative thioredoxin fold-haboring protein [Ralstonia solanacearum
           GMI1000]
 gi|299065614|emb|CBJ36786.1| peroxiredoxin [Ralstonia solanacearum CMR15]
          Length = 166

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 85/139 (61%), Gaps = 8/139 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  DL  GK + +F LPGAFTPTCS   +PG+   YD LR +G++E++C+SVNDAFVM A
Sbjct: 32  SAADLAQGKTILIFGLPGAFTPTCSARHVPGYLAHYDALRTKGVDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           W +       V++L DGS EFTR++G+       G G+RS RY  ++K+ VV    VE  
Sbjct: 92  WARAQGTDGRVRMLADGSAEFTRRLGLEQDLSKRGMGVRSQRYAMIVKNGVVTVLQVE-- 149

Query: 151 FSDNCATDPYEISSPENVL 169
                A   + +S+ E++L
Sbjct: 150 -----APGQFAVSNAESML 163


>gi|194290807|ref|YP_002006714.1| peroxiredoxin [Cupriavidus taiwanensis LMG 19424]
 gi|193224642|emb|CAQ70653.1| putative peroxiredoxin [Cupriavidus taiwanensis LMG 19424]
          Length = 168

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 88/140 (62%), Gaps = 8/140 (5%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           DL  G+++ +F LPGAFTPTCS   +PGF +  + LR  G++EV+C+SVNDAFVM AWG+
Sbjct: 35  DLVRGRKIVVFGLPGAFTPTCSAKHVPGFVQHAEALRAAGVDEVWCVSVNDAFVMGAWGR 94

Query: 95  KLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSD 153
           + ++   V+++ DGS E+TR +G+       G G+R+ R+  +I+D VV    VE     
Sbjct: 95  EQQVAGKVRMMADGSAEWTRALGLDQDLSARGLGVRAKRFAMVIEDGVVTRIDVE----- 149

Query: 154 NCATDPYEISSPENVLKVIR 173
             A   + +SS E VL  +R
Sbjct: 150 --APGEFRVSSAEAVLAALR 167


>gi|255629101|gb|ACU14895.1| unknown [Glycine max]
          Length = 162

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 100/166 (60%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG  A+     + + V+   L  GK+V +F +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGNVIPDGILAYLDEENKPQTVSIHSLATGKKVIIFGVPGAFTPTCSLKHVPGFIERA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ + ++E+ C+SVND FVMN+W K   E K+VK L DG+ ++T  +G+ +   + G 
Sbjct: 64  EELKGKDVDEIICISVNDPFVMNSWAKTFPENKHVKFLADGAAKYTNALGLELDLTDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L++D+ V+   VE G         + ISS E ++K +
Sbjct: 124 GVRSKRFALLVEDLKVKVANVESG-------GEFTISSAEEIIKAL 162


>gi|124268617|ref|YP_001022621.1| AhpC/TSA family protein [Methylibium petroleiphilum PM1]
 gi|124261392|gb|ABM96386.1| AhpC/TSA-family protein [Methylibium petroleiphilum PM1]
          Length = 169

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/135 (43%), Positives = 84/135 (62%), Gaps = 8/135 (5%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           L AGK + +FALPGAFTPTCS   +PGF K  D  +  G++E++CLSVNDAFVM AWG++
Sbjct: 36  LTAGKTIAVFALPGAFTPTCSAQHVPGFVKHADAFKAAGVDEIWCLSVNDAFVMGAWGRE 95

Query: 96  LEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDN 154
                 V+++ DGS  FT+  G+ +  +  G GLRS RY  L+ D  V++  +E      
Sbjct: 96  QGTGGKVRMMADGSAAFTQATGLTLDLNARGMGLRSQRYSMLVVDGTVKTLNIE------ 149

Query: 155 CATDPYEISSPENVL 169
            A   +E+S+ E +L
Sbjct: 150 -APGKFEVSNAETLL 163


>gi|186472082|ref|YP_001859424.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
 gi|184194414|gb|ACC72378.1| Redoxin domain protein [Burkholderia phymatum STM815]
          Length = 167

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 84/137 (61%), Gaps = 8/137 (5%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE 97
           AGKRV +F LPGAFTPTCS   LPG+     DL   G++E++C+SVNDAFVMNAWG++  
Sbjct: 38  AGKRVVIFGLPGAFTPTCSARHLPGYIDAAADLFAVGVDEIWCVSVNDAFVMNAWGRQQA 97

Query: 98  IKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               +K++ DGS  F+  +G+       G G+RS RY  ++ D VV +  VE       A
Sbjct: 98  TAGKIKMIADGSAHFSHALGLEQDLTARGMGIRSHRYAMVVDDGVVATLNVE-------A 150

Query: 157 TDPYEISSPENVLKVIR 173
              +++S  E+++ V+R
Sbjct: 151 PGEFQVSDAESIMAVLR 167


>gi|294011672|ref|YP_003545132.1| peroxiredoxin [Sphingobium japonicum UT26S]
 gi|292675002|dbj|BAI96520.1| peroxiredoxin [Sphingobium japonicum UT26S]
          Length = 160

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 87/145 (60%), Gaps = 8/145 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V + D FAG+ V LF++PGAFTPTCS   LPGF +  ++L+ +G++E+ C +VNDAFV
Sbjct: 23  EQVASDDFFAGRTVALFSVPGAFTPTCSARHLPGFVEKAEELKGKGVDEIACTAVNDAFV 82

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AWGK       V +L DG+GEF + +G+ +     G G R  R+  ++KD VV    V
Sbjct: 83  MGAWGKSANADGKVTMLADGNGEFAQAVGLTMDGSKFGLGTRGQRFSMIVKDGVVAELNV 142

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           E       A   +++SS E +L  I
Sbjct: 143 E-------APGDFKVSSAEYLLDQI 160


>gi|163857979|ref|YP_001632277.1| putative AhpC/TSA family protein [Bordetella petrii DSM 12804]
 gi|163261707|emb|CAP44009.1| putative AhpC/TSA family protein [Bordetella petrii]
          Length = 167

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 88/139 (63%), Gaps = 8/139 (5%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           DL  GK + +FA+PGAFTPTCS   LPG+ +    L+ +G++E++C+SVNDAFVM AWG+
Sbjct: 36  DLVKGKTIAVFAVPGAFTPTCSAKHLPGYVQQAQALKDKGVDEIWCVSVNDAFVMGAWGR 95

Query: 95  KLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSD 153
           + +    V++L DGS  +TR +G+ +  D  G G+RS RY AL++D VV+   +E     
Sbjct: 96  EQQTAGKVRMLADGSAHWTRALGLELDLDARGMGVRSQRYSALLQDGVVKQLNIE----- 150

Query: 154 NCATDPYEISSPENVLKVI 172
             A   +E+S    +L  I
Sbjct: 151 --APGKFEVSDAATLLSQI 167


>gi|116782003|gb|ABK22332.1| unknown [Picea sitchensis]
 gi|116785991|gb|ABK23933.1| unknown [Picea sitchensis]
 gi|116787992|gb|ABK24719.1| unknown [Picea sitchensis]
 gi|224284417|gb|ACN39943.1| unknown [Picea sitchensis]
          Length = 164

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 98/167 (58%), Gaps = 13/167 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   +PDG  A+     + + V+   L AGK++ LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDKIPDGVLAYFDEENKLQQVSAHSLAAGKKIILFGVPGAFTPTCSMQHVPGFVEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKK-LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +GI+E+ C+SVND FVM  W K     K+VK L DGS ++T  +G+ +     G 
Sbjct: 64  EELKGKGIDEIICISVNDPFVMKEWSKTYTNNKHVKFLADGSAKYTYALGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           G+RS R+  +  ++ V+   +EEG S       +E+SS E +LK + 
Sbjct: 124 GIRSRRFALVCDNLEVKVANIEEGGS-------FEVSSAEEILKSLE 163


>gi|326387832|ref|ZP_08209438.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207878|gb|EGD58689.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Novosphingobium nitrogenifigens DSM 19370]
          Length = 159

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 7/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V + D FAGK+V LF++PGAFTPTCS   LPGF     +++ +G++E+ C +VND FVM 
Sbjct: 25  VQSADYFAGKKVVLFSVPGAFTPTCSARHLPGFVDKAAEIKAKGVDEIACTAVNDPFVMK 84

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           AW        + +L DG+G+F + +G+++     G G R  R+ A+I D VVE   VE  
Sbjct: 85  AWAAASGSPEITMLADGNGDFVKALGLVLDGSGFGLGQRGQRFAAVINDGVVEQLHVE-- 142

Query: 151 FSDNCATDPYEISSPENVLK 170
                A   +++S+ E VL+
Sbjct: 143 -----APGDFKVSAAEYVLE 157


>gi|125538439|gb|EAY84834.1| hypothetical protein OsI_06200 [Oryza sativa Indica Group]
          Length = 225

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 99/175 (56%), Gaps = 17/175 (9%)

Query: 8   QVVFHMRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLP 61
            VV  + V   LPD + ++      + K V   +L AG++  LFA+PGAFTPTCS   LP
Sbjct: 58  TVVATIAVGDKLPDATLSYFDPADGELKTVTVAELTAGRKAVLFAVPGAFTPTCSQKHLP 117

Query: 62  GFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI--KNVKLLPDGSGEFTRKMG--M 117
           GF +   +L  +G++ + C+SVNDAFVM AW + L +   +V LL DG+ E TR +G  M
Sbjct: 118 GFIEKAGELHAKGVDAIACVSVNDAFVMRAWKESLGLGDADVLLLSDGNLELTRALGVEM 177

Query: 118 LVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            +    +G G+RS RY  L  D VV+   +EEG +       +  SS E +LK +
Sbjct: 178 DLSDKPMGLGVRSRRYALLADDGVVKVLNLEEGGA-------FTTSSAEEMLKAL 225


>gi|117620462|ref|YP_855809.1| peroxiredoxin [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117561869|gb|ABK38817.1| peroxiredoxin [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 157

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 93/166 (56%), Gaps = 16/166 (9%)

Query: 13  MRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKI 66
           + +   LP G   F      Q +D  +Q LF GKRV LFA+PGAFTPTCS+  LPG+  +
Sbjct: 2   IAIGQALPAGEFTFITAEGKQQRD--SQSLFGGKRVVLFAVPGAFTPTCSNAHLPGYVVL 59

Query: 67  YDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            D  + +G++ + CLSVNDAFVM AW      + + +L DG G +TR +G+       G 
Sbjct: 60  ADKFKEKGVDAICCLSVNDAFVMKAWQDAQNAEAITMLADGDGSWTRALGLAKETGAFG- 118

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+R+ R+  +  D VVE  FVE       A   +E+S  +++L  +
Sbjct: 119 GVRAQRFALIANDGVVEQLFVE-------APGKFEVSDAQSLLAAL 157


>gi|315499619|ref|YP_004088422.1| redoxin domain protein [Asticcacaulis excentricus CB 48]
 gi|315417631|gb|ADU14271.1| Redoxin domain protein [Asticcacaulis excentricus CB 48]
          Length = 160

 Score =  117 bits (293), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 85/143 (59%), Gaps = 8/143 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K + T ++FAGKRV LFA+PGAFTPTCS   LPGF         + I+ V C SVND FV
Sbjct: 23  KPLTTSEVFAGKRVVLFAVPGAFTPTCSARHLPGFRDQAKAFAFKNIDVVACTSVNDGFV 82

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AW K   +   V +L DG+GEF  K+G+++  +  G G RS RY  ++ D VVE  F+
Sbjct: 83  MKAWAKDQGLAGEVLMLGDGNGEFAEKVGLVLDAEGFGMGKRSQRYAMIVNDGVVEKLFI 142

Query: 148 EEGFSDNCATDPYEISSPENVLK 170
           E       A   +++SS + VL+
Sbjct: 143 E-------APGEFKVSSADYVLE 158


>gi|89092553|ref|ZP_01165506.1| antioxidant, putative [Oceanospirillum sp. MED92]
 gi|89083065|gb|EAR62284.1| antioxidant, putative [Oceanospirillum sp. MED92]
          Length = 157

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 87/144 (60%), Gaps = 8/144 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K ++T D FAGK+V +FALPGAFTPTCS   LPG+    D++   G++ + CLSVND+FV
Sbjct: 22  KTISTDDFFAGKKVVMFALPGAFTPTCSASHLPGYVVKADEIYAHGVDVIACLSVNDSFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           M AW +      + ++ DG  E ++ +G+ +     G G RS RY  +++D VV +  VE
Sbjct: 82  MKAWAEVQNADRITMVADGGAELSKAIGLHMETGAFG-GTRSQRYAMIVEDGVVTALNVE 140

Query: 149 EGFSDNCATDPYEISSPENVLKVI 172
           +          +E+SS E +L+++
Sbjct: 141 Q-------PKTFEVSSAETILQLL 157


>gi|147781540|emb|CAN73709.1| hypothetical protein VITISV_023716 [Vitis vinifera]
          Length = 162

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 95/166 (57%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ A+     Q +  +   L AGK+V  F +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVIPDGTLAYFDEQDQLQQASVHSLAAGKKVIXFGVPGAFTPTCSVKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            +L+ +GI+E+  +SVND FVM AW K   + K+VK L DGS  +T  +G+ +     G 
Sbjct: 64  GELKSKGIDEILLVSVNDPFVMKAWAKTYPDNKDVKFLADGSATYTHALGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G RS R+  L+ D+ V+   VE G         + +SS +++LK I
Sbjct: 124 GTRSRRFALLVDDLKVKVANVEAG-------GEFTVSSADDILKAI 162


>gi|242058321|ref|XP_002458306.1| hypothetical protein SORBIDRAFT_03g030950 [Sorghum bicolor]
 gi|241930281|gb|EES03426.1| hypothetical protein SORBIDRAFT_03g030950 [Sorghum bicolor]
          Length = 162

 Score =  117 bits (292), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 93/166 (56%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   LPDG   +     Q + V+   L AGK+V LF +PGAFTPTCS+  +PGF    
Sbjct: 4   IAVGDSLPDGQLGWFDENDQLQQVSVHALAAGKKVILFGVPGAFTPTCSNQHVPGFITQA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           + L+ +G++E+  +SVND FVM AW K   E K+VK L DGSG +T+ + + +     G 
Sbjct: 64  EQLKAKGVDEILLISVNDPFVMKAWAKTYPENKHVKFLADGSGAYTKALDLELDLTEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L  D+ V    +EEG         + IS  E +LK +
Sbjct: 124 GVRSKRFALLADDLKVTVANIEEGGQ-------FTISGAEEILKAL 162


>gi|115187464|gb|ABI84254.1| thioredoxin fold [Arachis hypogaea]
          Length = 162

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 97/166 (58%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAFQWKD-----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ AF   D     V+   L  GK+V +F +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVIPDGTLAFLDNDNKPQSVSIHSLAKGKKVIIFGVPGAFTPTCSLKHVPGFIERA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++E+ C+SVND FVM +W     E K+V  L DGS ++T  +G+ +     G 
Sbjct: 64  EELKGKGVDEIICISVNDPFVMKSWANTFPENKHVTFLADGSAKYTHDLGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L++D+ V+   +E G         + +SS E ++K +
Sbjct: 124 GIRSKRFALLVEDLKVKVANIESG-------GEFTVSSAEEIIKAL 162


>gi|330830644|ref|YP_004393596.1| Peroxiredoxin [Aeromonas veronii B565]
 gi|328805780|gb|AEB50979.1| Peroxiredoxin [Aeromonas veronii B565]
          Length = 157

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 93/167 (55%), Gaps = 18/167 (10%)

Query: 13  MRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKI 66
           + V   LP G   F      Q +D  T  LFAGK+V LFA+PGAFTPTCS+  LPG+  +
Sbjct: 2   IAVGQPLPAGEFTFITDEGKQLRDSKT--LFAGKKVVLFAVPGAFTPTCSNAHLPGYVVL 59

Query: 67  YDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            D    +G++ + CLSVNDAFVM AW      + + +L DG G +TR +G+   KD   F
Sbjct: 60  ADQFMAKGVDAICCLSVNDAFVMRAWQTAQNAEAITMLADGDGSWTRALGL--AKDTGAF 117

Query: 127 -GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            G+R+ R+  +  D VVE  FVE       A   +E+S   ++L  +
Sbjct: 118 GGIRAQRFALIANDGVVEQLFVE-------APGKFEVSDAASLLAAL 157


>gi|145298268|ref|YP_001141109.1| peroxiredoxin [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142851040|gb|ABO89361.1| peroxiredoxin [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 157

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 92/164 (56%), Gaps = 12/164 (7%)

Query: 13  MRVATVLPDGSKAF---QWKDV-NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           + +   LP G   F   + K V ++Q LFAGK V LFA+PGAFTPTCS+  LPG+  + D
Sbjct: 2   IAIGQTLPAGEFTFITAEGKQVQDSQALFAGKTVILFAVPGAFTPTCSNAHLPGYVVLAD 61

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
             + +G++ +YCLSVNDAFVM AW        + +L DG G +T+ +G+       G GL
Sbjct: 62  QFKAKGVDAIYCLSVNDAFVMKAWQVAQNADAITMLADGDGSWTQALGLAKETGAFG-GL 120

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           R+ R+  +  D VV   FVE       A   +E+S   ++L  +
Sbjct: 121 RAQRFALIALDGVVTRLFVE-------APGKFEVSDASSLLAAL 157


>gi|325922895|ref|ZP_08184614.1| peroxiredoxin [Xanthomonas gardneri ATCC 19865]
 gi|325546628|gb|EGD17763.1| peroxiredoxin [Xanthomonas gardneri ATCC 19865]
          Length = 160

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 2/120 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+T  LFA ++V LFA+PGAFTPTCS   LPG+ + ++  R  GI EV C +VND FVM 
Sbjct: 24  VDTHTLFADRKVLLFAVPGAFTPTCSAKHLPGYVEHFEQFRKRGI-EVLCTAVNDPFVMQ 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWG+   I + + +LPDG+ +  R +G+ V     G GLRS RY     D VV++ FVEE
Sbjct: 83  AWGRSQLIPDGLHMLPDGNADLARALGLEVDASGSGMGLRSRRYALYADDAVVKALFVEE 142


>gi|26989419|ref|NP_744844.1| redoxin domain protein [Pseudomonas putida KT2440]
 gi|24984284|gb|AAN68308.1|AE016465_1 AhpC/TSA family protein [Pseudomonas putida KT2440]
          Length = 166

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/172 (38%), Positives = 96/172 (55%), Gaps = 15/172 (8%)

Query: 5   QIPQVVFHM--RVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG 62
           Q+P V  +     A     G KAF  ++         K+V +FALPGAFTPTCS+  +PG
Sbjct: 7   QLPDVTLYQYNNDAGACAIGPKAFSIRERCKH-----KKVLIFALPGAFTPTCSERHVPG 61

Query: 63  FEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYK 121
           +      L   GI+E+ C+SVNDAFVMNAWG  L++ + VK++ DG+GEF+  +G+    
Sbjct: 62  YVAAAPALFAAGIDEILCVSVNDAFVMNAWGNSLQVGDAVKMIGDGNGEFSEALGLTQDL 121

Query: 122 DNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
              G G RS RY  L+ D VV+   VE       +   +E+S   ++L V+R
Sbjct: 122 SARGLGRRSQRYAMLVDDQVVQYIAVE-------SPGKFEVSDAASLLAVLR 166


>gi|192910922|gb|ACF06569.1| peroxiredoxin [Elaeis guineensis]
          Length = 162

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/166 (38%), Positives = 93/166 (56%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   LPDG+  +     Q + V+   + AGK++ L  +PGAFTPTCS   +P F K  
Sbjct: 4   IAVGDTLPDGTLGWFDENEQLQQVSIHGIGAGKKIVLVGVPGAFTPTCSSQHVPSFIKSA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKK-LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +GI+E+  +SVND FVM AW K   E K VK L DGSG +T  +G+ +     G 
Sbjct: 64  EELKSKGIDEILVISVNDPFVMKAWAKTYAENKYVKFLADGSGSYTHALGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GLRS RY     D+ V+   +EEG +       + IS  + +LK +
Sbjct: 124 GLRSRRYAVFADDLKVKVANIEEGGA-------FTISGADEILKAL 162


>gi|254471694|ref|ZP_05085095.1| thiol peroxidase [Pseudovibrio sp. JE062]
 gi|211958896|gb|EEA94095.1| thiol peroxidase [Pseudovibrio sp. JE062]
          Length = 161

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 86/142 (60%), Gaps = 7/142 (4%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           DV +++LF GK V LFA+PGAFTPTC  + LPGF    + ++ +G+E +  +SVNDAFVM
Sbjct: 24  DVTSEELFGGKTVVLFAVPGAFTPTCHLNHLPGFIDNAEAIKAKGVETIAVVSVNDAFVM 83

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AW +     + +  L DGS +FT+ + + +     G G+RS RY  ++KD V+ S  +E
Sbjct: 84  SAWARDTRADDKILFLADGSADFTKAISLELDASAFGMGIRSKRYSMIVKDGVLSSLNIE 143

Query: 149 EGFSDNCATDPYEISSPENVLK 170
           E      A     ISS EN+L 
Sbjct: 144 E------APGEATISSAENILS 159


>gi|187925436|ref|YP_001897078.1| redoxin [Burkholderia phytofirmans PsJN]
 gi|187716630|gb|ACD17854.1| Redoxin domain protein [Burkholderia phytofirmans PsJN]
          Length = 167

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  DVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHAEQLRALGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+       V+++ DGS  FTR +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDQHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLNVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   ++L  +
Sbjct: 150 -----AAGKFEVSDAGSILATL 166


>gi|319796207|ref|YP_004157847.1| redoxin domain protein [Variovorax paradoxus EPS]
 gi|315598670|gb|ADU39736.1| Redoxin domain protein [Variovorax paradoxus EPS]
          Length = 168

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 85/144 (59%), Gaps = 8/144 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+     AGK + LFALPGAFTPTCS   +PG+ + +DD +  G++E++C+SVNDAFVM 
Sbjct: 31  VDVAKASAGKTIALFALPGAFTPTCSAKHVPGYVQHFDDFKAAGVDEIWCVSVNDAFVMG 90

Query: 91  AWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DGS +F +  G+ +     G GLRS RY  L+KD  V +  VE 
Sbjct: 91  AWARDQKTGAKVRMLADGSADFAKATGLTLDLTGRGMGLRSNRYSMLVKDGKVATLNVE- 149

Query: 150 GFSDNCATDPYEISSPENVLKVIR 173
                 A   +E+S  + +L   R
Sbjct: 150 ------APGKFEVSDADTLLAQAR 167


>gi|187930151|ref|YP_001900638.1| Redoxin domain-containing protein [Ralstonia pickettii 12J]
 gi|187727041|gb|ACD28206.1| Redoxin domain protein [Ralstonia pickettii 12J]
          Length = 166

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 88/142 (61%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + + L  GK + +F LPGAFTPTCS   +PG+   +D LR +G++E++C+SVNDAFVM A
Sbjct: 32  SVRHLAEGKTIVIFGLPGAFTPTCSARHVPGYLANFDALRAKGVDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           W +     + +++L DGS EFT K+G+       G G+RS RY  ++KD VV +  VE  
Sbjct: 92  WARTQGTDDKIRMLGDGSAEFTSKLGLDQDLSKRGMGIRSQRYAMVVKDGVVTALQVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   + +SS E++L ++
Sbjct: 150 -----APGQFSVSSAESMLALL 166


>gi|296160535|ref|ZP_06843351.1| Redoxin domain protein [Burkholderia sp. Ch1-1]
 gi|295889284|gb|EFG69086.1| Redoxin domain protein [Burkholderia sp. Ch1-1]
          Length = 167

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +  + LR  GI+E++C+SVNDAFVM A
Sbjct: 32  DVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHAEQLRALGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+       V+++ DGS  FTR +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDQHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLNVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   ++L  +
Sbjct: 150 -----AAGKFEVSDAGSILATL 166


>gi|87200020|ref|YP_497277.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Novosphingobium aromaticivorans DSM 12444]
 gi|87135701|gb|ABD26443.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Novosphingobium aromaticivorans DSM 12444]
          Length = 159

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/140 (40%), Positives = 84/140 (60%), Gaps = 7/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V + + F GK+V LF++PGAFTPTCS   LPG+ +   DL+ +GI+EV C +VND FVM 
Sbjct: 25  VQSAEYFKGKKVALFSVPGAFTPTCSAKHLPGYVEKAADLKAKGIDEVACTAVNDPFVMK 84

Query: 91  AWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           AWG      +V +L DG+G+    +G+ +     G G R  R+  ++ D VVE  FVE  
Sbjct: 85  AWGAANGSSDVTMLADGNGDLAEALGLTMDGSGFGLGKRGQRFSMVVNDGVVEQLFVE-- 142

Query: 151 FSDNCATDPYEISSPENVLK 170
                A   +++SS E++L+
Sbjct: 143 -----APGDFKVSSAEHMLE 157


>gi|110633108|ref|YP_673316.1| redoxin [Mesorhizobium sp. BNC1]
 gi|110284092|gb|ABG62151.1| Redoxin [Chelativorans sp. BNC1]
          Length = 161

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 88/139 (63%), Gaps = 6/139 (4%)

Query: 12  HMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLR 71
           ++ +    P+G++     +  T+D FAG++V LF +PGAFTPTCS+  LPGF + YD + 
Sbjct: 11  NVTIKKATPNGAE-----ETTTRDFFAGRKVVLFGVPGAFTPTCSNSHLPGFIENYDAIV 65

Query: 72  CEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRS 130
             GI+ V  +SVNDAFVM AW +    ++ +  L DGSG+F R +G+ +     G GLRS
Sbjct: 66  SRGIDAVAVVSVNDAFVMGAWARFTGAEDKLVFLADGSGDFARAVGLDLDLSARGMGLRS 125

Query: 131 WRYGALIKDMVVESWFVEE 149
            RY  +++D +V++  VEE
Sbjct: 126 QRYSMIVEDGIVKAINVEE 144


>gi|187477333|ref|YP_785357.1| antioxidant [Bordetella avium 197N]
 gi|115421919|emb|CAJ48439.1| putative antioxidant [Bordetella avium 197N]
          Length = 167

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 91/152 (59%), Gaps = 13/152 (8%)

Query: 22  GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCL 81
           G  AFQ       DL  GK++ LFA+PGAFTPTCS   LPG+    +  + +G++E++C+
Sbjct: 28  GPNAFQ-----VADLTRGKKIALFAVPGAFTPTCSAKHLPGYVAQAEAFKAKGVDEIWCV 82

Query: 82  SVNDAFVMNAWGK-KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
           +VNDAFVM AWG+ +     V+LL DGS  +TR++G+ +     G G+RS RY ALI+D 
Sbjct: 83  AVNDAFVMGAWGRDQHATGKVRLLADGSALWTRELGLELDLIARGMGVRSQRYSALIEDG 142

Query: 141 VVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           VV    +E       A   +E+S  E +L  I
Sbjct: 143 VVTRLNIE-------APGKFEVSDAETLLSQI 167


>gi|166710990|ref|ZP_02242197.1| peroxiredoxin [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 160

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 98/168 (58%), Gaps = 21/168 (12%)

Query: 5   QIPQVVF-HMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGF 63
           +IP++V   MR      DG +A     V+T  LFAG+ V LFA+PGAFTPTCS   +PG+
Sbjct: 8   RIPEIVLKRMR------DGIEA-----VDTHTLFAGRTVLLFAVPGAFTPTCSAKHVPGY 56

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKD 122
            + +D LR  GI EV C +VND FV+ AWG+   I + + LLPDG+ E  R  G+ +   
Sbjct: 57  VEHFDALRKRGI-EVRCTAVNDPFVVPAWGRNPLIPDGLHLLPDGNPELARAPGLAIDAS 115

Query: 123 NVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
             G GLRS  Y     D VVE+ FVEE          +++S+ ++VL+
Sbjct: 116 GSGMGLRSRCYALYADDPVVEALFVEE-------PGEFKVSAADHVLQ 156


>gi|167618588|ref|ZP_02387219.1| AhpC/TSA family protein [Burkholderia thailandensis Bt4]
 gi|257137841|ref|ZP_05586103.1| AhpC/TSA family protein [Burkholderia thailandensis E264]
          Length = 168

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/133 (42%), Positives = 80/133 (60%), Gaps = 8/133 (6%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE 97
           AGKRV +F LPGAFTPTCS   +PG+    + LR  GI+E++C++VNDAFVM AWG+ L 
Sbjct: 38  AGKRVVIFGLPGAFTPTCSAQHVPGYVAQAERLRSAGIDEIWCVAVNDAFVMGAWGRDLH 97

Query: 98  IKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               V+++ DG   FT  +G+       G G+RS RY  ++ D VV++  VE       A
Sbjct: 98  TAGKVRMMADGGAAFTHALGLTQDLSARGMGIRSRRYAMVVDDGVVKTLLVE-------A 150

Query: 157 TDPYEISSPENVL 169
              +E+S   +VL
Sbjct: 151 PGKFEVSDAASVL 163


>gi|58580531|ref|YP_199547.1| peroxiredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84622490|ref|YP_449862.1| peroxiredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188578525|ref|YP_001915454.1| peroxiredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58425125|gb|AAW74162.1| peroxiredoxin [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84366430|dbj|BAE67588.1| peroxiredoxin [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188522977|gb|ACD60922.1| peroxiredoxin [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 160

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 97/168 (57%), Gaps = 21/168 (12%)

Query: 5   QIPQVVF-HMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGF 63
           +IP++V   MR      DG +A     V+T  LFAG+ V LFA+PGAFTPTCS   LPG+
Sbjct: 8   RIPEIVLKRMR------DGIEA-----VDTHTLFAGRTVLLFAVPGAFTPTCSAKHLPGY 56

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKD 122
            + +D LR  GI EV C +VND FVM AWG+   I + + LLPDG+ E  R   + +   
Sbjct: 57  VEHFDALRKRGI-EVRCTAVNDPFVMPAWGRNPLIPDGLHLLPDGNPELARAPDLEIDAS 115

Query: 123 NVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
             G GLRS  Y     D VVE+ FVEE          +++S+ ++VL+
Sbjct: 116 GSGMGLRSRCYALYADDAVVEALFVEE-------PGEFKVSAADHVLQ 156


>gi|118481397|gb|ABK92641.1| unknown [Populus trichocarpa]
          Length = 218

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 96/157 (61%), Gaps = 11/157 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   LP+ + ++     + +      L +GK+  LFA+PGAFTPTCS   LPGF +  
Sbjct: 57  ISVGDKLPEATLSYFDSEGELQTTTISSLTSGKKSILFAVPGAFTPTCSQKHLPGFVEKS 116

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN--VKLLPDGSGEFTRKMG--MLVYKDN 123
            +L+ +G++ + C+SVNDAFVM AW + L IK+  V LL DG+G+FT+ +G  + +    
Sbjct: 117 AELKSKGVDTIACISVNDAFVMKAWKEDLGIKDDGVLLLSDGNGDFTKAIGCELDLSDKP 176

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEEG--FSDNCATD 158
           VG G+RS RY  L +D VV+   +EEG  F+ + A D
Sbjct: 177 VGLGVRSRRYALLAEDGVVKVLNLEEGGAFTSSGAED 213


>gi|119946480|ref|YP_944160.1| antioxidant, AhpC/Tsa family protein [Psychromonas ingrahamii 37]
 gi|119865084|gb|ABM04561.1| antioxidant, AhpC/Tsa family protein [Psychromonas ingrahamii 37]
          Length = 157

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (61%), Gaps = 8/138 (5%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           +LFAGK+V LFA+PGAFTPTCS+  LPG+  + D  + +G++ + C++VNDAFVM AWG+
Sbjct: 28  ELFAGKKVLLFAVPGAFTPTCSESHLPGYVVLADKFKAKGVDLIACVAVNDAFVMKAWGE 87

Query: 95  KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDN 154
                 + +L DG   FT+ +G+ +   N G G+RS RY  +I D VV    VE      
Sbjct: 88  AHNASELMMLGDGDASFTKSLGLEMDTANFG-GVRSQRYAMIIDDGVVTQLNVE------ 140

Query: 155 CATDPYEISSPENVLKVI 172
            A   +E+S  E +L+ +
Sbjct: 141 -APKEFEVSKAEVMLEAL 157


>gi|313499219|gb|ADR60585.1| Redoxin domain protein [Pseudomonas putida BIRD-1]
          Length = 166

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 96/172 (55%), Gaps = 15/172 (8%)

Query: 5   QIPQVVFHM--RVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG 62
           Q+P V  +     A     G KAF  ++         K+V +FALPGAFTPTCS+  +PG
Sbjct: 7   QLPDVTLYQYNNDAGACAIGPKAFSIRERCKH-----KKVLIFALPGAFTPTCSERHVPG 61

Query: 63  FEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYK 121
           +      L   G++E+ C+SVNDAFVMNAWG  L++ + VK++ DG+GEF+  +G+    
Sbjct: 62  YVAAAPALFAAGVDEILCVSVNDAFVMNAWGNSLQVGDAVKMIGDGNGEFSEALGLTQDL 121

Query: 122 DNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
              G G RS RY  L+ D VV+   VE       +   +E+S   ++L V+R
Sbjct: 122 SAGGLGRRSQRYAMLVDDQVVQYIAVE-------SPGKFEVSDAASMLAVLR 166


>gi|329897314|ref|ZP_08272032.1| AhpC/TSA family protein [gamma proteobacterium IMCC3088]
 gi|328921245|gb|EGG28644.1| AhpC/TSA family protein [gamma proteobacterium IMCC3088]
          Length = 159

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 83/141 (58%), Gaps = 7/141 (4%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           D+ T ++F GK+V LFA+PGAFTP CS   LPG+    D ++  G++ + C++VNDAFVM
Sbjct: 24  DITTAEIFDGKKVVLFAVPGAFTPGCSMTHLPGYVVNADKIKAAGVDTIVCMAVNDAFVM 83

Query: 90  NAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
            AWGK      + +L DG+GE T+ +G+ +     G G RS R+  +++D  V    VE 
Sbjct: 84  GAWGKAQNADEILMLADGNGELTKALGLELDGSGFGLGTRSQRFAMIVEDGKVTQLNVEP 143

Query: 150 GFSDNCATDPYEISSPENVLK 170
           G          ++SS E +++
Sbjct: 144 GPG-------VDVSSAETIMQ 157


>gi|153002707|ref|YP_001368388.1| redoxin domain-containing protein [Shewanella baltica OS185]
 gi|160877443|ref|YP_001556759.1| redoxin domain-containing protein [Shewanella baltica OS195]
 gi|217975280|ref|YP_002360031.1| Redoxin domain-containing protein [Shewanella baltica OS223]
 gi|304412084|ref|ZP_07393694.1| Redoxin domain protein [Shewanella baltica OS183]
 gi|307305979|ref|ZP_07585725.1| Redoxin domain protein [Shewanella baltica BA175]
 gi|151367325|gb|ABS10325.1| Redoxin domain protein [Shewanella baltica OS185]
 gi|160862965|gb|ABX51499.1| Redoxin domain protein [Shewanella baltica OS195]
 gi|217500415|gb|ACK48608.1| Redoxin domain protein [Shewanella baltica OS223]
 gi|304349634|gb|EFM14042.1| Redoxin domain protein [Shewanella baltica OS183]
 gi|306911472|gb|EFN41898.1| Redoxin domain protein [Shewanella baltica BA175]
 gi|315269645|gb|ADT96498.1| Redoxin domain protein [Shewanella baltica OS678]
          Length = 157

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/159 (41%), Positives = 91/159 (57%), Gaps = 14/159 (8%)

Query: 19  LPDGSKAFQWKD--VNTQ--DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           LP  +     KD  VN Q  +LFAGK+V LFA+PGAFTPTCS+  LPG+  + D  + +G
Sbjct: 8   LPAATLGQLTKDGMVNHQVTELFAGKKVVLFAVPGAFTPTCSEAHLPGYVVLADQFKAKG 67

Query: 75  IEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRY 133
           ++ + C++VNDAFVM AWG+      + +L DG   FT+ +G+    D  GF G+RS RY
Sbjct: 68  VDLIACVAVNDAFVMKAWGEAQNASELMMLADGDASFTKALGL--EMDTAGFGGVRSQRY 125

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
             +I + VV    VEE          +E S  E VL  +
Sbjct: 126 AMIIDNGVVTLLNVEE-------PKAFEASKAEVVLAAL 157


>gi|186477415|ref|YP_001858885.1| redoxin domain-containing protein [Burkholderia phymatum STM815]
 gi|184193874|gb|ACC71839.1| Redoxin domain protein [Burkholderia phymatum STM815]
          Length = 169

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 85/144 (59%), Gaps = 8/144 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +  D L   GI+E++C+SVNDAFVM A
Sbjct: 32  DVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEQADKLHAAGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           W +       V+++ DGS  FTR +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WARDQHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLHVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVIRE 174
                A   +E+S   ++L  + +
Sbjct: 150 -----APGKFEVSDAASILATLSQ 168


>gi|254227850|ref|ZP_04921281.1| Peroxiredoxin [Vibrio sp. Ex25]
 gi|262395891|ref|YP_003287744.1| antioxidant putative [Vibrio sp. Ex25]
 gi|151939892|gb|EDN58719.1| Peroxiredoxin [Vibrio sp. Ex25]
 gi|262339485|gb|ACY53279.1| antioxidant putative [Vibrio sp. Ex25]
          Length = 157

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D+L+ +G++ + C+SVNDAFVM A
Sbjct: 25  DVTELFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADELKAKGVDLIACVSVNDAFVMQA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   FT+ +G+    D  GF G+RS RY  +I++ +V    VEE 
Sbjct: 85  WGEAQNASEILMLGDGDASFTKALGL--EMDTGGFGGIRSQRYAMIIENGIVTKLNVEE- 141

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                    +E S  E +L  +
Sbjct: 142 ------PKEFEASKAETILAAL 157


>gi|113869220|ref|YP_727709.1| peroxiredoxin [Ralstonia eutropha H16]
 gi|113527996|emb|CAJ94341.1| Peroxiredoxin [Ralstonia eutropha H16]
          Length = 168

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 85/140 (60%), Gaps = 8/140 (5%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           DL  G+++ +F LPGAFTPTCS   +PGF +    LR  G++EV+C+SVNDAFVM AWG+
Sbjct: 35  DLVRGRKIVVFGLPGAFTPTCSAKHVPGFVQHAAALREAGVDEVWCVSVNDAFVMGAWGR 94

Query: 95  KLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSD 153
           + +    V+++ DGS E+TR +G+       G G+RS RY  +I D VV    VE     
Sbjct: 95  EQQTGGTVRMMADGSAEWTRALGLDQDLGARGMGVRSKRYAMVIDDGVVTRLDVE----- 149

Query: 154 NCATDPYEISSPENVLKVIR 173
             A   + +SS E VL  +R
Sbjct: 150 --APGEFRVSSAEAVLAALR 167


>gi|91785287|ref|YP_560493.1| type 2 peroxiredoxin AhpC/TSAfamily [Burkholderia xenovorans LB400]
 gi|91689241|gb|ABE32441.1| Putative type 2 peroxiredoxin, AhpC/TSAfamily [Burkholderia
           xenovorans LB400]
          Length = 167

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++  AGKRV +F LPGAFTPTCS   +PG+ +    LR  GI+E++C+SVNDAFVM A
Sbjct: 32  DVREQTAGKRVVIFGLPGAFTPTCSAKHVPGYVEHAGQLRALGIDEIWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG+       V+++ DGS  FTR +G+       G G+RS RY  ++ D VV++  VE  
Sbjct: 92  WGRDQHASGKVRMMADGSAAFTRALGLEQDLSARGMGIRSQRYAMVVDDGVVKTLNVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                A   +E+S   ++L  +
Sbjct: 150 -----AAGKFEVSDAGSILATL 166


>gi|330803683|ref|XP_003289833.1| hypothetical protein DICPUDRAFT_48839 [Dictyostelium purpureum]
 gi|325080092|gb|EGC33663.1| hypothetical protein DICPUDRAFT_48839 [Dictyostelium purpureum]
          Length = 167

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 67/154 (43%), Positives = 97/154 (62%), Gaps = 15/154 (9%)

Query: 21  DGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYC 80
           DGS     K VN+ DLF+ +RV +FALPGAFTPTCS   LPGF +   +++ + I+E++C
Sbjct: 23  DGSCPVAPK-VNSGDLFSNRRVVVFALPGAFTPTCSAKHLPGFIQKSGEIKSKNIDEIFC 81

Query: 81  LSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGL---RSWRYGAL 136
           L+ ND+FVM+AWGK+    + V L+ DG+ EFT+K+GM +  D  GF +   RS RY  +
Sbjct: 82  LATNDSFVMSAWGKEQGAGDSVTLISDGNSEFTKKIGMTL--DATGFLMGPERSKRYAMI 139

Query: 137 IKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           + D VV+   ++E          +E SS E +LK
Sbjct: 140 LDDGVVKHIGLDE--------SGFEHSSAEAILK 165


>gi|83719595|ref|YP_441672.1| AhpC/TSA family protein [Burkholderia thailandensis E264]
 gi|83653420|gb|ABC37483.1| AhpC/TSA family protein [Burkholderia thailandensis E264]
          Length = 185

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/133 (42%), Positives = 80/133 (60%), Gaps = 8/133 (6%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE 97
           AGKRV +F LPGAFTPTCS   +PG+    + LR  GI+E++C++VNDAFVM AWG+ L 
Sbjct: 55  AGKRVVIFGLPGAFTPTCSAQHVPGYVAQAERLRSAGIDEIWCVAVNDAFVMGAWGRDLH 114

Query: 98  IKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               V+++ DG   FT  +G+       G G+RS RY  ++ D VV++  VE       A
Sbjct: 115 TAGKVRMMADGGAAFTHALGLTQDLSARGMGIRSRRYAMVVDDGVVKTLLVE-------A 167

Query: 157 TDPYEISSPENVL 169
              +E+S   +VL
Sbjct: 168 PGKFEVSDAASVL 180


>gi|269961824|ref|ZP_06176181.1| antioxidant, putative [Vibrio harveyi 1DA3]
 gi|269833402|gb|EEZ87504.1| antioxidant, putative [Vibrio harveyi 1DA3]
          Length = 157

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/145 (42%), Positives = 87/145 (60%), Gaps = 12/145 (8%)

Query: 31  VNTQ--DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           VN Q  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C+SVNDAFV
Sbjct: 22  VNHQVTELFADKKVVLFAVPGAFTPTCSEAHLPGYVVLADQLKAKGVDLIACVSVNDAFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFV 147
           M AWG+      + +L DG   FT+ +G  +  D  GF G+RS RY  +I + VV +  V
Sbjct: 82  MQAWGEAQNASELLMLGDGDASFTKALG--IEMDTGGFGGVRSQRYAMIIDNGVVTTLNV 139

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           EE          +E S  E +L  +
Sbjct: 140 EE-------PKTFEASKAETILAAL 157


>gi|307111208|gb|EFN59443.1| hypothetical protein CHLNCDRAFT_29579 [Chlorella variabilis]
          Length = 210

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 88/146 (60%), Gaps = 8/146 (5%)

Query: 28  WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAF 87
            ++V    L  GK+V LFA+PGAFTPTCS   LPGF +  D+LR +G++ + C+SVNDAF
Sbjct: 71  MQEVAVGSLTKGKKVVLFAVPGAFTPTCSLKHLPGFIEKADELRAKGVDTIACVSVNDAF 130

Query: 88  VMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           VM+AWGK +     V +L DGS  F + +G  +   + G G+RS RY  L+ D  V+   
Sbjct: 131 VMDAWGKSVGADGKVMMLADGSAVFAQAIGAELDLADKGLGVRSRRYAMLVDDGTVKKLN 190

Query: 147 VEEGFSDNCATDPYEISSPENVLKVI 172
           +EEG +       + +S  +++L  +
Sbjct: 191 MEEGGA-------FTVSGADDILAAL 209


>gi|156977635|ref|YP_001448541.1| peroxiredoxin [Vibrio harveyi ATCC BAA-1116]
 gi|156529229|gb|ABU74314.1| hypothetical protein VIBHAR_06423 [Vibrio harveyi ATCC BAA-1116]
          Length = 157

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/145 (42%), Positives = 88/145 (60%), Gaps = 12/145 (8%)

Query: 31  VNTQ--DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           VN Q  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C+SVNDAFV
Sbjct: 22  VNHQVTELFADKKVVLFAVPGAFTPTCSEAHLPGYVVLADQLKAKGVDLIACVSVNDAFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFV 147
           M AWG+      + +L DG   FT+ +G+    D  GF G+RS RY  +I + VV +  V
Sbjct: 82  MQAWGEAQNASELLMLGDGDASFTKALGL--EMDTGGFGGVRSQRYAMIIDNGVVTTLNV 139

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           EE  +       +E S  E +L  +
Sbjct: 140 EEPTT-------FEASKAETILAAL 157


>gi|167966208|gb|ACA13182.1| type II peroxiredoxin [Xerophyta viscosa]
          Length = 162

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 97/166 (58%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   +PDG+  +     + K ++   L AGK++ L  +PGAFTPTCS   +P F +  
Sbjct: 4   IAVGETIPDGTLGWFDEKDELKQISIHSLAAGKKIVLIGVPGAFTPTCSMQHVPSFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++E   +SVND FVM AW K   E K+VK L DGSG++T+ +G+ +     G 
Sbjct: 64  EELKAKGVDEFLVISVNDPFVMKAWSKTYPENKHVKFLADGSGKYTQALGVELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           GLRS R+  L+ D+ V+   VEEG +       + IS  + +LK +
Sbjct: 124 GLRSRRFAILVDDLKVKVANVEEGGA-------FTISGADEILKAV 162


>gi|152981331|ref|YP_001354699.1| peroxiredoxin [Janthinobacterium sp. Marseille]
 gi|151281408|gb|ABR89818.1| peroxiredoxin [Janthinobacterium sp. Marseille]
          Length = 167

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 88/143 (61%), Gaps = 8/143 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V   +   GK++ +FA+PGAFTPTCS+   PG+ K  D  + +G++E++C+SVND FVM 
Sbjct: 32  VMVHEATKGKKIAIFAVPGAFTPTCSEQHAPGYIKAADQFKAKGVDEIWCISVNDPFVMG 91

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWG++ +    V+ + DGSG FT+ +G+       G G+RS RY  L++D VV+   VE+
Sbjct: 92  AWGREQKAAGKVRFIADGSGTFTKALGLEFDLTKGGLGVRSQRYSMLVEDGVVKQLNVED 151

Query: 150 GFSDNCATDPYEISSPENVLKVI 172
                  +   E+S+ E +L+ I
Sbjct: 152 -------SGHLEVSTAEKLLEQI 167


>gi|125620178|gb|ABN46981.1| thioredoxin-dependent peroxidase [Nelumbo nucifera]
          Length = 162

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 96/166 (57%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ ++       + V+   L  GK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   ISVGDVIPDGTLSYFDENDDQQKVSIHSLAVGKKVILFGVPGAFTPTCSLKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +G++E+  +SVND FVM AW K   + K+VK L DGS  +T  +G+ +     G 
Sbjct: 64  EELKSKGVDEILLISVNDPFVMKAWAKTYPDNKHVKFLADGSATYTHALGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G RS R+  L+ D+ V+   +E G         + +SS E++LK +
Sbjct: 124 GTRSRRFALLVDDLKVKVANIESG-------GEFTVSSAEDILKAL 162


>gi|153833675|ref|ZP_01986342.1| redoxin domain protein [Vibrio harveyi HY01]
 gi|148870073|gb|EDL69028.1| redoxin domain protein [Vibrio harveyi HY01]
          Length = 157

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 62/145 (42%), Positives = 87/145 (60%), Gaps = 12/145 (8%)

Query: 31  VNTQ--DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           VN Q  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C+SVNDAFV
Sbjct: 22  VNHQITELFADKKVVLFAVPGAFTPTCSEAHLPGYVVLADQLKAKGVDLIACVSVNDAFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFV 147
           M AWG+      + +L DG   FT+ +G+    D  GF G+RS RY  +I + VV +  V
Sbjct: 82  MQAWGEAQNASELLMLGDGDASFTKALGL--EMDTGGFGGVRSQRYAMIIDNGVVTTLNV 139

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           EE          +E S  E +L  +
Sbjct: 140 EE-------PKTFEASKAETILAAL 157


>gi|33595793|ref|NP_883436.1| AhpC/TSA-family protein [Bordetella parapertussis 12822]
 gi|33565872|emb|CAE36419.1| AhpC/TSA-family protein [Bordetella parapertussis]
          Length = 183

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 99/180 (55%), Gaps = 29/180 (16%)

Query: 7   PQVVFHMRVATVLPDGS----------------KAFQWKDVNTQDLFAGKRVFLFALPGA 50
           P+ +  ++V   +PDG+                 AFQ       DL  GK++ LFA+PGA
Sbjct: 13  PESLMTIKVGDRVPDGTLTEFIETETAGCTLGPNAFQ-----VADLVKGKKIALFAVPGA 67

Query: 51  FTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSG 109
           FTPTCS   LPG+ +    LR +GI+E++C++VNDAFVM AWG++ +    V++L DGS 
Sbjct: 68  FTPTCSAKHLPGYVEQAAALRAKGIDEIWCVAVNDAFVMGAWGREQQAGGKVRMLADGSA 127

Query: 110 EFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            +T  +G+ +     G G+RS RY ALI D VV+   +E       A   +E+S    +L
Sbjct: 128 LWTTALGLELDLVQRGMGVRSQRYSALIDDGVVKQLNIE-------APGKFEVSDAATML 180


>gi|33600320|ref|NP_887880.1| AhpC/TSA-family protein [Bordetella bronchiseptica RB50]
 gi|33567919|emb|CAE31832.1| AhpC/TSA-family protein [Bordetella bronchiseptica RB50]
 gi|332383083|gb|AEE67930.1| AhpC/TSA-family protein [Bordetella pertussis CS]
          Length = 167

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (59%), Gaps = 13/149 (8%)

Query: 22  GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCL 81
           G  AFQ       DL  GK++ LFA+PGAFTPTCS   LPG+ +    LR +GI+E++C+
Sbjct: 28  GPNAFQ-----VADLVKGKKIALFAVPGAFTPTCSAKHLPGYVEQAAALRAKGIDEIWCV 82

Query: 82  SVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
           +VNDAFVM AWG++ +    V++L DGS  +T  +G+ +     G G+RS RY ALI D 
Sbjct: 83  AVNDAFVMGAWGREQQAGGKVRMLADGSALWTTALGLELDLVQRGMGVRSQRYSALIDDG 142

Query: 141 VVESWFVEEGFSDNCATDPYEISSPENVL 169
           VV+   +E       A   +E+S    +L
Sbjct: 143 VVKQLNIE-------APGKFEVSDAATML 164


>gi|269966373|ref|ZP_06180458.1| antioxidant, putative [Vibrio alginolyticus 40B]
 gi|269828960|gb|EEZ83209.1| antioxidant, putative [Vibrio alginolyticus 40B]
          Length = 157

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D+L+ +G++ + C+SVNDAFVM A
Sbjct: 25  DVTELFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADELKAKGVDVIACVSVNDAFVMQA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   FT+ +G+ +  D  GF G+RS RY  +I++  V    VEE 
Sbjct: 85  WGEAQNASEILMLGDGDASFTKALGLEM--DTGGFGGIRSQRYAMIIENGTVTKLNVEE- 141

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                    +E S  E +L  +
Sbjct: 142 ------PKEFEASKAETILAAL 157


>gi|33593679|ref|NP_881323.1| AhpC/TSA-family protein [Bordetella pertussis Tohama I]
 gi|33563752|emb|CAE42992.1| AhpC/TSA-family protein [Bordetella pertussis Tohama I]
          Length = 167

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (59%), Gaps = 13/149 (8%)

Query: 22  GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCL 81
           G  AFQ       DL  GK++ LFA+PGAFTPTCS   LPG+ +    LR +GI+E++C+
Sbjct: 28  GPNAFQ-----VADLVKGKKIALFAVPGAFTPTCSAKHLPGYVEQAAALRAKGIDEIWCV 82

Query: 82  SVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
           +VNDAFVM AWG++ +    V++L DGS  +T  +G+ +     G G+RS RY ALI D 
Sbjct: 83  AVNDAFVMGAWGREQQAGGKVRMLADGSALWTTALGLELDLVQRGMGVRSQRYSALIDDG 142

Query: 141 VVESWFVEEGFSDNCATDPYEISSPENVL 169
           VV+   +E       A   +E+S    +L
Sbjct: 143 VVKQLNIE-------APGKFEVSDAATML 164


>gi|134095964|ref|YP_001101039.1| putative alkyl hydroperoxide reductase [Herminiimonas
           arsenicoxydans]
 gi|133739867|emb|CAL62918.1| Peroxiredoxin [Herminiimonas arsenicoxydans]
          Length = 167

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 87/143 (60%), Gaps = 8/143 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V   +   GK++ +FA+PGAFTPTCS+   PG+ K  D  + +G++E++C+SVND FVM 
Sbjct: 32  VMVHEATKGKKIAIFAVPGAFTPTCSETHAPGYIKAADQFKAKGVDEIWCISVNDPFVMG 91

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWG+  +    V+ + DGSG FT+ +GM       G G+RS RY  L++D VV+   VE+
Sbjct: 92  AWGRDQKAAGKVRFIADGSGTFTKALGMEFDLTKGGLGVRSQRYSMLVEDGVVKQLNVED 151

Query: 150 GFSDNCATDPYEISSPENVLKVI 172
                  +   E+S+ E +L+ I
Sbjct: 152 -------SGHLEVSTAEKLLEQI 167


>gi|329901118|ref|ZP_08272734.1| AhpC/TSA-family protein [Oxalobacteraceae bacterium IMCC9480]
 gi|327549217|gb|EGF33805.1| AhpC/TSA-family protein [Oxalobacteraceae bacterium IMCC9480]
          Length = 168

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 86/136 (63%), Gaps = 8/136 (5%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           DL  GK++ +F LPGA+TPTCS   +PG+ K   DL+ +G++E++C+SVNDAFVM AWG+
Sbjct: 36  DLTKGKKIAVFGLPGAYTPTCSAQHVPGYLKHAADLKAKGVDEIWCVSVNDAFVMGAWGR 95

Query: 95  KLEIKNV-KLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSD 153
           + +   V ++L DG+ +F + +G+       G G RS RY  LI D VV+   VE+G   
Sbjct: 96  EQKATGVIRMLADGNADFCKSLGLDADFSKFGMGTRSQRYSMLIDDGVVKQLNVEQG--- 152

Query: 154 NCATDPYEISSPENVL 169
                 +E+S+ E ++
Sbjct: 153 ----GKFEVSNAETLV 164


>gi|293607171|ref|ZP_06689513.1| AhpC/Tsa family antioxidant [Achromobacter piechaudii ATCC 43553]
 gi|292814505|gb|EFF73644.1| AhpC/Tsa family antioxidant [Achromobacter piechaudii ATCC 43553]
          Length = 167

 Score =  115 bits (287), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 84/128 (65%), Gaps = 6/128 (4%)

Query: 22  GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCL 81
           G  AFQ       DL  GK + LFALPGAFTPTCS   LPG+ +  D  + +G++E++C+
Sbjct: 28  GPNAFQ-----VSDLTRGKTIALFALPGAFTPTCSAKHLPGYVEQADAFKAKGMDEIWCV 82

Query: 82  SVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
           +VNDAFVM AWG++ + +  V++L DGS  +TR++G+ +     G G+RS RY ALI D 
Sbjct: 83  AVNDAFVMGAWGREQKTEGRVRMLADGSALWTRELGLELDLIARGMGVRSQRYSALIVDG 142

Query: 141 VVESWFVE 148
           VV+   VE
Sbjct: 143 VVKQLNVE 150


>gi|91224060|ref|ZP_01259323.1| putative antioxidant [Vibrio alginolyticus 12G01]
 gi|91190971|gb|EAS77237.1| putative antioxidant [Vibrio alginolyticus 12G01]
          Length = 157

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 86/142 (60%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D+L+ +G++ + C+SVNDAFVM A
Sbjct: 25  DVTELFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADELKAKGVDLIACVSVNDAFVMQA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEG 150
           WG+      + +L DG   FT+ +G+ +  D  GF G+RS RY  +I++  V    VEE 
Sbjct: 85  WGEAQNASEILMLGDGDASFTKALGLEM--DTGGFGGIRSQRYAMIIENGTVTKLNVEE- 141

Query: 151 FSDNCATDPYEISSPENVLKVI 172
                    +E S  E +L  +
Sbjct: 142 ------PKEFEASKAETILAAL 157


>gi|127514569|ref|YP_001095766.1| redoxin domain-containing protein [Shewanella loihica PV-4]
 gi|126639864|gb|ABO25507.1| Redoxin domain protein [Shewanella loihica PV-4]
          Length = 178

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 87/144 (60%), Gaps = 12/144 (8%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           DVN  +LFA K+V LFA+PGAFTPTCS+  LPG+  + D  + +G++ + C+SVNDAFVM
Sbjct: 46  DVN--ELFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADQFKAKGVDIIACVSVNDAFVM 103

Query: 90  NAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVE 148
            AWG+      + +L DG   FT+ +G+ +  D  GF G+RS RY  +I + VV    VE
Sbjct: 104 KAWGEAQNASELMMLADGDASFTKALGLEM--DTAGFGGIRSQRYAMVIDNGVVSLLNVE 161

Query: 149 EGFSDNCATDPYEISSPENVLKVI 172
                  A   +E+S  E VL  +
Sbjct: 162 -------APKSFEVSKAEVVLAAL 178


>gi|148548262|ref|YP_001268364.1| redoxin domain-containing protein [Pseudomonas putida F1]
 gi|148512320|gb|ABQ79180.1| Redoxin domain protein [Pseudomonas putida F1]
          Length = 166

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 84/135 (62%), Gaps = 8/135 (5%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK 99
           K+V +FALPGAFTPTCS+  +PG+      L   GI+E+ C+SVNDAFVMNAWG  +++ 
Sbjct: 39  KKVLIFALPGAFTPTCSERHVPGYVAAAPALFAAGIDEILCVSVNDAFVMNAWGNSMQVG 98

Query: 100 N-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATD 158
           + VK++ DG+GEF+  +G+       G G RS RY  L+ D VV+   VE       +  
Sbjct: 99  DAVKMIGDGNGEFSEALGLTQDLSARGLGRRSQRYAMLVDDQVVQYIAVE-------SPG 151

Query: 159 PYEISSPENVLKVIR 173
            +E+S   ++L V+R
Sbjct: 152 KFEVSDAASLLAVLR 166


>gi|224136087|ref|XP_002327377.1| predicted protein [Populus trichocarpa]
 gi|222835747|gb|EEE74182.1| predicted protein [Populus trichocarpa]
          Length = 164

 Score =  114 bits (286), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 100/169 (59%), Gaps = 16/169 (9%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   LP+ + ++     + +      L +GK+  LFA+PGAFTPTCS   LPGF +  
Sbjct: 3   ISVGDKLPEATLSYFDSEGELQTTTISSLTSGKKSILFAVPGAFTPTCSQKHLPGFVEKS 62

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN--VKLLPDGSGEFTRKMG--MLVYKDN 123
            +L+ +G++ + C+SVNDAFVM AW + L IK+  V LL DG+G+FT+ +G  + +    
Sbjct: 63  AELKSKGVDTIACISVNDAFVMKAWKEDLGIKDDGVLLLSDGNGDFTKAIGCELDLSDKP 122

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           VG G+RS RY  L +D VV+   +EEG +       +  S  E++LK +
Sbjct: 123 VGLGVRSRRYALLAEDGVVKVLNLEEGGA-------FTSSGAEDMLKAL 164


>gi|311108339|ref|YP_003981192.1| alkyl hydroperoxide reductase [Achromobacter xylosoxidans A8]
 gi|310763028|gb|ADP18477.1| AhpC/TSA family protein 8 [Achromobacter xylosoxidans A8]
          Length = 167

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 84/128 (65%), Gaps = 6/128 (4%)

Query: 22  GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCL 81
           G  AFQ       DL  GK + LFALPGAFTPTCS   LPG+ +    L+ +G++E++C+
Sbjct: 28  GPNAFQ-----VADLTRGKTIALFALPGAFTPTCSAKHLPGYVEQAAALKAKGVDEIWCV 82

Query: 82  SVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
           SVNDAFVM AWG++ + +  V++L DGS  +T+++G+ +     G G+RS RY ALI D 
Sbjct: 83  SVNDAFVMGAWGREQKTEGKVRMLADGSALWTKELGLELDLIQRGMGVRSQRYSALIVDG 142

Query: 141 VVESWFVE 148
           VV+   VE
Sbjct: 143 VVKQLNVE 150


>gi|300309684|ref|YP_003773776.1| type 2 peroxiredoxin (AhpC/TSA-family [Herbaspirillum seropedicae
           SmR1]
 gi|300072469|gb|ADJ61868.1| type 2 peroxiredoxin (AhpC/TSA-family) protein [Herbaspirillum
           seropedicae SmR1]
          Length = 168

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 84/137 (61%), Gaps = 8/137 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            DL  GK++ LFALPGAFTPTCS   +PG+  + D  + +G++E++C+SVNDAFVM AWG
Sbjct: 35  SDLVKGKKIALFALPGAFTPTCSAKHVPGYIALADQFKAKGVDEIWCISVNDAFVMGAWG 94

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +  +    V++  DGS  FT+ +GM         G+RS RY  L++D VV+   +E    
Sbjct: 95  RDQKATGIVRMFGDGSATFTKALGMEFDLTERNMGVRSQRYSMLVEDGVVKQLNLE---- 150

Query: 153 DNCATDPYEISSPENVL 169
              A   +E+S+ E +L
Sbjct: 151 ---APGKFEVSNAETLL 164


>gi|94312053|ref|YP_585263.1| peptidase S8/S53 subtilisin kexin sedolisin [Cupriavidus
           metallidurans CH34]
 gi|93355905|gb|ABF09994.1| Peroxiredoxin [Cupriavidus metallidurans CH34]
          Length = 168

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 88/143 (61%), Gaps = 8/143 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  +L  G+++ +F LPGAFTPTCS   +P + K YD LR  G++E++C SVNDAFVM A
Sbjct: 32  SVAELVKGRKIVVFGLPGAFTPTCSAKHVPSYLKEYDALRAAGVDEIWCHSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG++ +    V+++ DG+ ++ R +G+       G G+R+ RY  ++ D VV   F+EE 
Sbjct: 92  WGREQKATGKVRMMGDGAAQWARALGLDQDLSQRGLGVRAKRYAMVVDDGVVTHLFIEE- 150

Query: 151 FSDNCATDPYEISSPENVLKVIR 173
                    +++SS E VL+ +R
Sbjct: 151 ------PGEFKVSSAEWVLQALR 167


>gi|258621552|ref|ZP_05716585.1| antioxidant, putative [Vibrio mimicus VM573]
 gi|258586170|gb|EEW10886.1| antioxidant, putative [Vibrio mimicus VM573]
          Length = 158

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (61%), Gaps = 8/138 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++LFA K+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C+SVNDAFVM A
Sbjct: 26  SVKNLFASKKVVLFAVPGAFTPTCSEAHLPGYVVLADKLKDKGVDLIACVSVNDAFVMKA 85

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+      + +L DG   FT+ +G+ +   N G G+RS RY  +I++ VV    VE   
Sbjct: 86  WGEAHNASEILMLADGDASFTKALGLEMDTGNFG-GIRSQRYAMVIENNVVTLLNVEP-- 142

Query: 152 SDNCATDPYEISSPENVL 169
                   +E+S  E VL
Sbjct: 143 -----PKTFELSKAETVL 155


>gi|258627566|ref|ZP_05722343.1| antioxidant, putative [Vibrio mimicus VM603]
 gi|258580148|gb|EEW05120.1| antioxidant, putative [Vibrio mimicus VM603]
          Length = 158

 Score =  114 bits (285), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 96/168 (57%), Gaps = 13/168 (7%)

Query: 2   IRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLP 61
           +  QI Q +  ++++    +G+     K+     LFA K+V LFA+PGAFTPTCS+  LP
Sbjct: 1   MMIQIGQTLPDVQLSQRTSEGTLTHSVKN-----LFANKKVVLFAVPGAFTPTCSEAHLP 55

Query: 62  GFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYK 121
           G+  + D L+ +G++ + C+SVNDAFVM AWG+      + +L DG   FT+ +G+ +  
Sbjct: 56  GYVVLADKLKDKGVDLIACVSVNDAFVMKAWGEAQNASEILMLADGDASFTKALGLEMDT 115

Query: 122 DNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            N G G+RS RY  +I++ VV    VE           +E+S  E VL
Sbjct: 116 GNFG-GIRSQRYAMVIENNVVTLLNVEP-------PKTFELSKAETVL 155


>gi|73542657|ref|YP_297177.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Ralstonia eutropha JMP134]
 gi|72120070|gb|AAZ62333.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Ralstonia eutropha JMP134]
          Length = 168

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 87/143 (60%), Gaps = 8/143 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +  DL  G+++ +FALPGAFTPTCS   +PG+      LR  G++EV+C+SVNDAFVM A
Sbjct: 32  SVSDLVKGRKIVVFALPGAFTPTCSAKHVPGYVAEAQALRDAGVDEVWCVSVNDAFVMGA 91

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WG++   +  V+++ DGS E+TR +G+       G G+RS RY  ++ D VV    VE  
Sbjct: 92  WGREQHTEGKVRMMADGSAEWTRALGLDQDLSARGMGVRSKRYAMVLDDGVVTHLQVE-- 149

Query: 151 FSDNCATDPYEISSPENVLKVIR 173
                A   ++ SS E +L+ +R
Sbjct: 150 -----APGEFKASSAEAMLEALR 167


>gi|262277139|ref|ZP_06054932.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [alpha
           proteobacterium HIMB114]
 gi|262224242|gb|EEY74701.1| hybrid peroxiredoxin hyPrx5 (Thioredoxin reductase) [alpha
           proteobacterium HIMB114]
          Length = 159

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 87/142 (61%), Gaps = 7/142 (4%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           D F  K++  FALPGAFTPTCS++ +P +E+ Y+++   G++E+YC+S+ND FV+  W +
Sbjct: 25  DYFVEKKIVAFALPGAFTPTCSNYHVPAYEEEYENITALGVDEIYCISMNDPFVIEKWKE 84

Query: 95  KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDN 154
               K +K +PDG+G FT  M M+  +   G G RS+RY   ++D  +   F +E     
Sbjct: 85  ISGAKKIKFIPDGNGVFTNDMKMISDRSASGMGPRSFRYSMYVEDGNIIKLFKDE----- 139

Query: 155 CATDPYEISSPENVLKVIRESK 176
                ++IS P+ ++  ++E+K
Sbjct: 140 --DGKFDISDPKTMINFLKENK 159


>gi|212637553|ref|YP_002314078.1| AhpC/Tsa family antioxidant [Shewanella piezotolerans WP3]
 gi|212559037|gb|ACJ31491.1| Antioxidant, AhpC/Tsa family [Shewanella piezotolerans WP3]
          Length = 157

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 82/138 (59%), Gaps = 10/138 (7%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           LFA K+V LFA+PGAFTPTCS+  LPGF  + D+ +  G++ + C+SVNDAFVM AWG  
Sbjct: 29  LFADKKVVLFAVPGAFTPTCSEAHLPGFVVMADEFKARGVDIIACVSVNDAFVMKAWGVA 88

Query: 96  LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESWFVEEGFSDN 154
                + +L DG   FT+ +G+    +  GF G RS RY  ++ + VV +  VE      
Sbjct: 89  QNASELMMLADGDASFTKALGL--EMETAGFGGTRSQRYAMVVDNGVVTTLNVE------ 140

Query: 155 CATDPYEISSPENVLKVI 172
            A   +E+S+ E VL  I
Sbjct: 141 -APKSFEVSTAEAVLAAI 157


>gi|262171618|ref|ZP_06039296.1| antioxidant putative [Vibrio mimicus MB-451]
 gi|261892694|gb|EEY38680.1| antioxidant putative [Vibrio mimicus MB-451]
          Length = 157

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (61%), Gaps = 8/138 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + ++LFA K+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C+SVNDAFVM A
Sbjct: 25  SVKNLFASKKVVLFAVPGAFTPTCSEAHLPGYVVLADKLKDKGVDLIACVSVNDAFVMKA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+      + +L DG   FT+ +G+ +   N G G+RS RY  +I++ VV    VE   
Sbjct: 85  WGEAHNASEILMLADGDASFTKALGLEMDTGNFG-GIRSQRYAMVIENNVVTLLNVEP-- 141

Query: 152 SDNCATDPYEISSPENVL 169
                   +E+S  E VL
Sbjct: 142 -----PKTFELSKAETVL 154


>gi|103485662|ref|YP_615223.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Sphingopyxis alaskensis RB2256]
 gi|98975739|gb|ABF51890.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Sphingopyxis alaskensis RB2256]
          Length = 167

 Score =  114 bits (284), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 84/141 (59%), Gaps = 8/141 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+  D F G+RV LF++PGAFTPTCS   LPGF +  D L+ +G++E+ C +VNDAFVM 
Sbjct: 32  VSAADYFKGRRVALFSVPGAFTPTCSAKHLPGFVEKADALKAKGVDEIACTAVNDAFVMG 91

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW K     + V +L DG+G F   +G+ +     G G R  R+  +I D VVE   VE 
Sbjct: 92  AWSKSANAGDAVTMLADGNGAFAEAVGLTMDGTAFGMGKRGQRFSMIINDGVVEQLNVE- 150

Query: 150 GFSDNCATDPYEISSPENVLK 170
                 A   +++SS +++L+
Sbjct: 151 ------APGEFKVSSADHMLE 165


>gi|261855120|ref|YP_003262403.1| redoxin [Halothiobacillus neapolitanus c2]
 gi|261835589|gb|ACX95356.1| Redoxin domain protein [Halothiobacillus neapolitanus c2]
          Length = 158

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 90/143 (62%), Gaps = 4/143 (2%)

Query: 16  ATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI 75
           AT+   G +      V   ++ A +R+ LFA+PGAFTPTCSD  +PGF  + D +R +GI
Sbjct: 11  ATLYHRGEQGLNGCSVT--EMTAAQRIVLFAVPGAFTPTCSDAHVPGFMVLNDAIRAKGI 68

Query: 76  EEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYG 134
           + ++C++VND FVM  WG+ L + + ++++ DG+G FTR +GM     N   G+RS RY 
Sbjct: 69  DNIFCVAVNDPFVMKFWGEHLNVGDAIRMISDGNGMFTRALGMERDMSNGAMGIRSKRYA 128

Query: 135 ALIKDMVVESWFVEE-GFSDNCA 156
            ++ + VVE   V+E G +++ A
Sbjct: 129 MILNNGVVEWLGVDESGLANSSA 151


>gi|167997559|ref|XP_001751486.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162697467|gb|EDQ83803.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 169

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 90/150 (60%), Gaps = 10/150 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V+  +L  GK+V LFA+PGAFTPTCS   LPGF    ++LR  G++ + C+SVNDAFV
Sbjct: 25  QSVSVSELTRGKKVVLFAVPGAFTPTCSSKHLPGFVANAEELRKAGVDTLACVSVNDAFV 84

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV-YKDNV-GFGLRSWRYGALIKDMVVESW 145
           M AW K +   + V +L DG  +FT+ +G  V   D V G G+RS RY  L+ D VV+  
Sbjct: 85  MQAWAKSVGAGDKVLMLSDGLAKFTQALGTTVDLTDKVEGLGIRSRRYSMLVDDGVVKVL 144

Query: 146 FVEEGFSDNCATDPYEISSPENVLKVIRES 175
            +EEG         +  SS E +L  ++++
Sbjct: 145 NLEEG-------GAFTSSSAEEILSSLQKA 167


>gi|326488016|dbj|BAJ89847.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326509253|dbj|BAJ91543.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 226

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 98/173 (56%), Gaps = 16/173 (9%)

Query: 9   VVFHMRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG 62
           VV  + V   LPD + ++      + K V   DL AGK+V LFA+PGAFTPTCS   LPG
Sbjct: 61  VVATIAVGDKLPDATLSYFDPADGELKTVTVGDLTAGKKVVLFAVPGAFTPTCSQKHLPG 120

Query: 63  FEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK-LEIKNVKLLPDGSGEFTRKMG--MLV 119
           F +   +LR +G++ V C+SVNDAFVM AW +      +V LL DG+ E TR +G  M +
Sbjct: 121 FVEKAGELRAKGVDTVACVSVNDAFVMKAWKESLGLGDDVLLLSDGNLELTRALGVEMDL 180

Query: 120 YKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
               +G G+RS RY  L  D VV+   +EEG +       +  SS E +L  +
Sbjct: 181 SDKPMGLGVRSRRYALLADDGVVKVLNLEEGGA-------FTTSSAEEMLNAL 226


>gi|317404670|gb|EFV85064.1| AhpC/TSA-family protein [Achromobacter xylosoxidans C54]
          Length = 167

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 82/128 (64%), Gaps = 6/128 (4%)

Query: 22  GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCL 81
           G  AFQ       DL  GK + LFALPGAFTPTCS   LPG+ +    L+ +G++E++C+
Sbjct: 28  GPNAFQ-----VADLTRGKTIALFALPGAFTPTCSAKHLPGYVEQAAALKAKGVDEIWCV 82

Query: 82  SVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
           SVNDAFVM AWG++ +    V++L DGS  +T+ +G+ +     G G+RS RY ALI D 
Sbjct: 83  SVNDAFVMGAWGREQKTGGKVRMLADGSALWTKALGLELDLIQRGMGVRSQRYSALIVDG 142

Query: 141 VVESWFVE 148
           VV+   VE
Sbjct: 143 VVKQLNVE 150


>gi|115439131|ref|NP_001043845.1| Os01g0675100 [Oryza sativa Japonica Group]
 gi|75172153|sp|Q9FR35|PRX2C_ORYSJ RecName: Full=Peroxiredoxin-2C; AltName: Full=Peroxiredoxin IIC;
           AltName: Full=Thioredoxin reductase 2C
 gi|11761654|gb|AAG40130.1|AF203879_1 peroxiredoxin [Oryza sativa]
 gi|21104735|dbj|BAB93323.1| putative thioredoxin peroxidase [Oryza sativa Japonica Group]
 gi|21644633|dbj|BAC01192.1| putative thioredoxin peroxidase [Oryza sativa Japonica Group]
 gi|113533376|dbj|BAF05759.1| Os01g0675100 [Oryza sativa Japonica Group]
 gi|125527234|gb|EAY75348.1| hypothetical protein OsI_03241 [Oryza sativa Indica Group]
 gi|125571551|gb|EAZ13066.1| hypothetical protein OsJ_02985 [Oryza sativa Japonica Group]
 gi|215765019|dbj|BAG86716.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 162

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 93/166 (56%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   LPDG   +     + + V+   L AGK+V LF +PGAFTPTCS+  +PGF    
Sbjct: 4   VAVGDTLPDGQLGWFDGEDKLQQVSVHGLAAGKKVVLFGVPGAFTPTCSNQHVPGFINQA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           + L+ +G++++  +SVND FVM AW K   E K+VK L DG G +T+ +G+ +     G 
Sbjct: 64  EQLKAKGVDDILLVSVNDPFVMKAWAKSYPENKHVKFLADGLGTYTKALGLELDLSEKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L  ++ V    +EEG         + IS  E +LK +
Sbjct: 124 GIRSRRFALLADNLKVTVANIEEG-------GQFTISGAEEILKAL 162


>gi|329851453|ref|ZP_08266210.1| redoxin family protein [Asticcacaulis biprosthecum C19]
 gi|328840299|gb|EGF89871.1| redoxin family protein [Asticcacaulis biprosthecum C19]
          Length = 160

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 82/137 (59%), Gaps = 8/137 (5%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           + FAGK V LFA+PGAFTPTCS   LPGF+    D   +G++ V C SVND FVM AW K
Sbjct: 29  EFFAGKTVVLFAVPGAFTPTCSARHLPGFKDHVADFTSKGVDVVACTSVNDYFVMKAWAK 88

Query: 95  KLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSD 153
              I + V LL DG+G+F + +G+ +     G G RS RY  ++KD  V+  FVE     
Sbjct: 89  DQGIVDEVVLLADGNGDFAKAVGLELDGTGFGMGPRSKRYAMVVKDGKVDQLFVE----- 143

Query: 154 NCATDPYEISSPENVLK 170
             A   + +SS E+VL+
Sbjct: 144 --APGEFRVSSAEHVLE 158


>gi|262165592|ref|ZP_06033329.1| antioxidant putative [Vibrio mimicus VM223]
 gi|262025308|gb|EEY43976.1| antioxidant putative [Vibrio mimicus VM223]
          Length = 157

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 84/138 (60%), Gaps = 8/138 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           + + LFA K+V LFA+PGAFTPTCS+  LPG+  + D L+ +G++ + C+SVNDAFVM A
Sbjct: 25  SVKTLFANKKVVLFAVPGAFTPTCSEAHLPGYVILADKLKDKGVDLIACVSVNDAFVMKA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+      + +L DG   FT+ +G+ +   N G G+RS RY  +I++ VV    VE   
Sbjct: 85  WGEAQNASEILMLADGDASFTKALGLEMDTGNFG-GIRSQRYAMVIENNVVTLLNVEP-- 141

Query: 152 SDNCATDPYEISSPENVL 169
                   +E+S  E VL
Sbjct: 142 -----PKTFELSKAETVL 154


>gi|307292818|ref|ZP_07572664.1| Redoxin domain protein [Sphingobium chlorophenolicum L-1]
 gi|306880884|gb|EFN12100.1| Redoxin domain protein [Sphingobium chlorophenolicum L-1]
          Length = 160

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 85/143 (59%), Gaps = 8/143 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V + + FAG+ V LF++PGAFTPTCS   LPGF    +D++ +G++E+ C +VNDAFVM 
Sbjct: 25  VASDEYFAGRTVALFSVPGAFTPTCSARHLPGFVDKAEDIKGKGVDEIACTAVNDAFVMG 84

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWGK    +  V +L DG+ +F + +G+ +     G G R  R+  ++KD VV    VE 
Sbjct: 85  AWGKSANAEGKVTMLADGNADFAKAVGLTMDGSGFGMGTRGQRFSMIVKDGVVSELNVE- 143

Query: 150 GFSDNCATDPYEISSPENVLKVI 172
                 A   +++SS E +L  I
Sbjct: 144 ------APGDFKVSSAEYLLDQI 160


>gi|319787392|ref|YP_004146867.1| redoxin [Pseudoxanthomonas suwonensis 11-1]
 gi|317465904|gb|ADV27636.1| Redoxin domain protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 160

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 97/167 (58%), Gaps = 19/167 (11%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           QIP+VV       V          + V+T  LF  ++V LFA+PGAFTPTCS+  LPGF 
Sbjct: 8   QIPEVVLKRIREGV----------ESVDTPTLFEARKVVLFAVPGAFTPTCSEKHLPGFI 57

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDN 123
           + ++D R  GI EV C++VND FVM AWG+ L+  + ++L+ DG+ + TR +G+ +    
Sbjct: 58  ERFEDFRNRGI-EVICMAVNDPFVMQAWGRTLDAPEGLQLVSDGNADLTRALGLEMDASG 116

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
            G G+R+ R+    ++ VV   FVE       A   +++SS + VL+
Sbjct: 117 YGMGIRAKRFALYAENGVVRELFVE-------APGEFKVSSADYVLE 156


>gi|153825303|ref|ZP_01977970.1| antioxidant, putative [Vibrio cholerae MZO-2]
 gi|153828800|ref|ZP_01981467.1| putative antioxidant [Vibrio cholerae 623-39]
 gi|229521458|ref|ZP_04410877.1| hypothetical protein VIF_001995 [Vibrio cholerae TM 11079-80]
 gi|229523545|ref|ZP_04412950.1| hypothetical protein VCA_001111 [Vibrio cholerae bv. albensis
           VL426]
 gi|148875753|gb|EDL73888.1| putative antioxidant [Vibrio cholerae 623-39]
 gi|149741131|gb|EDM55190.1| antioxidant, putative [Vibrio cholerae MZO-2]
 gi|229337126|gb|EEO02143.1| hypothetical protein VCA_001111 [Vibrio cholerae bv. albensis
           VL426]
 gi|229341556|gb|EEO06559.1| hypothetical protein VIF_001995 [Vibrio cholerae TM 11079-80]
          Length = 157

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 81/134 (60%), Gaps = 8/134 (5%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           LFA K+V LFA+PGAFTPTCS+  LPG+  + D  + +G++ + C+SVNDAFVM AWG+ 
Sbjct: 29  LFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADKFKEKGVDMIACVSVNDAFVMKAWGEA 88

Query: 96  LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNC 155
                + +L DG   FT+ +G+ +   N G G+RS RY  +I++ VV    VE       
Sbjct: 89  QNASEITMLADGDASFTKALGLEMDTGNFG-GVRSQRYAMVIENNVVTLLNVEP------ 141

Query: 156 ATDPYEISSPENVL 169
               +E+S  E VL
Sbjct: 142 -PKTFELSKAETVL 154


>gi|254286551|ref|ZP_04961507.1| antioxidant, putative [Vibrio cholerae AM-19226]
 gi|150423309|gb|EDN15254.1| antioxidant, putative [Vibrio cholerae AM-19226]
          Length = 157

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 81/134 (60%), Gaps = 8/134 (5%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           LFA K+V LFA+PGAFTPTCS+  LPG+  + D  + +G++ + C+SVNDAFVM AWG+ 
Sbjct: 29  LFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADKFKEKGVDMIACVSVNDAFVMKAWGEA 88

Query: 96  LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNC 155
                + +L DG   FT+ +G+ +   N G G+RS RY  +I++ VV    VE       
Sbjct: 89  QNASEIAMLADGDASFTKALGLEMDTGNFG-GVRSQRYAMVIENNVVTLLNVEP------ 141

Query: 156 ATDPYEISSPENVL 169
               +E+S  E VL
Sbjct: 142 -PKTFELSKAETVL 154


>gi|15641362|ref|NP_230994.1| antioxidant, putative [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|153213487|ref|ZP_01948798.1| antioxidant, putative [Vibrio cholerae 1587]
 gi|183179351|ref|ZP_02957562.1| antioxidant, putative [Vibrio cholerae MZO-3]
 gi|229511263|ref|ZP_04400742.1| hypothetical protein VCE_002670 [Vibrio cholerae B33]
 gi|229515724|ref|ZP_04405183.1| hypothetical protein VCB_003382 [Vibrio cholerae TMA 21]
 gi|229518381|ref|ZP_04407825.1| hypothetical protein VCC_002405 [Vibrio cholerae RC9]
 gi|229608071|ref|YP_002878719.1| hypothetical protein VCD_002989 [Vibrio cholerae MJ-1236]
 gi|254848473|ref|ZP_05237823.1| antioxidant [Vibrio cholerae MO10]
 gi|255745741|ref|ZP_05419689.1| antioxidant putative [Vibrio cholera CIRS 101]
 gi|262158981|ref|ZP_06030093.1| antioxidant putative [Vibrio cholerae INDRE 91/1]
 gi|297578938|ref|ZP_06940866.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|9655843|gb|AAF94508.1| antioxidant, putative [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|124115951|gb|EAY34771.1| antioxidant, putative [Vibrio cholerae 1587]
 gi|183012762|gb|EDT88062.1| antioxidant, putative [Vibrio cholerae MZO-3]
 gi|229345096|gb|EEO10070.1| hypothetical protein VCC_002405 [Vibrio cholerae RC9]
 gi|229347493|gb|EEO12453.1| hypothetical protein VCB_003382 [Vibrio cholerae TMA 21]
 gi|229351228|gb|EEO16169.1| hypothetical protein VCE_002670 [Vibrio cholerae B33]
 gi|229370726|gb|ACQ61149.1| hypothetical protein VCD_002989 [Vibrio cholerae MJ-1236]
 gi|254844178|gb|EET22592.1| antioxidant [Vibrio cholerae MO10]
 gi|255736816|gb|EET92213.1| antioxidant putative [Vibrio cholera CIRS 101]
 gi|262029166|gb|EEY47818.1| antioxidant putative [Vibrio cholerae INDRE 91/1]
 gi|297536532|gb|EFH75365.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 157

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 81/134 (60%), Gaps = 8/134 (5%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           LFA K+V LFA+PGAFTPTCS+  LPG+  + D  + +G++ + C+SVNDAFVM AWG+ 
Sbjct: 29  LFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADKFKEKGVDMIACVSVNDAFVMKAWGEA 88

Query: 96  LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNC 155
                + +L DG   FT+ +G+ +   N G G+RS RY  +I++ VV    VE       
Sbjct: 89  QNASEIAMLADGDASFTKALGLEMDTGNFG-GVRSQRYAMVIENNVVTLLNVEP------ 141

Query: 156 ATDPYEISSPENVL 169
               +E+S  E VL
Sbjct: 142 -PKTFELSKAETVL 154


>gi|119475500|ref|ZP_01615853.1| antioxidant, AhpC/Tsa family protein [marine gamma proteobacterium
           HTCC2143]
 gi|119451703|gb|EAW32936.1| antioxidant, AhpC/Tsa family protein [marine gamma proteobacterium
           HTCC2143]
          Length = 158

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 86/162 (53%), Gaps = 12/162 (7%)

Query: 13  MRVATVLPDGS----KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           ++V   LP GS     A   ++    DLF GK+V + A+PGAFTP CS   LPGF    D
Sbjct: 3   VKVGDKLPAGSLKVMGAEGPQEFTISDLFDGKKVVMLAVPGAFTPGCSMTHLPGFVVSAD 62

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
            ++  GI+ + CLSVNDAFVM AWG       + +  DGS ++T+ +G+ +     G GL
Sbjct: 63  KIKANGIDSIICLSVNDAFVMGAWGTAQNADEIIMAADGSADYTKALGLEMDASGFGMGL 122

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           RS RY  ++ D V+    V+            E S+ E VL+
Sbjct: 123 RSKRYAMIVDDGVITYLGVD--------AKAIEASAAEAVLE 156


>gi|296936619|gb|ADH94060.1| putative peroxiredoxin [Phlebotomus perniciosus]
          Length = 158

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/128 (47%), Positives = 81/128 (63%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VNT DL  GK+V LFA+PGAFTP CS   LPG+    DDL+ +G+ E+ C+SVND FVM+
Sbjct: 24  VNTADLCRGKKVILFAVPGAFTPGCSKTHLPGYVDKADDLKGQGVSEIVCVSVNDPFVMS 83

Query: 91  AWGK-KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK       V++L D SG FT+ M + V    +G G RS RY  +++D  V+S  VE 
Sbjct: 84  AWGKDHAAAGKVRMLADPSGVFTKAMDLGVDLPPLG-GFRSKRYSMVVEDGTVKSLNVEP 142

Query: 149 EGFSDNCA 156
           +G    C+
Sbjct: 143 DGTGLTCS 150


>gi|219921373|emb|CAQ52405.1| peroxyredoxin [Laminaria digitata]
          Length = 161

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 88/156 (56%), Gaps = 12/156 (7%)

Query: 18  VLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEE 77
           +L DG  A    DV   D+FAGK+V +  +PGAFTPTCSD  LP F  + D+ + +G++ 
Sbjct: 17  ILGDGGPA----DVPAADVFAGKKVVICGVPGAFTPTCSDDHLPSFIALADEFKAKGVDT 72

Query: 78  VYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGAL 136
           V CLSVNDAFVM+ W K L+  + V +L DG G F  + G+ V     G G R  R   +
Sbjct: 73  VACLSVNDAFVMSRWIKSLDAADKVTMLADGGGVFAEESGLCVKTGKFG-GTRLQRLAMI 131

Query: 137 IKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           + D  +E  F+E+G      T   ++SS   VL  +
Sbjct: 132 VNDGTIEKLFLEDG------TGYTDLSSGAGVLAAL 161


>gi|121591226|ref|ZP_01678527.1| antioxidant, putative [Vibrio cholerae 2740-80]
 gi|121728765|ref|ZP_01681779.1| antioxidant, putative [Vibrio cholerae V52]
 gi|147674520|ref|YP_001216912.1| putative antioxidant [Vibrio cholerae O395]
 gi|153818367|ref|ZP_01971034.1| antioxidant, putative [Vibrio cholerae NCTC 8457]
 gi|227081521|ref|YP_002810072.1| putative antioxidant [Vibrio cholerae M66-2]
 gi|229505067|ref|ZP_04394577.1| hypothetical protein VCF_000273 [Vibrio cholerae BX 330286]
 gi|298498563|ref|ZP_07008370.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|121546924|gb|EAX57075.1| antioxidant, putative [Vibrio cholerae 2740-80]
 gi|121628942|gb|EAX61395.1| antioxidant, putative [Vibrio cholerae V52]
 gi|126511114|gb|EAZ73708.1| antioxidant, putative [Vibrio cholerae NCTC 8457]
 gi|146316403|gb|ABQ20942.1| putative antioxidant [Vibrio cholerae O395]
 gi|227009409|gb|ACP05621.1| putative antioxidant [Vibrio cholerae M66-2]
 gi|227013267|gb|ACP09477.1| putative antioxidant [Vibrio cholerae O395]
 gi|229357290|gb|EEO22207.1| hypothetical protein VCF_000273 [Vibrio cholerae BX 330286]
 gi|297542896|gb|EFH78946.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
          Length = 157

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/134 (42%), Positives = 81/134 (60%), Gaps = 8/134 (5%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           LFA K+V LFA+PGAFTPTCS+  LPG+  + D  + +G++ + C+SVNDAFVM AWG+ 
Sbjct: 29  LFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADKYKEKGVDMIACVSVNDAFVMKAWGEA 88

Query: 96  LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNC 155
                + +L DG   FT+ +G+ +   N G G+RS RY  +I++ VV    VE       
Sbjct: 89  QNASEITMLADGDASFTKALGLEMDTGNFG-GVRSQRYAMVIENNVVTLLNVEP------ 141

Query: 156 ATDPYEISSPENVL 169
               +E+S  E VL
Sbjct: 142 -PKTFELSKAETVL 154


>gi|222109503|ref|YP_002551767.1| redoxin domain-containing protein [Acidovorax ebreus TPSY]
 gi|221728947|gb|ACM31767.1| Redoxin domain protein [Acidovorax ebreus TPSY]
          Length = 168

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 82/140 (58%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+ Q   AGK + LFA+PGAFTPTCS   +PG+ +   DL+  G++E++CLSVNDAFVM 
Sbjct: 31  VDVQKAAAGKTIALFAVPGAFTPTCSAKHVPGYVEQAGDLKAAGVDEIWCLSVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DG   F +  G+ +  +  G GLRS RY  L+KD  V +  VE 
Sbjct: 91  AWARDQKTDGKVRMLADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVKDGKVVALNVE- 149

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A   +E+S    +L
Sbjct: 150 ------APGKFEVSDAATLL 163


>gi|85373834|ref|YP_457896.1| AhpC/TSA family protein [Erythrobacter litoralis HTCC2594]
 gi|84786917|gb|ABC63099.1| AhpC/TSA family protein [Erythrobacter litoralis HTCC2594]
          Length = 159

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 82/141 (58%), Gaps = 7/141 (4%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V + + FAGK+V LFA+PGAFTPTCS   LPG+ +  ++L+ +G++E+   SVND FV
Sbjct: 23  EQVKSSEFFAGKKVALFAVPGAFTPTCSAKHLPGYVEKAEELKAKGVDEIAVTSVNDPFV 82

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           M AW K      +  L DG+GEF   +G+ +     G G RS RY  +++D  V    VE
Sbjct: 83  MGAWQKADGSDEITFLADGNGEFAEAIGLTMDGSGFGLGTRSQRYSMIVEDGKVTELNVE 142

Query: 149 EGFSDNCATDPYEISSPENVL 169
                  A   + +SS E++L
Sbjct: 143 -------APGDFSVSSAEHML 156


>gi|85708403|ref|ZP_01039469.1| AhpC/TSA family protein [Erythrobacter sp. NAP1]
 gi|85689937|gb|EAQ29940.1| AhpC/TSA family protein [Erythrobacter sp. NAP1]
          Length = 159

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 84/141 (59%), Gaps = 7/141 (4%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V++ + FAGK+V LF++PGAFTPTCS   LPGF +  DDL+ +G++E+   +VNDAFV
Sbjct: 23  QQVSSSEYFAGKKVALFSVPGAFTPTCSAKHLPGFVEKADDLKAKGVDEIVGTAVNDAFV 82

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           M AW       ++ +L DG+ +F   +G+ +     G G R  R+  +I+D  V    +E
Sbjct: 83  MGAWNSAAGSDDITMLADGNADFAEAVGLTMDGSGFGMGKRGQRFSMVIEDGTVTQLNIE 142

Query: 149 EGFSDNCATDPYEISSPENVL 169
           E          +++SS E++L
Sbjct: 143 E-------PGDFKVSSAEHML 156


>gi|328872774|gb|EGG21141.1| peroxiredoxin [Dictyostelium fasciculatum]
          Length = 168

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 87/147 (59%), Gaps = 1/147 (0%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P  +   +    LP+         V +  LF GK+V L A+PGAFTPTCS   +PGF 
Sbjct: 8   KVPYDITLWKAVQPLPEDGACPIPTKVQSNTLFEGKKVVLVAVPGAFTPTCSVKHIPGFV 67

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D+++ +GI+ VYC++VND FVM+ W    +  + V+   DG+G+FT+K+G+      
Sbjct: 68  EKIDEIKAKGIDAVYCIAVNDGFVMSYWAADQKAGDKVQFFGDGNGDFTKKIGLTKDCTA 127

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEEG 150
            G G+RS RY  +I D +V+S  V+ G
Sbjct: 128 FGLGIRSERYAIVIHDGIVKSIAVDAG 154


>gi|261210922|ref|ZP_05925212.1| antioxidant putative [Vibrio sp. RC341]
 gi|260839897|gb|EEX66497.1| antioxidant putative [Vibrio sp. RC341]
          Length = 157

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 91/161 (56%), Gaps = 12/161 (7%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           +++   LPD   + +  +     + + LFA K+V LFA+PGAFTPTCS+  LPG+    D
Sbjct: 2   IQIGQTLPDAQLSQRTSEGTLTHSVKTLFANKKVVLFAVPGAFTPTCSEAHLPGYVVFAD 61

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
             + +G++ + C+SVNDAFVM AWG+      + +L DG   FT+ +G+ +   N G G+
Sbjct: 62  QFKEKGVDVIACVSVNDAFVMKAWGEAQNASEILMLADGDASFTKALGLEMDTGNFG-GV 120

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
           RS RY  +I++ VV    VE           +E+S  E VL
Sbjct: 121 RSQRYAMVIENNVVTLLNVEP-------PKTFELSKAETVL 154


>gi|229529571|ref|ZP_04418961.1| hypothetical protein VCG_002666 [Vibrio cholerae 12129(1)]
 gi|229333345|gb|EEN98831.1| hypothetical protein VCG_002666 [Vibrio cholerae 12129(1)]
 gi|327484023|gb|AEA78430.1| Antioxidant, putative [Vibrio cholerae LMA3894-4]
          Length = 157

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           LFA K+V LFA+PGAFTPTCS+  LPG+  + D  + +G++ + C+SVNDAFVM AWG+ 
Sbjct: 29  LFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADKFKEKGVDMIACVSVNDAFVMKAWGEA 88

Query: 96  LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
                + +L DG   FT+ +G+ +   N G G+RS RY  +I++ VV    VE
Sbjct: 89  QNASEITMLADGDASFTKALGLEMDTGNFG-GVRSQRYAMVIENNVVTLLNVE 140


>gi|221069440|ref|ZP_03545545.1| Redoxin domain protein [Comamonas testosteroni KF-1]
 gi|220714463|gb|EED69831.1| Redoxin domain protein [Comamonas testosteroni KF-1]
          Length = 168

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 84/140 (60%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V   +  AGK V +FA+PGAFTPTCS+  LPG+    ++L+  G++E++CLSVNDAFVM 
Sbjct: 31  VKLPEALAGKTVAVFAVPGAFTPTCSEKHLPGYVAKAEELKAAGVDEIWCLSVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWG+  ++   V+++ DG   F +  G+ +  +  G GLR+ R+  L+KD  V +  VE 
Sbjct: 91  AWGRDQKVAGKVRMIADGDAAFAKATGLTLDLNGKGLGLRANRFSMLVKDGKVATLNVE- 149

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A   +E+S    +L
Sbjct: 150 ------APGKFEVSDAATML 163


>gi|300024400|ref|YP_003757011.1| redoxin [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526221|gb|ADJ24690.1| Redoxin domain protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 164

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 86/144 (59%), Gaps = 9/144 (6%)

Query: 13  MRVATVLPD------GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKI 66
           + V   LPD      GS   + K V   ++FAGK+V LFA+PGA+TPTCS+  +PGF   
Sbjct: 2   INVGDKLPDAKFTVMGSDGPKPKTV--AEVFAGKKVALFAVPGAYTPTCSNDHMPGFVNR 59

Query: 67  YDDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125
            D+L+ +GI+ + C +VND FV+  W K       +++L DGSG+F + +G+ +     G
Sbjct: 60  VDELKAKGIDAIACTAVNDVFVLTNWAKDTGAAGKIEMLADGSGDFAKAIGLDIDLAGFG 119

Query: 126 FGLRSWRYGALIKDMVVESWFVEE 149
            GLRS RY  L+ D VV+   VE+
Sbjct: 120 LGLRSKRYAMLVDDGVVKVLNVED 143


>gi|297841183|ref|XP_002888473.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297334314|gb|EFH64732.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 535

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 88/144 (61%), Gaps = 6/144 (4%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ +F     Q +  +   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVVPDGTISFVDDNDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+   ++E+ C SVND FVM AWGK   E K+VK + DGSG++T  +G+ +   + G 
Sbjct: 64  EELKSNYVDEIICFSVNDPFVMKAWGKTYAENKHVKFVADGSGKYTHLLGLELDLKDKGH 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEG 150
           G+RS  +  LI ++ V    VE G
Sbjct: 124 GVRSKSFALLIDNLKVIVAKVESG 147


>gi|308050072|ref|YP_003913638.1| redoxin [Ferrimonas balearica DSM 9799]
 gi|307632262|gb|ADN76564.1| Redoxin domain protein [Ferrimonas balearica DSM 9799]
          Length = 158

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 78/137 (56%), Gaps = 8/137 (5%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           FAG+ V LFA+PGAFTPTCS+  LPG+  + D L+  G + + C++VNDAFVM AWG   
Sbjct: 29  FAGRTVVLFAVPGAFTPTCSEAHLPGYVVLADKLKAAGADAIACVAVNDAFVMKAWGDSQ 88

Query: 97  EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               + +L DG G   + MG+ +     G G R+ RY  ++KD VV    VE       A
Sbjct: 89  NADAIDMLADGDGSAHKAMGLSMETGAFG-GTRAQRYAMIVKDNVVTVLNVE-------A 140

Query: 157 TDPYEISSPENVLKVIR 173
              +E+S  E +LK + 
Sbjct: 141 PKAFEVSDAETLLKALN 157


>gi|319761148|ref|YP_004125085.1| redoxin domain protein [Alicycliphilus denitrificans BC]
 gi|317115709|gb|ADU98197.1| Redoxin domain protein [Alicycliphilus denitrificans BC]
          Length = 168

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 83/140 (59%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+ Q   AGK + LFA+PGAFTPTCS   +PG+ +  + L+  G++E++CL+VNDAFVM 
Sbjct: 31  VDVQKAAAGKTIALFAVPGAFTPTCSAKHVPGYVEQAEALKAAGVDEIWCLAVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DG   F + +G+ +  +  G GLRS RY  L+KD  V +  VE 
Sbjct: 91  AWARDQKTAGKVRMLADGDAAFAKAVGLTLDLNGKGLGLRSNRYSMLVKDGKVATLNVE- 149

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A   +E+S    +L
Sbjct: 150 ------APGKFEVSDAATLL 163


>gi|330823006|ref|YP_004386309.1| Redoxin domain-containing protein [Alicycliphilus denitrificans
           K601]
 gi|329308378|gb|AEB82793.1| Redoxin domain protein [Alicycliphilus denitrificans K601]
          Length = 168

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 83/140 (59%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+ Q   AGK + LFA+PGAFTPTCS   +PG+ +  + L+  G++E++CL+VNDAFVM 
Sbjct: 31  VDVQKAAAGKTIALFAVPGAFTPTCSAKHVPGYVEQAEALKAAGVDEIWCLAVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DG   F + +G+ +  +  G GLRS RY  L+KD  V +  VE 
Sbjct: 91  AWARDQKTAGKVRMLADGDAAFAKAVGLTLDLNGKGLGLRSNRYSMLVKDGKVATLNVE- 149

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A   +E+S    +L
Sbjct: 150 ------APGKFEVSDAATLL 163


>gi|262192396|ref|ZP_06050549.1| antioxidant putative [Vibrio cholerae CT 5369-93]
 gi|262031749|gb|EEY50334.1| antioxidant putative [Vibrio cholerae CT 5369-93]
          Length = 157

 Score =  110 bits (276), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 80/134 (59%), Gaps = 8/134 (5%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           LFA K+V LFA+PGAFTPTCS+  LPG+  + D  + +G++ + C+SVNDAFVM AWG+ 
Sbjct: 29  LFANKKVVLFAVPGAFTPTCSEAHLPGYVVLVDKFKEKGVDMIACVSVNDAFVMKAWGEA 88

Query: 96  LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNC 155
                + +L DG   FT+ +G+ +   N G G+RS RY  +I++  V    VE       
Sbjct: 89  QNASEIAMLADGDASFTKALGLEMDTGNFG-GVRSQRYAMVIENNAVTLLNVEP------ 141

Query: 156 ATDPYEISSPENVL 169
               +E+S  E VL
Sbjct: 142 -PKTFELSKAETVL 154


>gi|170744311|ref|YP_001772966.1| redoxin domain-containing protein [Methylobacterium sp. 4-46]
 gi|168198585|gb|ACA20532.1| Redoxin domain protein [Methylobacterium sp. 4-46]
          Length = 160

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 91/166 (54%), Gaps = 15/166 (9%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQ  F +  A    DG  A       T D+F G+RV L A+PGAFTPTC  + LPG+ 
Sbjct: 8   HLPQATFRVMTA----DGPVA-----KTTDDVFKGRRVVLVAVPGAFTPTCHRNHLPGYV 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
               ++   GI+ +   SVND FV++AW K    + ++ L DG+G+F + +G+ +     
Sbjct: 59  AKRAEILSHGIDGIAVTSVNDVFVLDAWAKAAGAEGIEFLADGNGDFAKAIGLDMDGAGF 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           G G+RS RY  L++D VV +  VE+  S        E+SS E +LK
Sbjct: 119 GLGVRSKRYAMLVEDGVVRALNVEDTPS------KAEVSSAEALLK 158


>gi|66808689|ref|XP_638067.1| hypothetical protein DDB_G0285741 [Dictyostelium discoideum AX4]
 gi|60466656|gb|EAL64708.1| hypothetical protein DDB_G0285741 [Dictyostelium discoideum AX4]
          Length = 172

 Score =  110 bits (275), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 100/169 (59%), Gaps = 16/169 (9%)

Query: 8   QVVFHMRVATVLP--DGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +V   + +   LP  DG  A   K V + +LF  ++V LFA+PGAFTPTCS   LPGF +
Sbjct: 12  KVPMDVTLGKALPPVDGVCAMAPK-VLSGELFKDRKVVLFAVPGAFTPTCSAKHLPGFIE 70

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNV 124
             ++++ +GI E++C++ ND FVM+AWGK +     V LL DG+ EFT+K+G+ +  D  
Sbjct: 71  KSEEIKKKGISEIFCIATNDPFVMSAWGKDVNAGTAVTLLSDGNSEFTKKIGLEM--DGK 128

Query: 125 GFGL---RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
            F L   RS RY  ++   VV+   VEEG         +++SS E +LK
Sbjct: 129 AFLLGEDRSQRYAMILDSGVVKHLAVEEG-------GKFDVSSAEAILK 170


>gi|149923298|ref|ZP_01911707.1| putative thioredoxin family protein [Plesiocystis pacifica SIR-1]
 gi|149815838|gb|EDM75359.1| putative thioredoxin family protein [Plesiocystis pacifica SIR-1]
          Length = 161

 Score =  110 bits (275), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 80/122 (65%), Gaps = 1/122 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +V++++LFAG+ V LF++PGA+TPTCS   LPGF +  + ++ +G++E+ CLSVND FVM
Sbjct: 24  EVSSEELFAGRSVVLFSVPGAYTPTCSKEHLPGFVENAEAIKAKGVDEIICLSVNDPFVM 83

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AWG +      V++L D    FT+ MG+       G G+R  R+   ++D VVES  +E
Sbjct: 84  QAWGSEHGADGKVRMLADWDAGFTKAMGLDQDIGAAGLGVRGKRFSMRVEDGVVESLDIE 143

Query: 149 EG 150
           EG
Sbjct: 144 EG 145


>gi|121608253|ref|YP_996060.1| redoxin domain-containing protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121552893|gb|ABM57042.1| Redoxin domain protein [Verminephrobacter eiseniae EF01-2]
          Length = 168

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 81/133 (60%), Gaps = 8/133 (6%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE 97
           AGK + LFALPGAFTPTCS   LPG+ +  D+ +  G++E++C+SVNDAFVM AW ++ +
Sbjct: 38  AGKTIALFALPGAFTPTCSARHLPGYLQKADEFKAAGVDEIWCISVNDAFVMGAWAREQK 97

Query: 98  -IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               ++LL DG   FT+  G+ +     G GLRS RY  L++D  V +  VE       A
Sbjct: 98  SAGKLRLLADGDATFTKATGLTLDLSGKGLGLRSNRYSMLVRDGKVVTLNVE-------A 150

Query: 157 TDPYEISSPENVL 169
              +E+S  + +L
Sbjct: 151 PGQFEVSGADRLL 163


>gi|303282249|ref|XP_003060416.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226457887|gb|EEH55185.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 168

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 90/149 (60%), Gaps = 10/149 (6%)

Query: 27  QWKDVNTQDLFA-GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVND 85
           + + V+T +L   GK V LFA+PGAFTPTCS   LPGF K+ D+++  G ++V C+SVND
Sbjct: 22  ELRKVSTAELCGDGKTVVLFAVPGAFTPTCSLKHLPGFIKLADEMKDAGADDVVCVSVND 81

Query: 86  AFVMNAWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVE 143
           AFVM AW K     +  V LL DGS  FTR M   +  +  G G+RS RY  +++D V+ 
Sbjct: 82  AFVMRAWEKSGAFGSGRVLLLADGSCLFTRAMDAELDLNEKGLGVRSRRYAMIVEDGVIA 141

Query: 144 SWFVEEGFSDNCATDPYEISSPENVLKVI 172
              +EEG   N       +S+ E++L ++
Sbjct: 142 HLSMEEGGELN-------VSNAEHILHLL 163


>gi|239831348|ref|ZP_04679677.1| Redoxin domain protein [Ochrobactrum intermedium LMG 3301]
 gi|239823615|gb|EEQ95183.1| Redoxin domain protein [Ochrobactrum intermedium LMG 3301]
          Length = 161

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 89/146 (60%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG      K++ T ++F GK+V LFA+PGAFTPTCS + LPG+ 
Sbjct: 8   KLPAATFKVKTA----DG-----VKEMTTDEVFKGKKVVLFAVPGAFTPTCSLNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDN 123
              D +  +G++++  ++VNDAFVM AW +    +   L L DGS  FT+  G+ +    
Sbjct: 59  DNRDAILAKGVDQIAVVAVNDAFVMGAWAQSTGGEGKILYLADGSATFTKAAGLELDATA 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+++D VV++  +EE
Sbjct: 119 GGLGIRSKRYSAIVEDGVVKALNIEE 144


>gi|220926681|ref|YP_002501983.1| Redoxin domain-containing protein [Methylobacterium nodulans ORS
           2060]
 gi|219951288|gb|ACL61680.1| Redoxin domain protein [Methylobacterium nodulans ORS 2060]
          Length = 160

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 89/166 (53%), Gaps = 15/166 (9%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQ  F +  A    DG  A       T D+F G+RV L A+PGAFTPTC  + LPG+ 
Sbjct: 8   HLPQATFRVMTA----DGPAA-----KTTDDVFKGRRVVLVAVPGAFTPTCHRNHLPGYV 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
               ++   G++ +   SVND FV++AW K    + ++ L DG+G+F + +G+ +     
Sbjct: 59  ARRAEILSRGVDAIAVTSVNDVFVLDAWSKAAGAEGIEFLADGNGDFAKAIGLDMDGAGF 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
           G G+RS RY  L+ D VV +  VE+  S        E+S  E +LK
Sbjct: 119 GLGVRSKRYAMLVDDGVVRALNVEDSPS------KAEVSGAETLLK 158


>gi|154720991|gb|ABS84672.1| AhpC/TSA-family protein [Tetrathiobacter kashmirensis]
          Length = 166

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 91/149 (61%), Gaps = 13/149 (8%)

Query: 22  GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCL 81
           G +AF+       +L  GK++ LFA+PGAFTPTC+   +  F +  + ++ +G++E++C+
Sbjct: 27  GPQAFK-----VSELVKGKKIVLFAVPGAFTPTCTTKHVVDFIRDAEQIKAKGVDEIWCV 81

Query: 82  SVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
           +VNDAFVM AWG+       ++LL DGS  +T +MG+ +     G G+RS RY A+++D 
Sbjct: 82  AVNDAFVMGAWGRDTGATGIIRLLADGSATWTTEMGLELDLVARGLGVRSRRYSAILEDG 141

Query: 141 VVESWFVEEGFSDNCATDPYEISSPENVL 169
           VV+   VEEG         Y+IS  + +L
Sbjct: 142 VVKQLNVEEG-------GEYKISGTQTIL 163


>gi|53802780|ref|YP_112582.1| anti-oxidant AhpCTSA family protein [Methylococcus capsulatus str.
           Bath]
 gi|53756541|gb|AAU90832.1| antioxidant, AhpC/Tsa family [Methylococcus capsulatus str. Bath]
          Length = 168

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 88/142 (61%), Gaps = 8/142 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V+  +   GK++ +F +PGAFTPTCS   LPGF   +D LR +G++E++C++VND FV
Sbjct: 31  RAVDVGEQARGKKLVIFGVPGAFTPTCSVKHLPGFVANHDRLRAKGVDEIWCMAVNDGFV 90

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AWG++ +    V+++ DGS E+ +K+G+       G G+R  R+  ++ D VV+   V
Sbjct: 91  MAAWGREQKAGGKVRMMADGSAEYAKKLGLERDLTANGMGIRCHRFAMIVDDGVVKYLGV 150

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E       A+  +E+S+ E VL
Sbjct: 151 E-------ASGKFEVSNAEAVL 165


>gi|70914307|ref|XP_731797.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 gi|56502037|emb|CAH86350.1| hypothetical protein PC301962.00.0 [Plasmodium chabaudi chabaudi]
          Length = 114

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 74/113 (65%), Gaps = 1/113 (0%)

Query: 28  WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG-IEEVYCLSVNDA 86
           ++ ++T +LF  KR+ L +LPGAFTP C+   +P +EK YD+   E   +++YC++ ND 
Sbjct: 1   FRSIDTHELFKSKRILLISLPGAFTPLCTSKMIPEYEKEYDNFIIENKFDDIYCITNNDI 60

Query: 87  FVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           +V+ +W K + IK +K + DG+  FT  M MLV K N   G+R WRY A++++
Sbjct: 61  YVLKSWFKDMGIKKIKYISDGNSSFTESMNMLVDKSNYFMGMRPWRYVAIVEN 113


>gi|145352465|ref|XP_001420565.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144580800|gb|ABO98858.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 156

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 80/138 (57%), Gaps = 9/138 (6%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           DL  GK   +FA+PGAFTPTCS   LPG+ +  D +R  G++EV C+SVNDAFVMNAWG 
Sbjct: 21  DLLRGKTAVVFAVPGAFTPTCSTKHLPGYVERADAMRERGVDEVICVSVNDAFVMNAWGN 80

Query: 95  KLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
               K   +K++ DGS  +++  G+ +     G G RS RY  + +D V+E   +E G  
Sbjct: 81  SAGAKMAKIKMVADGSAAWSKACGVDLDLHEQGMGTRSRRYALIARDGVIEYLAMESG-- 138

Query: 153 DNCATDPYEISSPENVLK 170
                  YE S   ++L+
Sbjct: 139 -----QKYETSGAADILE 151


>gi|307545802|ref|YP_003898281.1| redoxin domain protein [Halomonas elongata DSM 2581]
 gi|307217826|emb|CBV43096.1| redoxin domain protein [Halomonas elongata DSM 2581]
          Length = 157

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/141 (42%), Positives = 83/141 (58%), Gaps = 9/141 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           +D++T +LFAGKRV LFA+PGAFTP CS+  +PGF    D L  + ++ V C++VNDAFV
Sbjct: 23  EDISTGELFAGKRVVLFAVPGAFTPGCSNTHMPGFVVNADKL-LDKVDVVACMAVNDAFV 81

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           M+AW K    + + +L DG+ EF R +G+ +     G G RS R+  +  D VVE   V+
Sbjct: 82  MDAWQKDQNAERITMLADGNAEFARALGLEMDVSAGGMGTRSKRFALIANDGVVEYLGVD 141

Query: 149 EGFSDNCATDPYEISSPENVL 169
                       E SS E VL
Sbjct: 142 --------AKGVEQSSAETVL 154


>gi|163852015|ref|YP_001640058.1| redoxin domain-containing protein [Methylobacterium extorquens PA1]
 gi|218530769|ref|YP_002421585.1| redoxin [Methylobacterium chloromethanicum CM4]
 gi|240139282|ref|YP_002963757.1| putative peroxiredoxin protein, antioxidant protein, AhpC/TSA
           family protein [Methylobacterium extorquens AM1]
 gi|254561738|ref|YP_003068833.1| peroxiredoxin protein, antioxidant protein, AhpC/TSA family protein
           [Methylobacterium extorquens DM4]
 gi|163663620|gb|ABY30987.1| Redoxin domain protein [Methylobacterium extorquens PA1]
 gi|218523072|gb|ACK83657.1| Redoxin domain protein [Methylobacterium chloromethanicum CM4]
 gi|240009254|gb|ACS40480.1| putative peroxiredoxin protein, antioxidant protein, AhpC/TSA
           family protein [Methylobacterium extorquens AM1]
 gi|254269016|emb|CAX24977.1| putative peroxiredoxin protein, antioxidant protein, AhpC/TSA
           family protein [Methylobacterium extorquens DM4]
          Length = 160

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/165 (37%), Positives = 89/165 (53%), Gaps = 8/165 (4%)

Query: 8   QVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           QV  H+  AT   +G    Q K   T D+F G+RV L  +PGAFTP C  + LPGF    
Sbjct: 4   QVGDHLPQATFRVNGPDGPQAK--TTDDVFKGRRVVLVGVPGAFTPACHRNHLPGFVAKR 61

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFG 127
           +++   GI+ +   SVND FV+NAW ++   + ++ L DG+ EF + +G+ +     G G
Sbjct: 62  EEILARGIDAIAVTSVNDIFVLNAWQQQSGAEGIEFLADGNAEFAKAIGLEMDGSGFGLG 121

Query: 128 LRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            RS RY  L+ D VV    VE+  S        E+S  E +LKV+
Sbjct: 122 PRSQRYAMLVDDGVVRILNVEDTPSK------AEVSGAEALLKVL 160


>gi|89902545|ref|YP_525016.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Rhodoferax ferrireducens T118]
 gi|89347282|gb|ABD71485.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Rhodoferax ferrireducens T118]
          Length = 183

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (57%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+     AGK + LFALPGAFTPTCS   +PG+ + +D L+  G++E++C+SVNDAFVM 
Sbjct: 46  VDVAKASAGKTIALFALPGAFTPTCSAKHVPGYIQHFDALKAAGVDEIWCVSVNDAFVMG 105

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DG   F +  G+ +     G GLRS RY  L+KD  V +  +E 
Sbjct: 106 AWARDQKTNGKVRMLADGDAAFAKATGLTLDLTGKGMGLRSNRYSMLVKDGKVVTLNIE- 164

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A   +E+S    +L
Sbjct: 165 ------APGKFEVSDAATLL 178


>gi|264676452|ref|YP_003276358.1| Redoxin [Comamonas testosteroni CNB-2]
 gi|299531226|ref|ZP_07044637.1| Redoxin [Comamonas testosteroni S44]
 gi|262206964|gb|ACY31062.1| Redoxin [Comamonas testosteroni CNB-2]
 gi|298720809|gb|EFI61755.1| Redoxin [Comamonas testosteroni S44]
          Length = 168

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 77/119 (64%), Gaps = 1/119 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V   +  AGK + +FA+PGAFTPTCS+  LPG+    ++L+  G++E++CL+VNDAFVM 
Sbjct: 31  VKLPEALAGKTIAVFAVPGAFTPTCSEKHLPGYVAKAEELKAAGVDEIWCLAVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWG+  ++   V+++ DG   F +  G+ +  +  G GLR+ R+  L+KD  V +  VE
Sbjct: 91  AWGRDQKVAGKVRMIADGDAAFAKATGLTLDLNGKGLGLRANRFSMLVKDGKVATLNVE 149


>gi|153007937|ref|YP_001369152.1| redoxin domain-containing protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151559825|gb|ABS13323.1| Redoxin domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 161

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 88/146 (60%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG      K++ T ++F GK+V LFA+PGAFTPTCS + LPG+ 
Sbjct: 8   KLPAATFKVKTA----DG-----VKEMTTDEVFKGKKVVLFAVPGAFTPTCSLNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDN 123
              D +  +G++++  ++VNDAFVM AW +    +   L L DGS  FT+  G+ +    
Sbjct: 59  DNRDAILAKGVDQIAVVAVNDAFVMGAWAQSTGGEGKILYLADGSAVFTKAAGLELDATA 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+++D VV +  +EE
Sbjct: 119 GGLGIRSKRYSAIVEDGVVTTLNIEE 144


>gi|114328542|ref|YP_745699.1| peroxiredoxin [Granulibacter bethesdensis CGDNIH1]
 gi|114316716|gb|ABI62776.1| peroxiredoxin [Granulibacter bethesdensis CGDNIH1]
          Length = 160

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/164 (36%), Positives = 92/164 (56%), Gaps = 19/164 (11%)

Query: 13  MRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC 72
           +++    PDG K     +V T  LFA K+V LFA+PGAFTPTCS   LPG+    +  + 
Sbjct: 12  IKIMASTPDGPK-----EVETGTLFADKKVVLFAVPGAFTPTCSAKHLPGYLNALEAFQQ 66

Query: 73  EGIEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSW 131
           +G++ + CLSVND FVM AW K+  + + + +L DGS   TR +G+ +     G G+RS 
Sbjct: 67  KGVDIIACLSVNDPFVMGAWAKEQGVEERILMLADGSAVLTRALGLELDLTARGLGVRSQ 126

Query: 132 RYGALIKDMVVESWFVEEGFSDNCATDP---YEISSPENVLKVI 172
           R+          +  VE+G   + A +P   +++S  E +L V+
Sbjct: 127 RF----------AMVVEKGVVTHLAIEPPGGFDVSRAEQILAVL 160


>gi|121592722|ref|YP_984618.1| redoxin domain-containing protein [Acidovorax sp. JS42]
 gi|120604802|gb|ABM40542.1| Redoxin domain protein [Acidovorax sp. JS42]
          Length = 185

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/140 (40%), Positives = 81/140 (57%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+ Q   AGK + LFA+PGAFTPTCS   +PG+ +    L+  G++E++CLSVNDAFVM 
Sbjct: 48  VDVQKAAAGKTIALFAVPGAFTPTCSAKHVPGYVEQAGALKAAGVDEIWCLSVNDAFVMG 107

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DG   F +  G+ +  +  G GLRS RY  L+KD  V +  VE 
Sbjct: 108 AWARDQKTDGKVRMLADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVKDGKVVALNVE- 166

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A   +E+S    +L
Sbjct: 167 ------APGKFEVSDAATLL 180


>gi|17987739|ref|NP_540373.1| thiol peroxidase [Brucella melitensis bv. 1 str. 16M]
 gi|17983459|gb|AAL52637.1| thiol peroxidase [Brucella melitensis bv. 1 str. 16M]
          Length = 191

 Score =  108 bits (271), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 88/146 (60%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG       ++ T D+F G++V LFA+PGAFTPTCS + LPG+ 
Sbjct: 38  RLPAATFKVKTA----DG-----VTEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYL 88

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D +  +G++++  ++VND FVM AW +    +  +  L DGS  FT+  G+ +    
Sbjct: 89  ENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSG 148

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+++D VV+S  +EE
Sbjct: 149 GGLGVRSKRYSAIVEDGVVKSLNIEE 174


>gi|120609051|ref|YP_968729.1| redoxin domain-containing protein [Acidovorax citrulli AAC00-1]
 gi|326315234|ref|YP_004232906.1| Redoxin domain-containing protein [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|120587515|gb|ABM30955.1| Redoxin domain protein [Acidovorax citrulli AAC00-1]
 gi|323372070|gb|ADX44339.1| Redoxin domain protein [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 168

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 82/144 (56%), Gaps = 8/144 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+     AGK + LFA+PGAFTPTCS   +PG+ +  +  +  G++E++CLSVNDAFVM 
Sbjct: 31  VDVAKASAGKTIALFAVPGAFTPTCSAKHVPGYVEQAEAFKAAGVDEIWCLSVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DG   F +  G+ +  +  G GLRS RY  L+KD  V S  +E 
Sbjct: 91  AWARDQKTDGKVRMLADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVKDGKVASLNIE- 149

Query: 150 GFSDNCATDPYEISSPENVLKVIR 173
                 A   +E+S  + +L   R
Sbjct: 150 ------APGKFEVSDADTLLAQAR 167


>gi|170750312|ref|YP_001756572.1| redoxin domain-containing protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656834|gb|ACB25889.1| Redoxin domain protein [Methylobacterium radiotolerans JCM 2831]
          Length = 159

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 91/168 (54%), Gaps = 15/168 (8%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
            +PQ  F +    + P+G  A       T D+F G+RV L  +PGAFTP+C  + LPGF 
Sbjct: 7   HLPQATFRV----IGPEGPIAR-----TTDDVFKGRRVVLIGVPGAFTPSCHRNHLPGFV 57

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
              D++   GI+ +   SVND FV++AW K    + ++ L DG+ +F + +G+ +     
Sbjct: 58  THRDEILGRGIDAIAVTSVNDVFVLDAWSKASGAEGLEFLADGNADFAKAIGLEMDGTGF 117

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G G+RS RY  L++D VV    VEE  S        E+S  E +LKV+
Sbjct: 118 GLGMRSKRYSMLVEDGVVRILNVEETPSK------AEVSGAEALLKVL 159


>gi|188581870|ref|YP_001925315.1| redoxin [Methylobacterium populi BJ001]
 gi|179345368|gb|ACB80780.1| Redoxin domain protein [Methylobacterium populi BJ001]
          Length = 160

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 90/165 (54%), Gaps = 8/165 (4%)

Query: 8   QVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           QV  H+  AT   +G    Q K   T D+F G+RV L  +PGAFTP C  + LPGF    
Sbjct: 4   QVGDHLPQATFRVNGPDGPQAK--TTDDVFKGRRVVLVGVPGAFTPACHRNHLPGFVAKR 61

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFG 127
           +++   GI+ +   SVND FV+NAW ++   + ++ L DG+ EF + +G+ +     G G
Sbjct: 62  EEILARGIDAIAVTSVNDIFVLNAWQQQSGAEGIEFLADGNAEFAKAIGLEMDGSGFGLG 121

Query: 128 LRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            RS RY  +++D VV    VE+  S        E+S  E +LKV+
Sbjct: 122 PRSQRYAMVVEDGVVRILNVEDTPSK------AEVSGAEALLKVL 160


>gi|237814946|ref|ZP_04593944.1| thiol peroxidase [Brucella abortus str. 2308 A]
 gi|237789783|gb|EEP63993.1| thiol peroxidase [Brucella abortus str. 2308 A]
          Length = 195

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 88/146 (60%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG       ++ T D+F G++V LFA+PGAFTPTCS + LPG+ 
Sbjct: 42  RLPAATFKVKTA----DG-----VTEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYL 92

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D +  +G++++  ++VND FVM AW +    +  +  L DGS  FT+  G+ +    
Sbjct: 93  ENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSG 152

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+++D VV+S  +EE
Sbjct: 153 GGLGVRSKRYSAIVEDGVVKSLNIEE 178


>gi|91786177|ref|YP_547129.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Polaromonas sp. JS666]
 gi|91695402|gb|ABE42231.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Polaromonas sp. JS666]
          Length = 168

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/119 (44%), Positives = 75/119 (63%), Gaps = 1/119 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+   + AGK + LFALPGAFTPTCS   +PG+ +   + +  G++E++C+SVNDAFVM 
Sbjct: 31  VDVAKVTAGKTIALFALPGAFTPTCSAKHVPGYVEKAAEFKAAGVDEIWCVSVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +  +    V++L DGS +F +  G+ +     G GLRS RY  L+KD  V S  VE
Sbjct: 91  AWARDQKTDGKVRMLADGSADFAKATGLTLDLTARGMGLRSNRYSMLVKDGKVMSLNVE 149


>gi|256368931|ref|YP_003106437.1| ahpC/TSA family protein [Brucella microti CCM 4915]
 gi|255999089|gb|ACU47488.1| ahpC/TSA family protein [Brucella microti CCM 4915]
          Length = 161

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 88/146 (60%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG       ++ T D+F G++V LFA+PGAFTPTCS + LPG+ 
Sbjct: 8   RLPAATFKVKTA----DG-----ITEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D +  +G++++  ++VND FVM AW +    +  +  L DGS  FT+  G+ +    
Sbjct: 59  ENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSG 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+++D VV+S  +EE
Sbjct: 119 GGLGVRSKRYSAIVEDGVVKSLNIEE 144


>gi|332528983|ref|ZP_08404949.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Hylemonella gracilis ATCC 19624]
 gi|332041533|gb|EGI77893.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Hylemonella gracilis ATCC 19624]
          Length = 168

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 81/138 (58%), Gaps = 8/138 (5%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
            AGK + LFA+PGAFTPTCS   +PG+ + +   +  G++E++CL+VND FVM AW +  
Sbjct: 37  LAGKTIALFAVPGAFTPTCSAKHVPGYVEHHAAFKAAGVDEIWCLAVNDPFVMGAWARDQ 96

Query: 97  EIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNC 155
           +    V++L DGS EF +  G+ +     G GLRS RY  LIKD  V++  +E       
Sbjct: 97  KTNGKVRMLADGSAEFAKATGLTLDLTARGLGLRSNRYSMLIKDGKVQTLNIE------- 149

Query: 156 ATDPYEISSPENVLKVIR 173
           A   +E+S    +L  ++
Sbjct: 150 APGKFEVSDAATLLAQVK 167


>gi|23501379|ref|NP_697506.1| ahpC/TSA family protein [Brucella suis 1330]
 gi|82699385|ref|YP_413959.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Brucella melitensis biovar Abortus 2308]
 gi|161618449|ref|YP_001592336.1| redoxin domain-containing protein [Brucella canis ATCC 23365]
 gi|163842759|ref|YP_001627163.1| thiol peroxidase [Brucella suis ATCC 23445]
 gi|189023708|ref|YP_001934476.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Brucella abortus S19]
 gi|225626983|ref|ZP_03785022.1| ahpC/TSA family protein [Brucella ceti str. Cudo]
 gi|225852014|ref|YP_002732247.1| redoxin domain-containing protein [Brucella melitensis ATCC 23457]
 gi|254688770|ref|ZP_05152024.1| thiol peroxidase [Brucella abortus bv. 6 str. 870]
 gi|254693254|ref|ZP_05155082.1| thiol peroxidase [Brucella abortus bv. 3 str. Tulya]
 gi|254696900|ref|ZP_05158728.1| thiol peroxidase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701281|ref|ZP_05163109.1| thiol peroxidase [Brucella suis bv. 5 str. 513]
 gi|254703827|ref|ZP_05165655.1| thiol peroxidase [Brucella suis bv. 3 str. 686]
 gi|254707794|ref|ZP_05169622.1| thiol peroxidase [Brucella pinnipedialis M163/99/10]
 gi|254709622|ref|ZP_05171433.1| thiol peroxidase [Brucella pinnipedialis B2/94]
 gi|254712962|ref|ZP_05174773.1| thiol peroxidase [Brucella ceti M644/93/1]
 gi|254716684|ref|ZP_05178495.1| thiol peroxidase [Brucella ceti M13/05/1]
 gi|254729803|ref|ZP_05188381.1| thiol peroxidase [Brucella abortus bv. 4 str. 292]
 gi|256031115|ref|ZP_05444729.1| thiol peroxidase [Brucella pinnipedialis M292/94/1]
 gi|256044192|ref|ZP_05447099.1| thiol peroxidase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256060612|ref|ZP_05450778.1| thiol peroxidase [Brucella neotomae 5K33]
 gi|256159188|ref|ZP_05457001.1| thiol peroxidase [Brucella ceti M490/95/1]
 gi|256254518|ref|ZP_05460054.1| thiol peroxidase [Brucella ceti B1/94]
 gi|256257017|ref|ZP_05462553.1| thiol peroxidase [Brucella abortus bv. 9 str. C68]
 gi|256264481|ref|ZP_05467013.1| alkyl hydroperoxide reductase [Brucella melitensis bv. 2 str. 63/9]
 gi|260168246|ref|ZP_05755057.1| thiol peroxidase [Brucella sp. F5/99]
 gi|260545788|ref|ZP_05821529.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal
           allergen [Brucella abortus NCTC 8038]
 gi|260563551|ref|ZP_05834037.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal
           allergen [Brucella melitensis bv. 1 str. 16M]
 gi|260566919|ref|ZP_05837389.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal
           allergen [Brucella suis bv. 4 str. 40]
 gi|260754256|ref|ZP_05866604.1| redoxin domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260757476|ref|ZP_05869824.1| redoxin domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260761301|ref|ZP_05873644.1| redoxin domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883281|ref|ZP_05894895.1| redoxin domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261213503|ref|ZP_05927784.1| redoxin domain-containing protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|261218489|ref|ZP_05932770.1| redoxin domain-containing protein [Brucella ceti M13/05/1]
 gi|261221695|ref|ZP_05935976.1| redoxin domain-containing protein [Brucella ceti B1/94]
 gi|261315280|ref|ZP_05954477.1| redoxin domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261317154|ref|ZP_05956351.1| redoxin domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261320661|ref|ZP_05959858.1| redoxin domain-containing protein [Brucella ceti M644/93/1]
 gi|261324608|ref|ZP_05963805.1| redoxin domain-containing protein [Brucella neotomae 5K33]
 gi|261751822|ref|ZP_05995531.1| redoxin domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261754478|ref|ZP_05998187.1| redoxin domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|261757709|ref|ZP_06001418.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal
           allergen [Brucella sp. F5/99]
 gi|265988192|ref|ZP_06100749.1| redoxin domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|265990607|ref|ZP_06103164.1| redoxin domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265997657|ref|ZP_06110214.1| redoxin domain-containing protein [Brucella ceti M490/95/1]
 gi|294851854|ref|ZP_06792527.1| peroxiredoxin [Brucella sp. NVSL 07-0026]
 gi|297247872|ref|ZP_06931590.1| peroxiredoxin [Brucella abortus bv. 5 str. B3196]
 gi|23347274|gb|AAN29421.1| ahpC/TSA family protein [Brucella suis 1330]
 gi|82615486|emb|CAJ10460.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Brucella melitensis biovar Abortus 2308]
 gi|161335260|gb|ABX61565.1| Redoxin domain protein [Brucella canis ATCC 23365]
 gi|163673482|gb|ABY37593.1| thiol peroxidase [Brucella suis ATCC 23445]
 gi|189019280|gb|ACD72002.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Brucella abortus S19]
 gi|225618640|gb|EEH15683.1| ahpC/TSA family protein [Brucella ceti str. Cudo]
 gi|225640379|gb|ACO00293.1| Redoxin domain protein [Brucella melitensis ATCC 23457]
 gi|260097195|gb|EEW81070.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal
           allergen [Brucella abortus NCTC 8038]
 gi|260153567|gb|EEW88659.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal
           allergen [Brucella melitensis bv. 1 str. 16M]
 gi|260156437|gb|EEW91517.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal
           allergen [Brucella suis bv. 4 str. 40]
 gi|260667794|gb|EEX54734.1| redoxin domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260671733|gb|EEX58554.1| redoxin domain-containing protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674364|gb|EEX61185.1| redoxin domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260872809|gb|EEX79878.1| redoxin domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|260915110|gb|EEX81971.1| redoxin domain-containing protein [Brucella abortus bv. 3 str.
           Tulya]
 gi|260920279|gb|EEX86932.1| redoxin domain-containing protein [Brucella ceti B1/94]
 gi|260923578|gb|EEX90146.1| redoxin domain-containing protein [Brucella ceti M13/05/1]
 gi|261293351|gb|EEX96847.1| redoxin domain-containing protein [Brucella ceti M644/93/1]
 gi|261296377|gb|EEX99873.1| redoxin domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261300588|gb|EEY04085.1| redoxin domain-containing protein [Brucella neotomae 5K33]
 gi|261304306|gb|EEY07803.1| redoxin domain-containing protein [Brucella pinnipedialis
           M163/99/10]
 gi|261737693|gb|EEY25689.1| alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal
           allergen [Brucella sp. F5/99]
 gi|261741575|gb|EEY29501.1| redoxin domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261744231|gb|EEY32157.1| redoxin domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|262552125|gb|EEZ08115.1| redoxin domain-containing protein [Brucella ceti M490/95/1]
 gi|263001391|gb|EEZ13966.1| redoxin domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094812|gb|EEZ18550.1| alkyl hydroperoxide reductase [Brucella melitensis bv. 2 str. 63/9]
 gi|264660389|gb|EEZ30650.1| redoxin domain-containing protein [Brucella pinnipedialis
           M292/94/1]
 gi|294820443|gb|EFG37442.1| peroxiredoxin [Brucella sp. NVSL 07-0026]
 gi|297175041|gb|EFH34388.1| peroxiredoxin [Brucella abortus bv. 5 str. B3196]
 gi|326408508|gb|ADZ65573.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Brucella melitensis M28]
 gi|326538225|gb|ADZ86440.1| redoxin domain protein [Brucella melitensis M5-90]
          Length = 161

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 88/146 (60%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG       ++ T D+F G++V LFA+PGAFTPTCS + LPG+ 
Sbjct: 8   RLPAATFKVKTA----DG-----VTEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D +  +G++++  ++VND FVM AW +    +  +  L DGS  FT+  G+ +    
Sbjct: 59  ENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSG 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+++D VV+S  +EE
Sbjct: 119 GGLGVRSKRYSAIVEDGVVKSLNIEE 144


>gi|114706563|ref|ZP_01439464.1| THIOL PEROXIDASE [Fulvimarina pelagi HTCC2506]
 gi|114537955|gb|EAU41078.1| THIOL PEROXIDASE [Fulvimarina pelagi HTCC2506]
          Length = 178

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 81/145 (55%), Gaps = 10/145 (6%)

Query: 6   IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
           +P   F  + A    DG       D++T D+F GK V LF +PGAFTPTCS + LPGF  
Sbjct: 26  LPNASFRTKTA----DG-----MNDLSTDDIFKGKTVVLFGVPGAFTPTCSMNHLPGFLD 76

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNV 124
              ++R +G++E+  +S+ND FVM  W +  E    +  L DG+GEF R  G+       
Sbjct: 77  ENAEIRAKGVDEIAVVSMNDPFVMAVWEEAKEASGKILFLSDGNGEFIRAAGLDADLSAA 136

Query: 125 GFGLRSWRYGALIKDMVVESWFVEE 149
           G G RS R+  ++KD VV S  +E+
Sbjct: 137 GMGTRSKRFSMIVKDGVVSSLAIED 161


>gi|296536724|ref|ZP_06898784.1| peroxiredoxin [Roseomonas cervicalis ATCC 49957]
 gi|296262955|gb|EFH09520.1| peroxiredoxin [Roseomonas cervicalis ATCC 49957]
          Length = 171

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 8/145 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           ++++T+ LF    V LF +PGAFTPTCS   +PGF +  D L+ +G+++V C++VNDAFV
Sbjct: 34  RELSTEALFGSGTVVLFGVPGAFTPTCSARHMPGFLQGLDALKAKGVDKVACMAVNDAFV 93

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AW K    +  V ++ DGS  FT+ +G+       G GLR  R+  + KD  V    V
Sbjct: 94  MQAWAKDQGAEGKVTMIADGSAAFTKALGLEFDLTARGLGLRCQRFVLVAKDGKVAHVAV 153

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           E       A   +E+SS E VL  +
Sbjct: 154 E-------APGAFEVSSAEAVLAAL 171


>gi|262404022|ref|ZP_06080577.1| antioxidant putative [Vibrio sp. RC586]
 gi|262349054|gb|EEY98192.1| antioxidant putative [Vibrio sp. RC586]
          Length = 157

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 82/138 (59%), Gaps = 8/138 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +   LFA K+V LFA+PGAFTPTCS+  LPG+  + D  + +G++ + C+SVNDAFVM A
Sbjct: 25  SVHTLFANKKVVLFAVPGAFTPTCSEAHLPGYVVLADKFKEKGVDLIACVSVNDAFVMKA 84

Query: 92  WGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           WG+      + +L DG   FT+ +G+ +   + G G+RS RY  +I++ +V    VE   
Sbjct: 85  WGENQNASEILMLADGDASFTQALGLEMNTGSFG-GIRSQRYAMVIENNMVTLLNVEP-- 141

Query: 152 SDNCATDPYEISSPENVL 169
                   +E+S  E +L
Sbjct: 142 -----PKTFELSKAETIL 154


>gi|306845106|ref|ZP_07477686.1| thiol peroxidase [Brucella sp. BO1]
 gi|306274521|gb|EFM56316.1| thiol peroxidase [Brucella sp. BO1]
          Length = 161

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 88/146 (60%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG       ++ T D+F G++V LFA+PGAFTPTCS + LPG+ 
Sbjct: 8   RLPAATFKVKTA----DG-----VTEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D +  +G++++  ++VND FVM AW +    +  +  L DGS  FT+  G+ +    
Sbjct: 59  ENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSG 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+I+D VV++  +EE
Sbjct: 119 GGLGVRSKRYSAIIEDGVVKALNIEE 144


>gi|301630264|ref|XP_002944242.1| PREDICTED: peroxiredoxin-2D-like [Xenopus (Silurana) tropicalis]
          Length = 168

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 79/140 (56%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+ Q   AGK + LFA+PGAFTPTCS   LPG+    +  +  G++E++CL+VNDAFVM 
Sbjct: 31  VDVQKATAGKTIALFAVPGAFTPTCSAQHLPGYVAQAEAFKAAGVDEIWCLAVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DG   F +  G+ +     G GLRS RY  L+KD  V +  VE 
Sbjct: 91  AWARDQKTAGKVRMLADGDAVFAKATGLTLDLHGKGLGLRSKRYSMLVKDGKVVALNVE- 149

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A   +E+S    +L
Sbjct: 150 ------APGKFEVSDAATLL 163


>gi|121603130|ref|YP_980459.1| redoxin domain-containing protein [Polaromonas naphthalenivorans
           CJ2]
 gi|120592099|gb|ABM35538.1| Redoxin domain protein [Polaromonas naphthalenivorans CJ2]
          Length = 168

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 74/119 (62%), Gaps = 1/119 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+     AGK + LFA+PGAFTPTCS   +PG+   + + +  G++E++CLSVNDAFVM 
Sbjct: 31  VDVAQASAGKTIALFAVPGAFTPTCSAKHVPGYVAKFAEFKAAGVDEIWCLSVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +  + +  V++L DG   F +  G+ +  +  G GLRS RY  L+KD  V S  +E
Sbjct: 91  AWARDQKTEGKVRMLADGDAAFAQATGLTLDLNGKGLGLRSNRYSMLVKDGKVASLNIE 149


>gi|260222799|emb|CBA32719.1| Peroxiredoxin-2E-1, chloroplastic [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 168

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+     AGK + LFALPGAFTPTCS   +PG+ +  +  +  G++E++C+SVNDAFVM 
Sbjct: 31  VDVAKATAGKTIALFALPGAFTPTCSAKHVPGYVESAEAFKAAGVDEIWCVSVNDAFVMG 90

Query: 91  AWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  +    V++L DG   FT+  G+ +     G GLRS RY  L+KD  V +  VE 
Sbjct: 91  AWARDQKTGTKVRMLGDGDATFTKATGLTLDLTGKGLGLRSNRYSMLVKDGKVATLNVE- 149

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A   +E+S    +L
Sbjct: 150 ------AAGKFEVSDAGTLL 163


>gi|194366792|ref|YP_002029402.1| Redoxin domain-containing protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194349596|gb|ACF52719.1| Redoxin domain protein [Stenotrophomonas maltophilia R551-3]
          Length = 160

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 87/143 (60%), Gaps = 9/143 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + ++T  LF  ++V LFA+PGAFTPTCS   LPG+ + ++  R  GI +VYC++VND FV
Sbjct: 22  ETLDTHSLFDARKVVLFAVPGAFTPTCSARHLPGYVEKFEAFRQRGI-DVYCVAVNDPFV 80

Query: 89  MNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AW  + ++   + +L DG+ E TR +G+ +     G G+RS R+   + D VV + ++
Sbjct: 81  MKAWAAEQDVPAGLMMLSDGNAELTRALGLELDASASGMGIRSRRFALYVVDGVVRAAWI 140

Query: 148 EEGFSDNCATDPYEISSPENVLK 170
           E+          +E+SS E VL+
Sbjct: 141 EQ-------PGQFEVSSAEYVLE 156


>gi|328545008|ref|YP_004305117.1| Peroxiredoxin-like protein [polymorphum gilvum SL003B-26A1]
 gi|326414750|gb|ADZ71813.1| Peroxiredoxin-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 161

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 83/142 (58%), Gaps = 5/142 (3%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           ++V   LPDG       D    + + DLFAGK V LF +PGAFTPTC  + LPGF + +D
Sbjct: 3   IKVGDRLPDGVFKTITADGPVELKSGDLFAGKTVVLFGVPGAFTPTCHMNHLPGFLEHHD 62

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFG 127
             + +G++ +  +SVND FVM+AW K     + +  L DGS +F + MG+ +     G G
Sbjct: 63  TFKAKGVDTIAVVSVNDMFVMDAWKKATNAGDKILFLADGSADFVKAMGLDLDASGFGMG 122

Query: 128 LRSWRYGALIKDMVVESWFVEE 149
           +RS R+  L+KD  V +  +E+
Sbjct: 123 VRSKRFAMLVKDGTVVALNIED 144


>gi|62289459|ref|YP_221252.1| ahpC/TSA family protein [Brucella abortus bv. 1 str. 9-941]
 gi|62195591|gb|AAX73891.1| ahpC/TSA family protein [Brucella abortus bv. 1 str. 9-941]
          Length = 161

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 87/146 (59%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG       ++ T D+F G++V LFA+PGAFTPTCS + LPG+ 
Sbjct: 8   RLPAATFKVKTA----DG-----VTEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D +  +G++++  ++VND FVM AW +    +  +  L DGS  FT+  G+ +    
Sbjct: 59  ENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSG 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+++D VV+S   EE
Sbjct: 119 GGLGVRSKRYSAIVEDGVVKSLNTEE 144


>gi|56461578|ref|YP_156859.1| AhpC/TSA family peroxiredoxin [Idiomarina loihiensis L2TR]
 gi|56180588|gb|AAV83310.1| Peroxiredoxin, AhpC/Tsa family [Idiomarina loihiensis L2TR]
          Length = 163

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 92/147 (62%), Gaps = 9/147 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           ++ +  ++FA     LF++PGAFTPTCS+  LPG+ +  + L+  G+  + C++VNDAFV
Sbjct: 25  QNYDPAEIFAKGTHVLFSVPGAFTPTCSEKHLPGYVEHAEALKEAGVLSINCVAVNDAFV 84

Query: 89  MNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AWG+ L I + V+LL DG+G + + MG+ +   N G G+RS RY  +I D  V+  FV
Sbjct: 85  MKAWGESLGIGEKVRLLSDGNGAYNQIMGLSMDTGNFG-GIRSKRYAMIITDGQVKGLFV 143

Query: 148 EEGFSDNCATDPYEISSPENVLKVIRE 174
           EE  S       +E+S  E +L+ +++
Sbjct: 144 EEDKS-------FEVSKAEYILEQLQK 163


>gi|256113007|ref|ZP_05453904.1| thiol peroxidase [Brucella melitensis bv. 3 str. Ether]
 gi|265994439|ref|ZP_06106996.1| redoxin domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|262765552|gb|EEZ11341.1| redoxin domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
          Length = 161

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 87/146 (59%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG        + T D+F G++V LFA+PGAFTPTCS + LPG+ 
Sbjct: 8   RLPAATFKVKTA----DG-----VTKMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D +  +G++++  ++VND FVM AW +    +  +  L DGS  FT+  G+ +    
Sbjct: 59  ENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSG 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+++D VV+S  +EE
Sbjct: 119 GGLGVRSKRYSAIVEDGVVKSLNIEE 144


>gi|302782199|ref|XP_002972873.1| hypothetical protein SELMODRAFT_148621 [Selaginella moellendorffii]
 gi|300159474|gb|EFJ26094.1| hypothetical protein SELMODRAFT_148621 [Selaginella moellendorffii]
          Length = 163

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 97/164 (59%), Gaps = 13/164 (7%)

Query: 15  VATVLPDGSKAFQWKDVNTQD-----LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           V  ++PDG+ ++  KD   Q+     L   K+V LF +PGAFTPTCS   +PG+ +   +
Sbjct: 6   VEEIIPDGTLSYFDKDGKLQNVSIYALAEKKKVVLFGVPGAFTPTCSLKHVPGYIEKAPE 65

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
           L+ +G++++ CL+VND FV+  W K   E   V  L DGS  +T+ +G+ +     G G+
Sbjct: 66  LKAKGVDKILCLTVNDPFVVREWAKTYPEDSAVMFLADGSATYTKSLGLELDLTERGMGI 125

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           RS R+  L+ D+VV++  +EEG         +++SS +++L V+
Sbjct: 126 RSKRFALLLDDLVVKAANIEEGGD-------FKVSSADDILAVL 162


>gi|125581128|gb|EAZ22059.1| hypothetical protein OsJ_05717 [Oryza sativa Japonica Group]
          Length = 225

 Score =  107 bits (267), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 67/174 (38%), Positives = 93/174 (53%), Gaps = 17/174 (9%)

Query: 9   VVFHMRVATVLPDGSKAF------QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG 62
           VV  + V   LPD + ++      + K V   +L AG++  LFA+PGAFTPTCS   LPG
Sbjct: 59  VVATIAVGDKLPDATLSYFDPADGELKTVTVAELTAGRKAVLFAVPGAFTPTCSQKHLPG 118

Query: 63  FEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI--KNVKLLPDGSGEFTRKMG--ML 118
             +       +G     C+SVNDAFVM AW + L +   +V LL DG+ E TR +G  M 
Sbjct: 119 VHREGRGASSQGGGRHCCVSVNDAFVMRAWKESLGLGDADVLLLSDGNLELTRALGVEMD 178

Query: 119 VYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           +    +G G+RS RY  L  D VV+   +EEG +       +  SS E +LK +
Sbjct: 179 LSDKPMGLGVRSRRYALLADDGVVKVLNLEEGGA-------FTTSSAEEMLKAL 225


>gi|254718652|ref|ZP_05180463.1| thiol peroxidase [Brucella sp. 83/13]
 gi|265983633|ref|ZP_06096368.1| redoxin domain-containing protein [Brucella sp. 83/13]
 gi|306837799|ref|ZP_07470663.1| thiol peroxidase [Brucella sp. NF 2653]
 gi|306842238|ref|ZP_07474901.1| thiol peroxidase [Brucella sp. BO2]
 gi|264662225|gb|EEZ32486.1| redoxin domain-containing protein [Brucella sp. 83/13]
 gi|306287618|gb|EFM59065.1| thiol peroxidase [Brucella sp. BO2]
 gi|306407140|gb|EFM63355.1| thiol peroxidase [Brucella sp. NF 2653]
          Length = 161

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 88/146 (60%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P   F ++ A    DG       ++ T D+F G++V LFA+PGAFTPTCS + LPG+ 
Sbjct: 8   RLPAATFKVKTA----DG-----VTEMTTDDVFKGRKVVLFAVPGAFTPTCSLNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  D +  +G++++  ++VND FVM AW +    +  +  L DGS  FT+  G+ +    
Sbjct: 59  ENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLDIDLSG 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G+RS RY A+++D VV++  +EE
Sbjct: 119 GGLGVRSKRYSAIVEDGVVKALNIEE 144


>gi|229366436|gb|ACQ58198.1| Peroxiredoxin-5, mitochondrial precursor [Anoplopoma fimbria]
          Length = 190

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 81/131 (61%), Gaps = 5/131 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V    LF GK+  LFA+PGAFTP CS   LPGF +   DL+ +G++EV C+SVNDAFVM 
Sbjct: 51  VAMDKLFEGKKGVLFAVPGAFTPGCSKTHLPGFVQQAADLKSKGLQEVACISVNDAFVMA 110

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGL---RSWRYGALIKDMVVESWF 146
           AWGK+      V++L D +G FT+ + +L+  D +   L   RS RY  L++D VV+   
Sbjct: 111 AWGKEHGTDGKVRMLADPTGAFTKAVDLLLDSDQIVQALGNKRSKRYAMLVEDGVVKKIN 170

Query: 147 VE-EGFSDNCA 156
           VE +G    C+
Sbjct: 171 VEPDGTGLTCS 181


>gi|239789275|dbj|BAH71271.1| ACYPI009090 [Acyrthosiphon pisum]
          Length = 156

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 74/119 (62%), Gaps = 2/119 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +L +GK V LFA+PGAFTP CS   LPG+    DDL+ +G++E+ C+SVNDAFVM 
Sbjct: 23  VNISELCSGKTVILFAVPGAFTPGCSKTHLPGYVNTADDLKSKGVDEIVCVSVNDAFVMA 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +  + +  V+LL D + E T    + +    +G G RS RY  LIKD  VE   VE
Sbjct: 83  AWAQDQKAEGKVRLLADPNAELTNAFDLAINLPPLG-GTRSKRYSMLIKDGKVEQLNVE 140


>gi|193700161|ref|XP_001948371.1| PREDICTED: peroxiredoxin-5, mitochondrial-like isoform 1
           [Acyrthosiphon pisum]
          Length = 156

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 74/119 (62%), Gaps = 2/119 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +L +GK V LFA+PGAFTP CS   LPG+    DDL+ +G++E+ C+SVNDAFVM 
Sbjct: 23  VNISELCSGKTVILFAVPGAFTPGCSKTHLPGYVNTADDLKSKGVDEIVCVSVNDAFVMA 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +  + +  V+LL D + E T    + +    +G G RS RY  LIKD  VE   VE
Sbjct: 83  AWAQDQKAEGKVRLLADPNAELTNAFDLAINLPPLG-GTRSKRYSMLIKDGKVEQLNVE 140


>gi|254524080|ref|ZP_05136135.1| peroxiredoxin-2E-1 [Stenotrophomonas sp. SKA14]
 gi|219721671|gb|EED40196.1| peroxiredoxin-2E-1 [Stenotrophomonas sp. SKA14]
          Length = 160

 Score =  107 bits (266), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 86/143 (60%), Gaps = 9/143 (6%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + ++T  LF  ++V LFA+PGAFTPTCS   LPG+ + ++  R  GI +VYC++VND FV
Sbjct: 22  ETLDTHSLFDARKVVLFAVPGAFTPTCSARHLPGYVEKFEAFRQRGI-DVYCMAVNDPFV 80

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AW     + + + +L DG+ E TR +G+ +     G G+RS R+   + D VV + ++
Sbjct: 81  MKAWAADQSVPDGLLMLSDGNAELTRALGLELDASASGMGIRSRRFALYVVDGVVRAAWI 140

Query: 148 EEGFSDNCATDPYEISSPENVLK 170
           E+          +E+SS E VL+
Sbjct: 141 EQ-------PGQFEVSSAEYVLE 156


>gi|302812753|ref|XP_002988063.1| hypothetical protein SELMODRAFT_159225 [Selaginella moellendorffii]
 gi|300144169|gb|EFJ10855.1| hypothetical protein SELMODRAFT_159225 [Selaginella moellendorffii]
          Length = 163

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 96/164 (58%), Gaps = 13/164 (7%)

Query: 15  VATVLPDGSKAFQWKDVNTQD-----LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           V  ++PDG+ ++  KD   Q+     L   K+V LF +PGAFTPTCS   +PG+     +
Sbjct: 6   VEEIIPDGTLSYFDKDGKLQNVSIYALAEKKKVVLFGVPGAFTPTCSLKHVPGYIDKAPE 65

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
           L+ +G++++ CL+VND FV+  W K   E   V  L DGS  +T+ +G+ +     G G+
Sbjct: 66  LKAKGVDKILCLTVNDPFVVREWAKTYPEDSAVMFLADGSATYTKSLGLELDLTERGMGI 125

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           RS R+  L+ D+VV++  +EEG         +++SS +++L V+
Sbjct: 126 RSKRFALLLDDLVVKAANIEEGGD-------FKVSSADDILAVL 162


>gi|190575461|ref|YP_001973306.1| putative redoxin [Stenotrophomonas maltophilia K279a]
 gi|190013383|emb|CAQ47017.1| putative redoxin [Stenotrophomonas maltophilia K279a]
          Length = 160

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 85/144 (59%), Gaps = 11/144 (7%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + ++T  LF  ++V LFA+PGAFTPTCS   LPG+ + ++  R  GI  VYC++VND FV
Sbjct: 22  ETLDTHSLFDARKVVLFAVPGAFTPTCSARHLPGYVEKFEAFRQRGI-NVYCMAVNDPFV 80

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVV-ESWF 146
           M AW     + + + +L DG+ E TR +G+ +     G G+RS R+   + D VV E+W 
Sbjct: 81  MKAWAADQSVPDGLLMLSDGNAELTRALGLELDASASGMGIRSRRFALYVDDGVVREAWV 140

Query: 147 VEEGFSDNCATDPYEISSPENVLK 170
            + G         +E+SS E VL+
Sbjct: 141 EQPG--------QFEVSSAEYVLE 156


>gi|158302218|ref|XP_001238545.2| AGAP001325-PA [Anopheles gambiae str. PEST]
 gi|157012845|gb|EAU75715.2| AGAP001325-PA [Anopheles gambiae str. PEST]
          Length = 194

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 81/128 (63%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  DL AGK+V LFA+PGAFTP CS   LPG+ +   DL+  G  E+ C+SVND FVM+
Sbjct: 61  VNMADLCAGKKVILFAVPGAFTPGCSKTHLPGYVEKAGDLKSSGATEIVCVSVNDPFVMS 120

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK+      V++L D +  FT+ + +      +G GLRS RY  +++D VV+S  VE 
Sbjct: 121 AWGKQHNATGKVRMLADPAAAFTKALELGADLPPLG-GLRSKRYSMVLEDGVVKSLNVEP 179

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 180 DGTGLSCS 187


>gi|168016047|ref|XP_001760561.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162688258|gb|EDQ74636.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 163

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 97/166 (58%), Gaps = 13/166 (7%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V   +PD + ++     Q + ++T     GK+V L A+PGAFTPTCS   +PGF    
Sbjct: 4   IAVGDTIPDVTLSYLDDDNQSQKLSTHQDLKGKKVMLVAVPGAFTPTCSQEHVPGFIDNA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKLE-IKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            +++ +G+ ++  +SVND FVM AW +  +  +++K + DGS EFT+ +G+ +   + G 
Sbjct: 64  KEIKSKGVSDIIVVSVNDPFVMKAWERSYDGAEHLKFVADGSLEFTKALGLELDLTDKGL 123

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  L+ D+VV+   +EEG +       + +S  E +LK +
Sbjct: 124 GVRSRRFCLLVDDLVVKVANIEEGGA-------FTVSGAEEILKAL 162


>gi|157115218|ref|XP_001658149.1| peroxiredoxin 5, prdx5 [Aedes aegypti]
 gi|108876980|gb|EAT41205.1| peroxiredoxin 5, prdx5 [Aedes aegypti]
          Length = 193

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 83/128 (64%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  DL AGK+V LFA+PGAFTP CS   LPG+    D ++  G++E+ C+SVND FVM+
Sbjct: 60  VNMADLCAGKKVVLFAVPGAFTPGCSKTHLPGYVDRADAIKSSGVQEIVCVSVNDPFVMS 119

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK+      V++L D +  FT+++ +      +G GLRS RY  +++D V++S  VE 
Sbjct: 120 AWGKQHNTGGKVRMLADPAAIFTKQLELGADLPPLG-GLRSKRYSMVLEDGVIKSLNVEP 178

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 179 DGTGLSCS 186


>gi|312373818|gb|EFR21501.1| hypothetical protein AND_16974 [Anopheles darlingi]
          Length = 172

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 81/128 (63%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  DL AGK+V LFA+PGAFTP CS   LPG+ +   DL+  G  E+ C+SVND FVM+
Sbjct: 39  VNIADLCAGKKVILFAVPGAFTPGCSKTHLPGYVEKATDLKSSGATEIVCVSVNDPFVMS 98

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK+      V++L D +  FT+ + +      +G GLRS RY  +++D VV+S  VE 
Sbjct: 99  AWGKQHNATGKVRMLADPAAVFTKALDLGADLPPLG-GLRSKRYSMVVEDGVVKSLNVEP 157

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 158 DGTGLSCS 165


>gi|55233150|gb|AAV48533.1| peroxiredoxin-like protein [Aedes aegypti]
          Length = 157

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 83/128 (64%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  DL AGK+V LFA+PGAFTP CS   LPG+    D ++  G++E+ C+SVND FVM+
Sbjct: 24  VNMADLCAGKKVVLFAVPGAFTPGCSKTHLPGYVDRADAIKSSGVQEIVCVSVNDPFVMS 83

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK+      V++L D +  FT+++ +      +G GLRS RY  +++D V++S  VE 
Sbjct: 84  AWGKQHNTGGKVRMLADPAAIFTKQLELGADLPPLG-GLRSKRYSMVLEDGVIKSLNVEP 142

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 143 DGTGLSCS 150


>gi|157361539|gb|ABV44727.1| peroxiredoxin-like protein [Phlebotomus papatasi]
          Length = 182

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 82/128 (64%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VNT DL   K+V LFA+PGAFTP CS   LPG+ +  ++L+ +G+ E+ C+SVND FVM+
Sbjct: 48  VNTGDLCRNKKVILFAVPGAFTPGCSKTHLPGYVEKAEELKAQGVSEIVCVSVNDPFVMS 107

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK       V++L D +G FT+ + + V    +G G RS RY  +++D VV+S  VE 
Sbjct: 108 AWGKDQSAGGKVRMLADPNGAFTKAVDLGVDLPPLG-GFRSKRYSMVVEDGVVKSLNVEP 166

Query: 149 EGFSDNCA 156
           +G    C+
Sbjct: 167 DGTGLTCS 174


>gi|217977441|ref|YP_002361588.1| Redoxin domain protein [Methylocella silvestris BL2]
 gi|217502817|gb|ACK50226.1| Redoxin domain protein [Methylocella silvestris BL2]
          Length = 161

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 82/145 (56%), Gaps = 5/145 (3%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           ++V   LP+ S A    +     +T D+F G+RV L  +PGAFTPTCS+  LPGF    D
Sbjct: 3   IKVGDRLPNASFAVMTPEGPAVRSTDDIFKGRRVVLIGVPGAFTPTCSNVHLPGFVNRLD 62

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFG 127
           D + + I+ +   +VND FVMNAW    +   ++  L DG+G+F + +G+ +     G G
Sbjct: 63  DFKQKRIDAIAVTAVNDVFVMNAWAASSDAGAHMSFLADGNGDFAKALGLTLDLTERGLG 122

Query: 128 LRSWRYGALIKDMVVESWFVEEGFS 152
           +RS RY  ++ D VV+   VE   S
Sbjct: 123 VRSQRYSMVVDDGVVQQLNVEASAS 147


>gi|170044203|ref|XP_001849745.1| peroxiredoxin 5, prdx5 [Culex quinquefasciatus]
 gi|167867442|gb|EDS30825.1| peroxiredoxin 5, prdx5 [Culex quinquefasciatus]
          Length = 163

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 82/128 (64%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  DL AGK+V LFA+PGAFTP CS   LPG+     DL+  G+ EV C+SVND FVM+
Sbjct: 30  VNIADLCAGKKVILFAVPGAFTPGCSKTHLPGYVDKAGDLKSAGVAEVVCVSVNDPFVMS 89

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK+      V++L D +  FT+++ +      +G GLRS RY  +++D V+++  VE 
Sbjct: 90  AWGKQHNAGGKVRMLADPAAVFTKQLELGADLPPLG-GLRSKRYSMVLEDGVIKTLNVEP 148

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 149 DGTGLSCS 156


>gi|78046726|ref|YP_362901.1| putative peroxiredoxin [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|78035156|emb|CAJ22801.1| putative peroxiredoxin [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 125

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 68/108 (62%), Gaps = 2/108 (1%)

Query: 43  FLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-V 101
            LFA+PGAFTPTCS   LPG+ + ++  R  GIE V C +VND FVM AWG+   I + +
Sbjct: 1   MLFAVPGAFTPTCSAKHLPGYVEHFEQFRKRGIE-VLCTAVNDPFVMQAWGRSQLIPDGL 59

Query: 102 KLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
            LLPDG+ E  R +G+ +     G GLRS RY     D VV++ FVEE
Sbjct: 60  HLLPDGNAELARALGLEIDASGSGMGLRSRRYALYADDAVVKALFVEE 107


>gi|195996419|ref|XP_002108078.1| hypothetical protein TRIADDRAFT_18263 [Trichoplax adhaerens]
 gi|190588854|gb|EDV28876.1| hypothetical protein TRIADDRAFT_18263 [Trichoplax adhaerens]
          Length = 180

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 93/160 (58%), Gaps = 8/160 (5%)

Query: 3   RFQIPQVVFHMRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDH 58
           RF     +  ++V   LP  S A         V+ + LFA K+  LFA+PGAFTP CS  
Sbjct: 13  RFSSTSRLLQIQVGDKLP--SIALHQNSPGNKVDIRQLFANKKGILFAVPGAFTPGCSKT 70

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGM 117
            LPG+ + YD+ + +GI+ + C+SVNDAFV++AW K   + + +++L D S +FT+ +G+
Sbjct: 71  HLPGYLQHYDNFKSKGIDVIACVSVNDAFVVDAWSKSNNVDDRLEMLADTSAQFTKSVGL 130

Query: 118 LVYKDNVGFGLRSWRYGALIKDMVVESWFVE-EGFSDNCA 156
                 V   +RS RY  +I+D VV+   VE +G   +C+
Sbjct: 131 DFDATPVLGNIRSKRYAMIIEDTVVKQINVEPDGTGLSCS 170


>gi|209730614|gb|ACI66176.1| Peroxiredoxin-5, mitochondrial precursor [Salmo salar]
          Length = 190

 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 83/131 (63%), Gaps = 5/131 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+   LF GK+  LFA+PGAFTP CS   LPGF +   +L+ +G++EV C+SVNDAFVM 
Sbjct: 50  VSMDQLFKGKKGVLFAVPGAFTPGCSKTHLPGFVEQAAELKSKGVQEVACISVNDAFVMA 109

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGL---RSWRYGALIKDMVVESWF 146
           AWGK+      V++L D +G FT+ + +L+  D +   L   RS RY  L++D VV++  
Sbjct: 110 AWGKEHGAGGKVRMLADPTGAFTKAVDLLLDNDQIVAVLGNKRSQRYAMLVEDGVVKNIN 169

Query: 147 VE-EGFSDNCA 156
           VE +G    C+
Sbjct: 170 VEPDGTGLTCS 180


>gi|241765227|ref|ZP_04763210.1| Redoxin domain protein [Acidovorax delafieldii 2AN]
 gi|241365107|gb|EER59986.1| Redoxin domain protein [Acidovorax delafieldii 2AN]
          Length = 168

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 73/119 (61%), Gaps = 1/119 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+     AGK + LFALPGAFTPTCS   +PG+ +   + +  G++E++C+SVNDAFVM 
Sbjct: 31  VSVDKATAGKTIALFALPGAFTPTCSAKHVPGYVEKAAEFKAAGVDEIWCVSVNDAFVMG 90

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +  + +  V++L DG   F +  G+ +     G GLRS RY  L++D  V S  VE
Sbjct: 91  AWARDQKTEGKVRMLADGDAAFAKATGLTLDLHGKGMGLRSNRYSMLVRDGKVVSLNVE 149


>gi|148559629|ref|YP_001258495.1| thiol peroxidase [Brucella ovis ATCC 25840]
 gi|148370886|gb|ABQ60865.1| thiol peroxidase [Brucella ovis ATCC 25840]
          Length = 161

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 90/151 (59%), Gaps = 12/151 (7%)

Query: 2   IRF--QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQ 59
           I+F  ++P   F ++ A    DG       ++ T D+F G++V LFA+PGAFT TCS + 
Sbjct: 3   IKFGDRLPAATFKVKTA----DG-----VTEMTTDDVFKGRKVVLFAVPGAFTSTCSLNH 53

Query: 60  LPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGML 118
           LPG+ +  D +  +G++++  ++VND FVM AW +    +  +  L DGS  FT+  G+ 
Sbjct: 54  LPGYLENRDAILAKGVDQIAVVAVNDPFVMGAWAQSTGGEGKILFLADGSATFTKAAGLD 113

Query: 119 VYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           +     G G+RS RY A+++D VV+S  +EE
Sbjct: 114 IDLSGGGLGVRSKRYSAIVEDGVVKSLNIEE 144


>gi|260837161|ref|XP_002613574.1| hypothetical protein BRAFLDRAFT_119799 [Branchiostoma floridae]
 gi|229298959|gb|EEN69583.1| hypothetical protein BRAFLDRAFT_119799 [Branchiostoma floridae]
          Length = 189

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 80/128 (62%), Gaps = 2/128 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LFAGK+  +FA+PGAFTP CS   LPGF     DL+ +G+E + C+SVND FVM 
Sbjct: 55  VNVSELFAGKKGVIFAVPGAFTPGCSKTHLPGFVSRAGDLQAKGVEVIACVSVNDPFVME 114

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWG+  + +  V++L D   EFT+ +G+ +    +   +RS RY  L++D  V+   VE 
Sbjct: 115 AWGRDQKAEGKVRMLADTGAEFTKAIGLDLDATAILGNIRSKRYSMLVEDGEVKQLNVEP 174

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 175 DGTGLSCS 182


>gi|42565527|gb|AAS21026.1| peroxiredoxin [Hyacinthus orientalis]
          Length = 132

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 88/137 (64%), Gaps = 10/137 (7%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI 98
           GK+    A+PGAFTPTCS+  L GF +   +L+ +G++ + C+SVNDAFVM AW + L++
Sbjct: 3   GKKGSFLAVPGAFTPTCSEKHLRGFVEKAGELKAKGVDTIACISVNDAFVMKAWKEDLKV 62

Query: 99  KN-VKLLPDGSGEFTRKMGM-LVYKDN-VGFGLRSWRYGALIKDMVVESWFVEEGFSDNC 155
            + V LL DG+G+FTR +G+ L   D  VG G+RS RY  L +D VV+   +EEG +   
Sbjct: 63  GDEVLLLSDGNGDFTRALGVQLDLSDQPVGLGVRSRRYALLAEDGVVKVVNLEEGGA--- 119

Query: 156 ATDPYEISSPENVLKVI 172
               +  SS +++LK +
Sbjct: 120 ----FTFSSADDMLKAL 132


>gi|254293403|ref|YP_003059426.1| redoxin [Hirschia baltica ATCC 49814]
 gi|254041934|gb|ACT58729.1| Redoxin domain protein [Hirschia baltica ATCC 49814]
          Length = 160

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 8/140 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++T+DL +G  V LFA+PGA+TPTCS   LPG+    + LR +G++++ C+SVND FVM+
Sbjct: 25  LSTKDLTSGATVALFAVPGAYTPTCSVSHLPGYLNNAEALRAKGVDKIACISVNDVFVMD 84

Query: 91  AWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWGK   + +++ +L DG+ EF    G  +     G G R  RY  LIKD  V    +E+
Sbjct: 85  AWGKSSNVGEDIIMLADGNAEFADLTGTQLDGRGFGMGPRCKRYSMLIKDGKVVELNIED 144

Query: 150 GFSDNCATDPYEISSPENVL 169
           G         +++SS E +L
Sbjct: 145 G-------GEFKVSSAEYML 157


>gi|160895850|ref|YP_001561432.1| redoxin domain-containing protein [Delftia acidovorans SPH-1]
 gi|160361434|gb|ABX33047.1| Redoxin domain protein [Delftia acidovorans SPH-1]
          Length = 192

 Score =  104 bits (260), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 73/119 (61%), Gaps = 1/119 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V   +  AGK + +FA+PGAFTPTCS   +PGF +  +  +  G++E++CLSVNDAFVM 
Sbjct: 55  VKLPEAAAGKTIAVFAVPGAFTPTCSAKHVPGFVEQAEAFKAAGVDEIWCLSVNDAFVMG 114

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +  +    V++L DG   F +  G+ +  +  G GLRS RY  L+KD  V +  VE
Sbjct: 115 AWARDQKTDGKVRMLADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVKDGKVATLNVE 173


>gi|110832905|ref|YP_691764.1| AhpC/TSA family protein [Alcanivorax borkumensis SK2]
 gi|110646016|emb|CAL15492.1| AhpC/TSA family protein [Alcanivorax borkumensis SK2]
          Length = 157

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 79/139 (56%), Gaps = 6/139 (4%)

Query: 20  PDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVY 79
           PDG +     D+NT D F G++V LFA+PGAFTP CS+  +PGF  I  D   E ++ + 
Sbjct: 19  PDGPQ-----DLNTGDFFKGRKVVLFAVPGAFTPGCSNTHMPGFV-INADALLEKVDAIA 72

Query: 80  CLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           C++VNDAFVM AW K    + + +L DG+ E  + +G+ +       G+RS R+  +  D
Sbjct: 73  CMAVNDAFVMGAWQKDQNAERITMLADGNAELAKALGLELDATGGCMGIRSKRFALIAND 132

Query: 140 MVVESWFVEEGFSDNCATD 158
            VVE   V+    D  + D
Sbjct: 133 GVVEYLGVDAKGVDKSSAD 151


>gi|299471059|emb|CBN78919.1| Peroxyredoxin [Ectocarpus siliculosus]
          Length = 205

 Score =  104 bits (259), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 92/171 (53%), Gaps = 19/171 (11%)

Query: 14  RVATVLPDGSK-----AFQWK------DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG 62
           R+A  + +G K      FQ K      DV   ++FAGK+V +  +PGAFTPTC D+ LP 
Sbjct: 42  RLAMAIKEGDKFPMDSTFQIKGDAGPADVPASEIFAGKKVVICGVPGAFTPTCDDNHLPS 101

Query: 63  FEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYK 121
           F    D  + +G++ V C+SVNDAFVM+ W K L+ ++ V +L DG   F  + G+ V  
Sbjct: 102 FIANADKFKEKGVDTVACMSVNDAFVMSRWIKSLDAEDKVTMLADGGAVFAEESGLCVKT 161

Query: 122 DNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
              G G R  R   ++ D  +E  F+E+G      T   ++SS + VL  +
Sbjct: 162 GKFG-GTRLQRLAMIVNDGTIEKLFLEDG------TGYTDVSSGDTVLAAL 205


>gi|290996650|ref|XP_002680895.1| predicted protein [Naegleria gruberi]
 gi|284094517|gb|EFC48151.1| predicted protein [Naegleria gruberi]
          Length = 184

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 85/144 (59%), Gaps = 8/144 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V T DLF   +V +F +PGAFTP CS+  +P +      L+ +GI ++ CLSVND+FVM 
Sbjct: 47  VTTDDLFTSGKVIVFGVPGAFTPVCSNKHVPSYLNNSKALKEKGISKIICLSVNDSFVMK 106

Query: 91  AWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +K+   N  ++ + D  GEFTR++G+ V     G G RS R+  LI++  V+  FVE
Sbjct: 107 AWKEKVASGNEEIEFIADPLGEFTRQVGLEVDLTAAGLGKRSKRFSMLIENGKVKELFVE 166

Query: 149 EGFSDNCATDPYEISSPENVLKVI 172
           +      +    E ++ EN+L ++
Sbjct: 167 D------SPGQLEKTTAENMLTLL 184


>gi|254429164|ref|ZP_05042871.1| Redoxin superfamily [Alcanivorax sp. DG881]
 gi|196195333|gb|EDX90292.1| Redoxin superfamily [Alcanivorax sp. DG881]
          Length = 157

 Score =  103 bits (258), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 82/139 (58%), Gaps = 6/139 (4%)

Query: 20  PDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVY 79
           PDG +     D+NT + F G++V LFA+PGAFTP CS+  +PGF  +  D   + ++ + 
Sbjct: 19  PDGPE-----DLNTGEFFKGRKVVLFAVPGAFTPGCSNTHMPGF-VVNADALLDKVDAIA 72

Query: 80  CLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           C++VNDAFV++AW K    + + +L DG+ EF + +G+ +     G G+RS R+  +  D
Sbjct: 73  CMAVNDAFVLDAWQKDQNAERLTMLADGNAEFAKALGLELDATGGGMGMRSKRFALIAND 132

Query: 140 MVVESWFVEEGFSDNCATD 158
            VVE   V+    D  + D
Sbjct: 133 GVVEYIGVDAKGVDKSSAD 151


>gi|20269863|gb|AAM18076.1|AF498232_1 peroxiredoxin V protein [Branchiostoma belcheri tsingtauense]
          Length = 188

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 79/128 (61%), Gaps = 2/128 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LFAGK+  LFA+PGAFTP CS   LPG+     DL+ +G++ + C+SVND FVM 
Sbjct: 54  VNVSELFAGKKGVLFAVPGAFTPGCSKTHLPGYVGKAGDLKAKGVQVIACVSVNDPFVME 113

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK  + +  V++L D   EFT+ +G+ +    +   +RS RY  L++D  V+   VE 
Sbjct: 114 AWGKDQKAEGKVRMLADTGAEFTKAIGLDLDATGLLGNIRSKRYSMLVEDGEVKQLNVEP 173

Query: 149 EGFSDNCA 156
           +G    C+
Sbjct: 174 DGTGLTCS 181


>gi|86356614|ref|YP_468506.1| peroxiredoxin protein [Rhizobium etli CFN 42]
 gi|86280716|gb|ABC89779.1| probable peroxiredoxin protein [Rhizobium etli CFN 42]
          Length = 161

 Score =  103 bits (257), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 76/121 (62%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           ++ T+ LFAGKRV LFA+PGAFTPTCS + LPG+ +  D +  +G++++  L+VND  VM
Sbjct: 24  EITTEQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILAKGVDDIAVLAVNDWHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D    FT+ +G+       G GLRS RY  L++D VV++  VE
Sbjct: 84  GAWAQSSGGLGKIHFLADWDAAFTKAVGLEADLSAGGLGLRSKRYSMLVEDGVVKALNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|281200610|gb|EFA74828.1| peroxiredoxin [Polysphondylium pallidum PN500]
          Length = 176

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 90/144 (62%), Gaps = 13/144 (9%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           +   ++DLF  K+V LFALPG    TCS + LPG+ +   +++ +GI+ + CLS ND+FV
Sbjct: 42  QKTTSKDLFENKKVVLFALPG----TCSGNHLPGYVEHAGEIKSKGIDSIICLSTNDSFV 97

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFG-LRSWRYGALIKDMVVESWF 146
           M+ W K   + + V+L+ DG+ EFT+K+G+++     G G LRS RY A+I + VV+   
Sbjct: 98  MSYWAKDRNVGDAVQLIADGNSEFTQKVGLIMDGSAFGMGALRSKRYAAIIDNGVVKYIG 157

Query: 147 VEEGFSDNCATDPYEISSPENVLK 170
           VEE          +E+S+ +N+LK
Sbjct: 158 VEE-------PGKFELSAADNILK 174


>gi|229366500|gb|ACQ58230.1| Peroxiredoxin-5, mitochondrial precursor [Anoplopoma fimbria]
          Length = 214

 Score =  102 bits (255), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 78/125 (62%), Gaps = 5/125 (4%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           F GK+  LFA+PGAFTP CS   LPGF +   DL+ +G++EV C+SVNDAFVM AWGK+ 
Sbjct: 57  FEGKKGVLFAVPGAFTPGCSKTHLPGFVQQAADLKSKGLQEVACISVNDAFVMAAWGKEH 116

Query: 97  EIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGL---RSWRYGALIKDMVVESWFVE-EGF 151
                V++L D +G FT+ + +L+  D +   L   R  RY  L++D VV+   VE +G 
Sbjct: 117 GTDGKVRMLADPTGAFTKAVDLLLDSDQIVQALGNKRYKRYAMLVEDGVVKKINVEPDGT 176

Query: 152 SDNCA 156
              C+
Sbjct: 177 GLTCS 181


>gi|327192543|gb|EGE59494.1| putative thioredoxin protein [Rhizobium etli CNPAF512]
          Length = 161

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 77/121 (63%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +++T+ LFAG+RV LFA+PGAFTPTCS + LPG+ +  D +  +G++++  L+VND  VM
Sbjct: 24  EISTEQLFAGRRVVLFAVPGAFTPTCSLNHLPGYLENRDTILGKGVDDIAVLAVNDLHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D    FT+ +G+       G GLRS RY  L++D VV++  VE
Sbjct: 84  GAWAQSSGGMGKIHFLADWDAGFTKAVGLEADLSAGGLGLRSKRYSMLVEDGVVKALNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|222085139|ref|YP_002543669.1| peroxiredoxin protein [Agrobacterium radiobacter K84]
 gi|221722587|gb|ACM25743.1| peroxiredoxin protein [Agrobacterium radiobacter K84]
          Length = 161

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 77/121 (63%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           ++ T+ LFAGKRV LFA+PGAFTPTCS + LPG+ +  D +  +G++++  +SVND  VM
Sbjct: 24  EITTEQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDAILAKGVDDIAVISVNDWHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D  G F + +G+ V     G G+RS RY  L+++ VV++  +E
Sbjct: 84  GAWAQSSGGLGKIHFLADWDGSFAKAVGLDVDLSAGGLGVRSKRYSMLVENGVVKTLNIE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|84500432|ref|ZP_00998681.1| AhpC/TSA family protein [Oceanicola batsensis HTCC2597]
 gi|84391385|gb|EAQ03717.1| AhpC/TSA family protein [Oceanicola batsensis HTCC2597]
          Length = 162

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/161 (38%), Positives = 86/161 (53%), Gaps = 12/161 (7%)

Query: 18  VLPDGS----KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE 73
            LPD +     A   K+V+  +  AG+ V +FALPGA+T TC+   +P F +  D  R +
Sbjct: 8   TLPDATLVEFTAEGPKEVSLSERLAGRNVVIFALPGAYTGTCTTAHVPSFIRTVDQFRDK 67

Query: 74  GIEEVYCLSVNDAFVMNAWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSW 131
           G++EV CLSVND FVM AWGK     +  + +L D   EFT+ +GM      VG   RS 
Sbjct: 68  GVDEVICLSVNDPFVMAAWGKDTGAADAGIAMLGDPRAEFTKAVGMDFTAPPVGLIDRSK 127

Query: 132 RYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           RY   +KD VV     EE     C     ++S  E++L+ I
Sbjct: 128 RYAMYVKDGVVTVLHAEEN-PGQC-----DVSGGESMLEAI 162


>gi|328772793|gb|EGF82831.1| hypothetical protein BATDEDRAFT_18846 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 164

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 75/122 (61%), Gaps = 1/122 (0%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K  +T  +F  K V +FA+PGAFTPTC    LPGF   Y+  + +G++ V CL+ ND FV
Sbjct: 30  KPQSTAAVFGNKLVVVFAVPGAFTPTCHLQHLPGFISKYEAFKAKGVDTVACLATNDVFV 89

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           ++AWGK  +  + +  L DGSG FT+ +GM +   + G G+R  R+  +++D VV+   V
Sbjct: 90  LDAWGKAEKAGDKILFLADGSGAFTKAIGMELDLVDKGLGVRCQRFAMVVRDGVVKHIAV 149

Query: 148 EE 149
            E
Sbjct: 150 GE 151


>gi|323135736|ref|ZP_08070819.1| Redoxin domain protein [Methylocystis sp. ATCC 49242]
 gi|322398827|gb|EFY01346.1| Redoxin domain protein [Methylocystis sp. ATCC 49242]
          Length = 161

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 89/156 (57%), Gaps = 11/156 (7%)

Query: 19  LPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           +PD +     KD    + ++D FAG+++ LF++PGA+TPTC    LPGF +  D+++ +G
Sbjct: 9   IPDVTLTVMGKDGPQTIKSKDYFAGRKIALFSVPGAYTPTCHTKHLPGFVEKADEIKSKG 68

Query: 75  IEEVYCLSVNDAFVMNAWGK-KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
           ++ V   +VND F ++AW K K     +  L DGS    R MG+ +     G G+R  RY
Sbjct: 69  VDAVAVTAVNDIFTLDAWLKEKGASGKIDGLADGSAVLARAMGLELDLTEHGLGVRGKRY 128

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            A+++D VVE   VEE  S   AT    +SS E+ L
Sbjct: 129 SAIVRDGVVEWINVEENSS--LAT----VSSAESTL 158


>gi|324997802|ref|ZP_08118914.1| redoxin domain-containing protein [Pseudonocardia sp. P1]
          Length = 161

 Score =  101 bits (252), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 85/166 (51%), Gaps = 16/166 (9%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           QIP V      A    DG    Q     +        V LF +PGAFTP CSD  LPG+ 
Sbjct: 8   QIPDVTLMTPTA----DGPTKVQ-----SATALGSGTVVLFGVPGAFTPACSDTHLPGYV 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
              D+L+ +G++ V C S NDAFV+ AW +   + + V +L DG+ +F +  G+ +    
Sbjct: 59  LRADELKAKGVDTVACTSANDAFVLAAWAEARNVGDAVLMLADGNADFAKAAGLDMDGSA 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            G G RS RY A++KD VV+   VE+  S        E+S  E+VL
Sbjct: 119 FGLGTRSKRYAAIVKDGVVQWIGVEDVPSS------VEVSGVESVL 158


>gi|158422110|ref|YP_001523402.1| alkyl hydroperoxide reductase [Azorhizobium caulinodans ORS 571]
 gi|158328999|dbj|BAF86484.1| alkyl hydroperoxide reductase [Azorhizobium caulinodans ORS 571]
          Length = 161

 Score =  101 bits (252), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 73/119 (61%), Gaps = 1/119 (0%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
            T ++F GKRV LFA+PGAFTPTC  + LPG+    ++++ + I+ +  +SVND FVM A
Sbjct: 26  TTDEVFKGKRVVLFAVPGAFTPTCHKNHLPGYVSRAEEIKAKNIDTIAVVSVNDPFVMGA 85

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           W +       V  L DG+G+F + + +      VG GLRS RY  L++D VV+   VE+
Sbjct: 86  WEQASGADGKVLFLSDGNGDFAKALDLFFDGSAVGLGLRSKRYSMLVEDGVVKVLNVED 144


>gi|190890684|ref|YP_001977226.1| thioredoxin protein [Rhizobium etli CIAT 652]
 gi|190695963|gb|ACE90048.1| putative thioredoxin protein [Rhizobium etli CIAT 652]
          Length = 161

 Score =  101 bits (251), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 76/121 (62%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +++T+ LFAGKRV LFA+PGAFTPTCS + LPG+ +  D +   G++++  L+VND  VM
Sbjct: 24  EISTEQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILGRGVDDIAVLAVNDWHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D    FT+ +G+       G GLRS RY  L++D VV++  VE
Sbjct: 84  GAWAQSSGGMGKIHFLADWDAGFTKAVGLDADLSAGGLGLRSKRYSMLVEDGVVKALNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|218459259|ref|ZP_03499350.1| peroxiredoxin protein [Rhizobium etli Kim 5]
          Length = 161

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 75/121 (61%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           ++ T  LFAGKRV LFA+PGAFTPTCS + LPG+ +  D +  +G++++  L+VND  VM
Sbjct: 24  EITTDQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILGKGVDDIAVLAVNDWHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D    FT+ +G+       G GLRS RY  L++D VV++  VE
Sbjct: 84  GAWAQSSGGLGKIHFLADWDAGFTKAVGLEADLSAGGLGLRSKRYSMLVEDGVVKALNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|150395754|ref|YP_001326221.1| redoxin domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150027269|gb|ABR59386.1| Redoxin domain protein [Sinorhizobium medicae WSM419]
          Length = 161

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 74/121 (61%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +V T+ LF GKRV LFA+PGAFTPTCS + LPG+ +  D +   G++++  ++VND  VM
Sbjct: 24  EVTTEQLFKGKRVVLFAVPGAFTPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDLHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW      +  +  L D +  FTR +GM +       G+RS RY  L++D VV++  VE
Sbjct: 84  GAWATHSGGMGKIHFLSDWNAAFTRAIGMEIDLSAGTLGIRSKRYSMLVEDGVVKALNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|218672686|ref|ZP_03522355.1| peroxiredoxin protein [Rhizobium etli GR56]
          Length = 161

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 74/121 (61%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           ++ T  LFAGKRV LFA+PGAFTPTCS + LPG+ +  D +  +G++++  L+VND  VM
Sbjct: 24  EITTDQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILAKGVDDIAVLAVNDWHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +       +  L D    FT+ +G+       G GLRS RY  L++D VV++  VE
Sbjct: 84  GAWAQSSGGFGKIHFLADWDAGFTKAVGLEADLSAGGLGLRSKRYSMLVEDGVVKALNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|163745376|ref|ZP_02152736.1| antioxidant, AhpC/Tsa family, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161382194|gb|EDQ06603.1| antioxidant, AhpC/Tsa family, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 162

 Score =  100 bits (250), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 71/140 (50%), Gaps = 6/140 (4%)

Query: 16  ATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLR 71
            + LPD        D    V   D   G++V +FA+PGAFTPTC    +P F +  D   
Sbjct: 6   GSTLPDAKLVQMGADGPEPVQMADKLKGRKVVVFAVPGAFTPTCHSAHVPSFVRTKDQFD 65

Query: 72  CEGIEEVYCLSVNDAFVMNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLR 129
            +G++EV C+S ND FVM AWG+        + +L D S EFTR +GM    +  G   R
Sbjct: 66  AKGVDEVICISCNDPFVMKAWGEATGASEAGITMLADASSEFTRAIGMDFDAEGAGLVGR 125

Query: 130 SWRYGALIKDMVVESWFVEE 149
           S RY  L+ D  V  W  EE
Sbjct: 126 SKRYAMLVDDGKVTLWQPEE 145


>gi|209548225|ref|YP_002280142.1| redoxin [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209533981|gb|ACI53916.1| Redoxin domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 161

 Score =  100 bits (249), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 76/121 (62%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           ++ T+ LF+GKRV LFA+PGAFTPTCS + LPG+ +  D +  +G++++  ++VND  VM
Sbjct: 24  EITTEQLFSGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILGKGVDDIAVIAVNDWHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D    FT+ +G+       G GLRS RY  L++D VV++  VE
Sbjct: 84  GAWAQSSGGLGKIHFLADWDAAFTKAVGLDADLSGGGLGLRSKRYSMLVEDGVVKALNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|326429871|gb|EGD75441.1| peroxiredoxin V protein [Salpingoeca sp. ATCC 50818]
          Length = 198

 Score =  100 bits (249), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 84/144 (58%), Gaps = 8/144 (5%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           D + + LF GK+  LF +PGAFTP CS   LPG+ + +DDL+ +G + + C++VND FVM
Sbjct: 62  DFSIRSLFDGKKGILFGVPGAFTPGCSRTHLPGYVQRHDDLKAKGYDVLACVAVNDPFVM 121

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AWGK  ++   V++L D   E T+ +G+ +        +R  R+  +I D VV++  +E
Sbjct: 122 EAWGKDQKVDGKVRMLSDTCAELTKALGLELDAVERLGNVRCRRFALVIDDNVVKAAQIE 181

Query: 149 EGFSDNCATDPYEISSPENVLKVI 172
           EG +  C       S  ENV+ ++
Sbjct: 182 EGGAMTC-------SLAENVIDLL 198


>gi|91080447|ref|XP_969254.1| PREDICTED: similar to peroxiredoxin-like protein [Tribolium
           castaneum]
 gi|270005571|gb|EFA02019.1| hypothetical protein TcasGA2_TC007642 [Tribolium castaneum]
          Length = 156

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 78/128 (60%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN   L AGK++ +FA+PGAFTP CS   LPG+ +  ++L+ +GI E++C+SVND FVM 
Sbjct: 23  VNLAQLAAGKKIIIFAVPGAFTPGCSKTHLPGYVQKAEELKGQGISEIFCVSVNDPFVMA 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AW K  +    V+LL D S  FT+ + + V    +G G RS RY  ++ +  + S  VE 
Sbjct: 83  AWAKDQKTTGKVRLLADPSAAFTKALDLTVDIAPLG-GTRSKRYSMVVDNGKITSLQVEP 141

Query: 149 EGFSDNCA 156
           +G    C+
Sbjct: 142 DGTGLTCS 149


>gi|66773128|ref|NP_001019577.1| peroxiredoxin-5, mitochondrial [Danio rerio]
 gi|63102025|gb|AAH95755.1| Peroxiredoxin 5 [Danio rerio]
          Length = 162

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 81/133 (60%), Gaps = 5/133 (3%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
             ++  +LF+ KR  LF +PGAFTP CS   LPGF ++  +LR +G++EV C+SVND FV
Sbjct: 21  NSLSMAELFSCKRGVLFGVPGAFTPGCSKTHLPGFIQMAGELRAKGVDEVACISVNDVFV 80

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN---VGFGLRSWRYGALIKDMVVES 144
           M+AWGK+      V++L D +G FT+ + +++       V   LRS RY  LI++ VV  
Sbjct: 81  MSAWGKQNGADGKVRMLADPTGAFTKAVDLVLNNAQLIPVLGNLRSQRYAMLIENGVVTK 140

Query: 145 WFVE-EGFSDNCA 156
             VE +G    C+
Sbjct: 141 LSVEPDGTGLTCS 153


>gi|71082835|ref|YP_265554.1| peroxisomal membrane protein a (pmp20) [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91762742|ref|ZP_01264707.1| peroxisomal membrane protein a (pmp20) [Candidatus Pelagibacter
           ubique HTCC1002]
 gi|71061948|gb|AAZ20951.1| peroxisomal membrane protein a (pmp20) [Candidatus Pelagibacter
           ubique HTCC1062]
 gi|91718544|gb|EAS85194.1| peroxisomal membrane protein a (pmp20) [Candidatus Pelagibacter
           ubique HTCC1002]
          Length = 161

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 83/142 (58%), Gaps = 7/142 (4%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           NT + +  K++ LF LPGA+T  CS   LPG+   Y+  + +GI+ + C+SVND FVM++
Sbjct: 26  NTHEFYKDKKIVLFGLPGAYTSVCSAKHLPGYVNNYEKYKEKGIDHIVCISVNDPFVMDS 85

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           WGK   ++N + ++ D   EFT+ +G  V K   G G+RS RY  LI ++ V     EE 
Sbjct: 86  WGKSQNVENKIIMMADPFLEFTKAIGADVDKSARGLGIRSNRYTMLIDNLKVIK-LQEEE 144

Query: 151 FSDNCATDPYEISSPENVLKVI 172
            +  C     EIS+ +N L ++
Sbjct: 145 DAGAC-----EISAAQNFLSLV 161


>gi|254488984|ref|ZP_05102189.1| peroxiredoxin TPx2 [Roseobacter sp. GAI101]
 gi|214045853|gb|EEB86491.1| peroxiredoxin TPx2 [Roseobacter sp. GAI101]
          Length = 162

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 72/138 (52%), Gaps = 6/138 (4%)

Query: 18  VLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE 73
            LPD +      D    V   D   G++V +FA+PGAFTPTC    +P F +  D    +
Sbjct: 8   TLPDATLMQMGADGPAPVQMADKLKGRKVVIFAVPGAFTPTCHSAHVPSFIRTKDQFDAK 67

Query: 74  GIEEVYCLSVNDAFVMNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSW 131
           G++E+ C+SVND FVM AWG         + +L DG+  FT+ +GM    + VG   RS 
Sbjct: 68  GVDEIICVSVNDPFVMQAWGDATGASAAGITMLADGNSAFTKAIGMDFTAEPVGLMARSK 127

Query: 132 RYGALIKDMVVESWFVEE 149
           RY  L+ D  V  +  EE
Sbjct: 128 RYAMLVDDGKVSLFQAEE 145


>gi|114051191|ref|NP_001040386.1| peroxiredoxin [Bombyx mori]
 gi|95102710|gb|ABF51296.1| peroxiredoxin [Bombyx mori]
          Length = 188

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 78/128 (60%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +L AGK+V LFA+PGAFTP CS   LPG+ +  D L+ +G+ E+ C+SVND +VM 
Sbjct: 54  VNICELTAGKKVVLFAVPGAFTPGCSKTHLPGYVQNADKLKSDGVAEIVCVSVNDPYVMA 113

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWG +   K  V++L D SG F + + +      +G G RS R+  +I D  V+   VE 
Sbjct: 114 AWGAQHNTKGKVRMLADPSGNFIKALDLGTNLPPLG-GFRSKRFSMVIVDSKVQDLNVEP 172

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 173 DGTGLSCS 180


>gi|312195512|ref|YP_004015573.1| Redoxin domain protein [Frankia sp. EuI1c]
 gi|311226848|gb|ADP79703.1| Redoxin domain protein [Frankia sp. EuI1c]
          Length = 160

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 71/119 (59%), Gaps = 1/119 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V + +L    +V LFA+PGAFTP CS   LPGF    D+L  +G++ + C++VND +VM 
Sbjct: 25  VRSAELLGSGKVVLFAVPGAFTPGCSKIHLPGFVAQADELASKGVDRIACVAVNDPWVMQ 84

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW     + + + ++ DGS  FT  MG+       G G+RS RY A+I++ V+ +  VE
Sbjct: 85  AWAASQGVGDKIVMIADGSARFTEAMGLTGDMTAAGLGVRSQRYAAVIENGVIRNLDVE 143


>gi|195444791|ref|XP_002070031.1| GK11833 [Drosophila willistoni]
 gi|194166116|gb|EDW81017.1| GK11833 [Drosophila willistoni]
          Length = 185

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 81/129 (62%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC-EGIEEVYCLSVNDAFVM 89
           +NT DL  GK+V +F +PGAFTP CS   LPG+    D L+  +G++E+ C+SVND FVM
Sbjct: 50  INTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYISTSDQLKSQQGVDEIVCVSVNDPFVM 109

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V+LL D +G FT+ + + +    +G G+RS RY  ++++  V    VE
Sbjct: 110 SAWGKEHGANGKVRLLADPAGAFTKALDVTIDLPPLG-GVRSKRYSLVVENGSVTELNVE 168

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 169 PDGTGLSCS 177


>gi|195497529|ref|XP_002096139.1| GE25237 [Drosophila yakuba]
 gi|194182240|gb|EDW95851.1| GE25237 [Drosophila yakuba]
          Length = 190

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 96/172 (55%), Gaps = 17/172 (9%)

Query: 1   MIRFQIPQVVFHMR-----------VATVLP--DGSKAFQWKDVNTQDLFAGKRVFLFAL 47
           ++   +PQ++  +R           V   LP  D  +      +NT DL  GK+V +F +
Sbjct: 12  VVNSALPQIIISLRSLSRTSAAMVKVGDSLPAVDLFEDSPANKINTGDLVNGKKVIIFGV 71

Query: 48  PGAFTPTCSDHQLPGFEKIYDDLRC-EGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLP 105
           PGAFTP CS   LPG+    D+L+  +G++E+ C+SVND FVM+AWGK+      V+LL 
Sbjct: 72  PGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVMSAWGKEHGASGKVRLLA 131

Query: 106 DGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE-EGFSDNCA 156
           D +G FT+ + + +    +G G+RS RY  ++++  V    VE +G   +C+
Sbjct: 132 DPAGGFTKALDVTIDLPPLG-GVRSKRYSLVVENGKVTELNVEPDGTGLSCS 182


>gi|126733960|ref|ZP_01749707.1| antioxidant, AhpC/Tsa family, putative [Roseobacter sp. CCS2]
 gi|126716826|gb|EBA13690.1| antioxidant, AhpC/Tsa family, putative [Roseobacter sp. CCS2]
          Length = 204

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 85/166 (51%), Gaps = 12/166 (7%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           ++    LPD +     +D    V   D    ++V LF LPGA+T TCS   +P F   YD
Sbjct: 37  IKTGDTLPDATLLAMGEDGPQQVALADKLKDRKVVLFGLPGAYTGTCSTAHVPSFMVTYD 96

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           D + +G++E+ C+SVND FVM AWG+        + +L D    FT  +GM      VGF
Sbjct: 97  DFKAKGVDEIICVSVNDPFVMQAWGESTRATETGITMLADAESAFTTAIGMNFSAPPVGF 156

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
             RS RY  L+++ VV +   EE     C     EIS+ E +L+ +
Sbjct: 157 VNRSKRYAMLVENGVV-AILNEELSPGEC-----EISAGETLLEAL 196


>gi|195569999|ref|XP_002102996.1| GD20203 [Drosophila simulans]
 gi|194198923|gb|EDX12499.1| GD20203 [Drosophila simulans]
          Length = 190

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 82/129 (63%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC-EGIEEVYCLSVNDAFVM 89
           +NT DL  GK+V +F +PGAFTP CS   LPG+    D+L+  +G++E+ C+SVND FVM
Sbjct: 55  INTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVM 114

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V+LL D +G FT+ + + +    +G G+RS RY  ++++  V    VE
Sbjct: 115 SAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLG-GVRSKRYSLVVENGKVTELNVE 173

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 174 PDGTGLSCS 182


>gi|194900296|ref|XP_001979693.1| GG16729 [Drosophila erecta]
 gi|190651396|gb|EDV48651.1| GG16729 [Drosophila erecta]
          Length = 190

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 82/129 (63%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC-EGIEEVYCLSVNDAFVM 89
           +NT DL  GK+V +F +PGAFTP CS   LPG+    D+L+  +G++E+ C+SVND FVM
Sbjct: 55  INTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVM 114

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V+LL D +G FT+ + + +    +G G+RS RY  ++++  V    VE
Sbjct: 115 SAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLG-GVRSKRYSLVVENGKVTELNVE 173

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 174 PDGTGLSCS 182


>gi|116250810|ref|YP_766648.1| thioredoxin family protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|241203408|ref|YP_002974504.1| Redoxin domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|115255458|emb|CAK06534.1| putative thioredoxin family protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|240857298|gb|ACS54965.1| Redoxin domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 161

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 75/121 (61%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           ++ T  LFAGKRV LFA+PGAFTPTCS + LPG+ +  D +  +G++++  ++VND  VM
Sbjct: 24  EITTDQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILGKGVDDIAVVAVNDWHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D    FT+ +G+       G GLRS RY  L++D VV++  VE
Sbjct: 84  GAWAQSSGGMGKIHFLADWDAGFTKAVGLDADLSAGGLGLRSKRYSMLVEDGVVKALNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|78706776|ref|NP_001027191.1| peroxiredoxin 5, isoform B [Drosophila melanogaster]
 gi|78709078|ref|NP_650679.3| peroxiredoxin 5, isoform A [Drosophila melanogaster]
 gi|15292277|gb|AAK93407.1| LD45324p [Drosophila melanogaster]
 gi|25012449|gb|AAN71330.1| RE23139p [Drosophila melanogaster]
 gi|28317021|gb|AAO39530.1| RE19605p [Drosophila melanogaster]
 gi|28381340|gb|AAO41575.1| peroxiredoxin 5, isoform B [Drosophila melanogaster]
 gi|71854599|gb|AAF55497.2| peroxiredoxin 5, isoform A [Drosophila melanogaster]
 gi|220944380|gb|ACL84733.1| CG7217-PA [synthetic construct]
 gi|220954254|gb|ACL89670.1| CG7217-PA [synthetic construct]
          Length = 190

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 82/129 (63%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC-EGIEEVYCLSVNDAFVM 89
           +NT DL  GK+V +F +PGAFTP CS   LPG+    D+L+  +G++E+ C+SVND FVM
Sbjct: 55  INTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVM 114

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V+LL D +G FT+ + + +    +G G+RS RY  ++++  V    VE
Sbjct: 115 SAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLG-GVRSKRYSLVVENGKVTELNVE 173

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 174 PDGTGLSCS 182


>gi|254511396|ref|ZP_05123463.1| peroxiredoxin-2E-2 [Rhodobacteraceae bacterium KLH11]
 gi|221535107|gb|EEE38095.1| peroxiredoxin-2E-2 [Rhodobacteraceae bacterium KLH11]
          Length = 161

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 84/161 (52%), Gaps = 12/161 (7%)

Query: 18  VLPDGS----KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE 73
            LPD +     A   ++V   D   G++V +FA+PGAFTPTC    +P F +  D    +
Sbjct: 7   TLPDATLTRLGAEGPEEVRVSDKTKGRKVVIFAVPGAFTPTCHSAHVPSFMRTKDQFDAK 66

Query: 74  GIEEVYCLSVNDAFVMNAWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSW 131
           G++E+ C+SVND FVM AWG+        + +L D + EFT+ +GM       G   RS 
Sbjct: 67  GVDEIICISVNDPFVMKAWGEATGATEAGLSMLADAASEFTKAIGMDFDAPPAGLLARSK 126

Query: 132 RYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           RY  L++D  V +  +EE      +    EIS+ E +L  I
Sbjct: 127 RYAMLVEDGKVVALNLEE------SPGACEISAGEGLLDTI 161


>gi|195348957|ref|XP_002041013.1| GM15327 [Drosophila sechellia]
 gi|194122618|gb|EDW44661.1| GM15327 [Drosophila sechellia]
          Length = 190

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 82/129 (63%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC-EGIEEVYCLSVNDAFVM 89
           +NT DL  GK+V +F +PGAFTP CS   LPG+    D+L+  +G++E+ C+SVND FVM
Sbjct: 55  INTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVM 114

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V+LL D +G FT+ + + +    +G G+RS RY  ++++  V    VE
Sbjct: 115 SAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLG-GVRSKRYSLVVENGKVTELNVE 173

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 174 PDGTGLSCS 182


>gi|224006119|ref|XP_002292020.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220972539|gb|EED90871.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 217

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 81/143 (56%), Gaps = 6/143 (4%)

Query: 16  ATVLPDGSKAFQWK-DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           + VL +G   ++   DVN  +L AGK+V LFA+PGAFTP CS   LP F     +LR +G
Sbjct: 69  SVVLKEGQADYEKPVDVNIGELIAGKKVALFAVPGAFTPGCSKSHLPSFITAQKELREKG 128

Query: 75  IEEVYCLSVNDAFVMNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWR 132
           ++   C++ NDA+VM AWG+        ++ L D + E +R +G+ +  D +   +R+ R
Sbjct: 129 VDLTICIATNDAYVMEAWGRTSGGADAGIRFLSDANAELSRALGLSMENDVM---VRTKR 185

Query: 133 YGALIKDMVVESWFVEEGFSDNC 155
           +  + +D +V  +F     SDN 
Sbjct: 186 FSLIAEDGIVTHYFSSADASDNT 208


>gi|38048721|gb|AAR10263.1| similar to Drosophila melanogaster CG7217 [Drosophila yakuba]
          Length = 157

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 82/129 (63%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC-EGIEEVYCLSVNDAFVM 89
           +NT DL  GK+V +F +PGAFTP CS   LPG+    D+L+  +G++E+ C+SVND FVM
Sbjct: 22  INTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVM 81

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V+LL D +G FT+ + + +    +G G+RS RY  ++++  V    VE
Sbjct: 82  SAWGKEHGASGKVRLLADPAGGFTKALDVTIDLPPLG-GVRSKRYSLVVENGKVTELNVE 140

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 141 PDGTGLSCS 149


>gi|21361068|gb|AAM49795.1|AF516693_1 peroxiredoxin [Pyrocoelia rufa]
          Length = 185

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 78/124 (62%), Gaps = 2/124 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +L AGK++ +FA+PGAFTP CS   LPG+ K  ++L+ +GI E+ C++VND FVM+
Sbjct: 54  VNLNELSAGKKIIVFAVPGAFTPGCSKTHLPGYVKKAEELKLQGISEIACVAVNDPFVMS 113

Query: 91  AWGKKLEIK-NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWGK+  +   +++L D    FT+ + +      +G G RS RY  ++++  V+S  V+ 
Sbjct: 114 AWGKEHNVNGKIRMLADTQATFTKSIDLGQDLAPLG-GYRSKRYSMVVENGKVQSLQVDP 172

Query: 150 GFSD 153
              D
Sbjct: 173 MVPD 176


>gi|68348725|gb|AAY96293.1| peroxiredoxin 5 [Arenicola marina]
          Length = 186

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 81/135 (60%), Gaps = 2/135 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LFAGK+  LFA+PGAFTP CS   LPG+ +    +  +G++ + C++VND+FVM+
Sbjct: 50  VNMAELFAGKKGVLFAVPGAFTPGCSKTHLPGYVEQAAAIHGKGVDIIACMAVNDSFVMD 109

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK     + V++L D  G FT+ + M +    V   +RS RY  +I+D VV    VE 
Sbjct: 110 AWGKAHGADDKVQMLADPGGAFTKAVDMELDLSAVLGNVRSKRYSLVIEDGVVTKVNVEP 169

Query: 149 EGFSDNCATDPYEIS 163
           +G    C+  P  +S
Sbjct: 170 DGKGLTCSLAPNILS 184


>gi|83594387|ref|YP_428139.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Rhodospirillum rubrum ATCC 11170]
 gi|83577301|gb|ABC23852.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Rhodospirillum rubrum ATCC 11170]
          Length = 159

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 89/165 (53%), Gaps = 12/165 (7%)

Query: 13  MRVATVLPDGS----KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           + V   LP G+     A   + V+  +     +  LFA+PGAFTPTCSD  +PG+     
Sbjct: 2   IAVGDALPSGTLHHKTAAGIEAVDPAEFLGAGKAVLFAVPGAFTPTCSDSHVPGYIAQAQ 61

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK-NVKLLPDGSGEFTRKMGMLVYKDNVGFG 127
            LR +G+ +V C++VNDAFV+ AW K L  +  V++L DG+G++ R +G+ +     G G
Sbjct: 62  ALRDKGVTKVACVAVNDAFVLAAWSKALGAEGTVEMLADGNGDYARALGLELDLTAKGLG 121

Query: 128 LRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            R  R   ++ +  V    V+EG +        ++SS E VL ++
Sbjct: 122 KRFQRCALVLDNGKVTHLAVDEGGA-------LDVSSAEAVLALL 159


>gi|260460289|ref|ZP_05808541.1| Redoxin domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259033934|gb|EEW35193.1| Redoxin domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 160

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 85/145 (58%), Gaps = 10/145 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P+  F     T+  DG+KA     + + ++F+GK+V LF +PGAFTPTCS++ LPG+ 
Sbjct: 8   KLPEATFK----TMTADGAKA-----ITSAEIFSGKKVVLFGVPGAFTPTCSNNHLPGYI 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           + +D +   G++ +  +SVND  VM AW +    +  +  L DG+G+F + +G+      
Sbjct: 59  ENHDAILARGVDTIAVVSVNDVHVMGAWARFTGGEGKILFLADGNGDFAKAVGLDNDLSA 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVE 148
            G GLRS R+  ++ D  V +  VE
Sbjct: 119 GGMGLRSKRFSMIVDDGKVTAINVE 143


>gi|297740055|emb|CBI30237.3| unnamed protein product [Vitis vinifera]
          Length = 189

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 64/93 (68%), Gaps = 1/93 (1%)

Query: 25  AFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVN 84
           A + +     DL  GK+  LFA+PGAFTPTCS   LPGF +   +L+ +G+E + C+SVN
Sbjct: 63  AGELQTTTVSDLTKGKKAILFAVPGAFTPTCSQKHLPGFVEKSGELKSKGVETIACISVN 122

Query: 85  DAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMG 116
           DAFVM AW   L+I++ V LL DG+G+FT+ +G
Sbjct: 123 DAFVMKAWKADLKIEDQVLLLSDGNGDFTKAIG 155


>gi|168011033|ref|XP_001758208.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162690664|gb|EDQ77030.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 198

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 80/137 (58%), Gaps = 7/137 (5%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           ++F GK+V +F LPGAFT  CS   +P F    D L+ +GI+ + C+SVND + MNAW +
Sbjct: 66  EIFKGKKVAIFGLPGAFTGVCSQKHVPSFLNNSDKLKSKGIDSIVCVSVNDPYTMNAWAE 125

Query: 95  KLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSD 153
           KL  K+ +K   D  G+F + +G+ +       G RS RY A+++D  ++   VEE  SD
Sbjct: 126 KLGAKDKIKFYGDFDGKFHKSLGLDLDLSGALLGPRSQRYAAVVEDGKIKQLNVEEVPSD 185

Query: 154 NCATDPYEISSPENVLK 170
                 +++S  E +LK
Sbjct: 186 ------FKVSDAETLLK 196


>gi|195157834|ref|XP_002019799.1| GL12016 [Drosophila persimilis]
 gi|198455364|ref|XP_002138062.1| GA26161 [Drosophila pseudoobscura pseudoobscura]
 gi|194116390|gb|EDW38433.1| GL12016 [Drosophila persimilis]
 gi|198133214|gb|EDY68620.1| GA26161 [Drosophila pseudoobscura pseudoobscura]
          Length = 189

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 82/129 (63%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC-EGIEEVYCLSVNDAFVM 89
           +NT DL  GK+V +F +PGAFTP CS   LPG+    D+L+  +G++E+ C+SVND FVM
Sbjct: 54  INTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVM 113

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V+LL D +G FT+ + + +    +G G+RS RY  ++++  V    VE
Sbjct: 114 SAWGKEHGAGGKVRLLADPAGGFTKALDVSIDLPPLG-GVRSKRYSLVVENGKVTELNVE 172

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 173 PDGTGLSCS 181


>gi|326783902|ref|YP_004324296.1| antioxidant protein [Synechococcus phage S-SSM7]
 gi|310003914|gb|ADO98309.1| antioxidant protein [Synechococcus phage S-SSM7]
          Length = 212

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 91/155 (58%), Gaps = 16/155 (10%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI-EEVYCLSVNDAFVMNAW 92
             LF GK V L ++ GAFTP C++  +  +EK+YD    E I +E+Y LS+ND+FVM+ W
Sbjct: 25  HSLFEGKDVLLVSVCGAFTPPCTE-MVKEYEKLYDTFIKETIVDEIYVLSMNDSFVMDKW 83

Query: 93  GKKLEIKNVKLLPDGSGEFTRKM----GMLVYK-----DNVGFGLRSWRYGALIKDMVVE 143
            K+++IK +K LPDG+G +  ++    GM   +      N G G+R+WR+  L+++ V  
Sbjct: 84  FKEMKIKKLKYLPDGNGAYVFRLAKQGGMAATQCSIKMYNKGMGVRAWRWVMLVENNVQM 143

Query: 144 SWFVEE-----GFSDNCATDPYEISSPENVLKVIR 173
            +  EE     G  DN   DP+E++    +L+ ++
Sbjct: 144 VYLEEETPDGVGTRDNLPNDPFELTHASQMLEFLK 178


>gi|260429539|ref|ZP_05783516.1| peroxiredoxin-2C [Citreicella sp. SE45]
 gi|260420162|gb|EEX13415.1| peroxiredoxin-2C [Citreicella sp. SE45]
          Length = 162

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 79/146 (54%), Gaps = 8/146 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V  +D  +G++V +FA+PGAFTPTC    +P F +  D    +G++E+ C+SVND FV
Sbjct: 23  EQVKLEDKLSGRKVVIFAVPGAFTPTCHSAHVPSFIRTKDQFAGKGVDEIICVSVNDPFV 82

Query: 89  MNAWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWG+        + +L D    FT+ +GM       G   RS RY  L++D  V + F
Sbjct: 83  MKAWGEATGATEAGITMLGDPESAFTKAIGMDFTAPPAGLMARSKRYAMLVEDGTV-TLF 141

Query: 147 VEEGFSDNCATDPYEISSPENVLKVI 172
             E     C     EIS+ E++L+ +
Sbjct: 142 HAEASPGEC-----EISAGESLLEAM 162


>gi|304393512|ref|ZP_07375440.1| peroxiredoxin-2E-1, ic [Ahrensia sp. R2A130]
 gi|303294519|gb|EFL88891.1| peroxiredoxin-2E-1, ic [Ahrensia sp. R2A130]
          Length = 161

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 75/133 (56%), Gaps = 1/133 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++T +L +GK V LFA+PGAFTPTC  + LPGF +  D ++ +G++ +   +VND  V N
Sbjct: 25  MSTSELCSGKTVVLFAVPGAFTPTCHANHLPGFLEHSDAIKEKGVDTIAVTTVNDIHVTN 84

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW    + K  V  L DG+ EF   +G  +     G G+RS RY  +IKD V+ +  VE+
Sbjct: 85  AWADASKAKGKVVFLSDGNAEFATAVGQEIDLGVAGMGMRSKRYSMIIKDGVITNLNVED 144

Query: 150 GFSDNCATDPYEI 162
                 A+    I
Sbjct: 145 NPGQAVASSASAI 157


>gi|254502400|ref|ZP_05114551.1| Redoxin superfamily [Labrenzia alexandrii DFL-11]
 gi|222438471|gb|EEE45150.1| Redoxin superfamily [Labrenzia alexandrii DFL-11]
          Length = 160

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 78/154 (50%), Gaps = 4/154 (2%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           ++V   LPD +      D    ++T DL +GK V LF +PGAFTPTC  + LPGF +  D
Sbjct: 3   LKVGDKLPDATFKTMTSDGPGEISTADLTSGKTVVLFGVPGAFTPTCHMNHLPGFVEHAD 62

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
            L+ +GI+ +  +SVND FVM+AW K      +  L D   EF    G+ +    +   L
Sbjct: 63  TLKSKGIDAIAVVSVNDVFVMDAWQKASNANAITFLADTGAEFVEAAGLGLGPAPIFGHL 122

Query: 129 RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEI 162
           RS R+  + KD  V    VE+   D   T    I
Sbjct: 123 RSQRFALIAKDGEVSFIAVEDSPGDATKTGAAAI 156


>gi|75676870|ref|YP_319291.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Nitrobacter winogradskyi Nb-255]
 gi|74421740|gb|ABA05939.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Nitrobacter winogradskyi Nb-255]
          Length = 161

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 80/142 (56%), Gaps = 5/142 (3%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           ++V   LP+ +     +D     +T D+F  K+V LFA+PGA+T TC    LP      +
Sbjct: 3   IKVGDCLPNATFRIMTEDGVLTKSTDDIFKSKKVALFAVPGAYTGTCHKQHLPSIFASAN 62

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFG 127
            ++ +G+ E+  +SVND FVMNAW +  + +N    L DG+ EF + + M       G G
Sbjct: 63  AIKGKGVNEIAIVSVNDVFVMNAWKRDTDQRNEATFLADGNAEFAKAIDMTFDGSEKGLG 122

Query: 128 LRSWRYGALIKDMVVESWFVEE 149
           +RS RY  L++D VV++  VE+
Sbjct: 123 IRSKRYSMLVEDGVVKTLNVED 144


>gi|323320784|gb|ADX36414.1| peroxiredoxin 5 [Brachymyrmex patagonicus]
          Length = 157

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 81/128 (63%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           +N  D+   K++ LFA+PGAFTP CS   LP + +   DL+  G++E+ C+SVND FVM+
Sbjct: 24  INIADISKNKKIVLFAVPGAFTPGCSKTHLPSYLEKEKDLKSGGVDEIVCVSVNDPFVMS 83

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWG +   K  +++L D +  FT+ + + +    +G GLRS RY  ++++ VV+S  VE 
Sbjct: 84  AWGNQFNTKGKIRMLADPNAAFTKAVDLSLDLPPLG-GLRSKRYSMVLENGVVKSLNVEP 142

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 143 DGTGLSCS 150


>gi|307177535|gb|EFN66646.1| Importin subunit alpha-7 [Camponotus floridanus]
          Length = 670

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 72/121 (59%), Gaps = 2/121 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN     AGK++ +F +PGAFTP CS   LPG+    DDL+ +GI E++C+SVND FVM 
Sbjct: 23  VNLAQAAAGKKIIIFGVPGAFTPGCSKTHLPGYVTKADDLKSKGISEIFCISVNDPFVMA 82

Query: 91  AWGKKLEIK-NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AWGK+      V++L D  G+FT    + V    +G G RS RY  ++ + +V+   +  
Sbjct: 83  AWGKEHNATGKVRMLADPKGDFTDAADLSVDLHVLG-GKRSKRYSMVVDNGIVKELNMST 141

Query: 150 G 150
           G
Sbjct: 142 G 142


>gi|15888122|ref|NP_353803.1| peroxiredoxin [Agrobacterium tumefaciens str. C58]
 gi|15155756|gb|AAK86588.1| peroxiredoxin [Agrobacterium tumefaciens str. C58]
          Length = 161

 Score = 97.8 bits (242), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 73/121 (60%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +  T  LF GK+V LFA+PGAFTPTCS + LPG+ +  D +  +G++++  +SVND  VM
Sbjct: 24  ETTTDALFGGKKVVLFAVPGAFTPTCSLNHLPGYLENRDAILAKGVDDIAVVSVNDWHVM 83

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D    FT+ +G+       G G+RS RY  L++D VV+S  VE
Sbjct: 84  GAWAQSSGGQGKIHFLADWDASFTKALGLDADLSGGGLGVRSKRYSMLVEDGVVKSLNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|159042669|ref|YP_001531463.1| redoxin [Dinoroseobacter shibae DFL 12]
 gi|157910429|gb|ABV91862.1| redoxin [Dinoroseobacter shibae DFL 12]
          Length = 160

 Score = 97.8 bits (242), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 68/121 (56%), Gaps = 2/121 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+   L AG++V LFA+PGA+TPTC    +P F +  D    +G++E+ C+SVND FVM 
Sbjct: 23  VSVSSLTAGRKVILFAVPGAYTPTCHSAHVPSFVRTKDAFAAKGVDEIICVSVNDPFVMK 82

Query: 91  AWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWG+     +  + +L D   EFT+ +GM       G   RS RY    +D VV+    E
Sbjct: 83  AWGEATGAADAGITMLGDPGSEFTKAIGMDFDAPPAGLHARSKRYALYAEDGVVKVLHAE 142

Query: 149 E 149
           E
Sbjct: 143 E 143


>gi|15964668|ref|NP_385021.1| peroxiredoxin protein [Sinorhizobium meliloti 1021]
 gi|307304246|ref|ZP_07583998.1| Redoxin domain protein [Sinorhizobium meliloti BL225C]
 gi|307320551|ref|ZP_07599966.1| Redoxin domain protein [Sinorhizobium meliloti AK83]
 gi|15073846|emb|CAC45487.1| Hypothetical peroxiredoxin protein [Sinorhizobium meliloti 1021]
 gi|306893827|gb|EFN24598.1| Redoxin domain protein [Sinorhizobium meliloti AK83]
 gi|306902714|gb|EFN33307.1| Redoxin domain protein [Sinorhizobium meliloti BL225C]
          Length = 161

 Score = 97.8 bits (242), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 74/121 (61%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +V T+ LF GKRV LFA+PGAFTPTCS + LPG+ +  D +   G++++  ++VND  VM
Sbjct: 24  EVTTELLFKGKRVVLFAVPGAFTPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDLHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW      +  +  L D +  FT+ +GM +       G+RS RY  L++D VV++  +E
Sbjct: 84  GAWATHSGGMGKIHFLSDWNAAFTKAIGMEIDLSAGTLGIRSKRYSMLVEDGVVKALNIE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|254460344|ref|ZP_05073760.1| peroxiredoxin TPx2 [Rhodobacterales bacterium HTCC2083]
 gi|206676933|gb|EDZ41420.1| peroxiredoxin TPx2 [Rhodobacteraceae bacterium HTCC2083]
          Length = 162

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 77/144 (53%), Gaps = 8/144 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V   D  AG++V +FA+PGAFTPTC    +P F +  D    +G++E+ C+SVND FVM 
Sbjct: 25  VALADKTAGRKVVIFAVPGAFTPTCHSAHVPSFMRTKDQFTEKGVDEIICVSVNDPFVMK 84

Query: 91  AWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWG+        + +L D    FT+ +GM       G   RS RY  L++D +V +   E
Sbjct: 85  AWGEVTGATEAGITMLSDAESAFTKAIGMDFDAPPAGLIARSKRYAMLVEDGIV-TQLNE 143

Query: 149 EGFSDNCATDPYEISSPENVLKVI 172
           E     C     EIS+ E +L V+
Sbjct: 144 ESSPGEC-----EISAGEGLLDVM 162


>gi|260783931|ref|XP_002587024.1| hypothetical protein BRAFLDRAFT_103838 [Branchiostoma floridae]
 gi|229272158|gb|EEN43035.1| hypothetical protein BRAFLDRAFT_103838 [Branchiostoma floridae]
          Length = 125

 Score = 97.4 bits (241), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 67/103 (65%), Gaps = 1/103 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LFAGK+  LFA+PGAFTP CS   LPGF     DL+ +G++ + C+SVND FVM 
Sbjct: 23  VNVSELFAGKKGILFAVPGAFTPGCSKTHLPGFVSQAGDLKAKGVQVIACVSVNDPFVME 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWR 132
           AWGK  + +  V++L D + EFT+ +G+ +    +   +RS R
Sbjct: 83  AWGKDQKAEGKVRMLADSAAEFTKAIGLELDATGLLGNIRSKR 125


>gi|90425550|ref|YP_533920.1| peroxiredoxin-like protein [Rhodopseudomonas palustris BisB18]
 gi|90107564|gb|ABD89601.1| peroxiredoxin-like protein [Rhodopseudomonas palustris BisB18]
          Length = 161

 Score = 97.4 bits (241), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 74/118 (62%), Gaps = 1/118 (0%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
            T+D+F GK+V +FA+PGA+T TC    LP        ++ +G++ +  +SVNDAFVM A
Sbjct: 26  TTEDIFKGKKVAVFAVPGAYTGTCHKMHLPSIFLNAYAIKDKGVDTIAIVSVNDAFVMGA 85

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           W +  +++N    L DG+ EFT+ +GM +     G G+RS RY  L++D VV++  +E
Sbjct: 86  WKRDTDLRNEATFLADGNAEFTKAIGMELDASGNGLGIRSHRYSMLVEDGVVKTLNLE 143


>gi|156550175|ref|XP_001603445.1| PREDICTED: similar to peroxiredoxin 5, prdx5 [Nasonia vitripennis]
          Length = 186

 Score = 97.4 bits (241), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN   L  GK++ +FA+PGAFTP CS   LPG+ +  D+L+ +G  E+ C+ VND FVM 
Sbjct: 54  VNLAQLSQGKKIIVFAVPGAFTPGCSKTHLPGYVQKADELKAKGYSEIICIGVNDPFVMA 113

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWGK    +  V++L D +G FT  + + V    +G G RS RY  +I+D  V+   VE
Sbjct: 114 AWGKDQNTQGKVRMLADPAGAFTDAVDLSVDLAVLG-GKRSKRYSMIIEDGTVKELNVE 171


>gi|307207876|gb|EFN85437.1| Peroxiredoxin-5, mitochondrial [Harpegnathos saltator]
          Length = 152

 Score = 97.1 bits (240), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 52/119 (43%), Positives = 74/119 (62%), Gaps = 2/119 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN     AGK++ +FA+PGAFTP CS   LPG+     +L+ +GI E++C+SVND FVM 
Sbjct: 19  VNLAKEAAGKKIVVFAVPGAFTPGCSKTHLPGYIGKAAELKFKGISEIFCISVNDPFVME 78

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWGK+    N V++L D   EFT  + + V    +G G RS RY  +++D +V+   VE
Sbjct: 79  AWGKEHGANNKVRMLADPKAEFTDAVDLSVDLPPLG-GKRSKRYSMIVEDGIVKELNVE 136


>gi|156066428|gb|ABU43073.1| 1-Cys peroxiredoxin isozyme [Taiwanofungus camphoratus]
          Length = 171

 Score = 97.1 bits (240), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 77/119 (64%), Gaps = 1/119 (0%)

Query: 33  TQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW 92
           T D + GK+V +F++PGAFTPTC  + LP + + Y++ + +G++ +  ++ NDAFVM+ W
Sbjct: 38  TTDQWKGKKVVIFSVPGAFTPTCHVNHLPPYIEKYEEFKAKGVDTIAVVAANDAFVMSGW 97

Query: 93  GKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
            + + +K+ +  L DG   +++ +G+ V    +GFG R+ RY  ++ D+VV+   VE G
Sbjct: 98  ARLMGLKDKIIALSDGDAAWSKSLGLDVDMSAIGFGTRTARYAIILDDLVVKYVEVEPG 156


>gi|194743812|ref|XP_001954394.1| GF18245 [Drosophila ananassae]
 gi|190627431|gb|EDV42955.1| GF18245 [Drosophila ananassae]
          Length = 157

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 82/129 (63%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC-EGIEEVYCLSVNDAFVM 89
           +NT DL  GK+V +F +PGAFTP CS   LPG+    ++L+  +G++E+ C+SVND FVM
Sbjct: 22  INTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSAEELKSKQGVDEIVCVSVNDPFVM 81

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V+LL D +G FT+ + + +    +G G+RS RY  ++++  V    VE
Sbjct: 82  SAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLG-GVRSKRYSLVVENGKVTELNVE 140

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 141 PDGTGLSCS 149


>gi|156373030|ref|XP_001629337.1| predicted protein [Nematostella vectensis]
 gi|156216335|gb|EDO37274.1| predicted protein [Nematostella vectensis]
          Length = 159

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 78/128 (60%), Gaps = 2/128 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+   LF GK+  LFA+PGAFTP CS   LPG+   +D ++ +G++ V C++VND FVM+
Sbjct: 23  VDVASLFKGKKGILFAVPGAFTPGCSKTHLPGYVADFDKIKSKGVDVVACIAVNDPFVMS 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWG+    +  +++L D  GEFT+ + + +        +RS RY  L++D VV+   VE 
Sbjct: 83  AWGEANGCQGKIQMLADVHGEFTKAVDLELDATPFLGNIRSKRYAMLVEDGVVKQLHVEP 142

Query: 149 EGFSDNCA 156
           +G    C+
Sbjct: 143 DGTGLTCS 150


>gi|297184304|gb|ADI20421.1| peroxiredoxin [uncultured alpha proteobacterium EB080_L43F08]
          Length = 162

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 8/138 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +DL AGK++ +F LPGA+T TCS   +P F +  + +R  G++ +YCL+VND  VM +W 
Sbjct: 28  KDLTAGKKIVIFGLPGAYTNTCSTAHMPSFVRNAETIRANGVDAIYCLAVNDVHVMKSWA 87

Query: 94  KKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           K +  ++  + +L D  G +T+++G       VGF  RS RY  +I++ V+ S   EE  
Sbjct: 88  KDMGADVAQIGMLSDSDGSYTKEIGFDFTVPAVGFIGRSQRYSMIIENGVITS-LNEEIE 146

Query: 152 SDNCATDPYEISSPENVL 169
              C     +IS  E +L
Sbjct: 147 RTTC-----DISGGETIL 159


>gi|84515747|ref|ZP_01003108.1| AhpC/TSA family protein [Loktanella vestfoldensis SKA53]
 gi|84510189|gb|EAQ06645.1| AhpC/TSA family protein [Loktanella vestfoldensis SKA53]
          Length = 173

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 85/175 (48%), Gaps = 12/175 (6%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQW----KDVNTQDLFAGKRVFLFALPGAFTPTCS 56
           MI+ +       ++    LPD +         + V   D   G++V +F LPGA+T TC+
Sbjct: 1   MIQREQGAKAMTIKTGDALPDATFLVMGDNGPESVALADKIKGRKVVIFGLPGAYTGTCT 60

Query: 57  DHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI--KNVKLLPDGSGEFTRK 114
              +P F   YD    +G++E+ C+SVND FVM AWG+        + +L D    FT  
Sbjct: 61  TAHVPSFMVTYDAFMAKGVDEIICVSVNDPFVMKAWGESTRAIETGITMLADAESAFTTA 120

Query: 115 MGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
           +GM      VGF  RS RY  L++D VV+    EE     C     EIS+ E +L
Sbjct: 121 IGMDFSAAPVGFVNRSKRYAMLVEDGVVK-ILNEEAGPGQC-----EISAGETLL 169


>gi|114769628|ref|ZP_01447238.1| antioxidant, AhpC/Tsa family protein [alpha proteobacterium
           HTCC2255]
 gi|114549333|gb|EAU52215.1| antioxidant, AhpC/Tsa family protein [alpha proteobacterium
           HTCC2255]
          Length = 162

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 8/138 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +DL AGK++ +F LPGA+T TCS   +P F +  + +R  G++ +YCL+VND  VM +W 
Sbjct: 28  KDLTAGKKIVIFGLPGAYTNTCSTAHMPSFVRNAETIRANGVDAIYCLAVNDVHVMKSWA 87

Query: 94  KKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           K +  ++  + +L D  G +T+++G       VGF  RS RY  +I++ V+ S   EE  
Sbjct: 88  KDMGADVAQIGMLSDSDGSYTKEIGFDFTLPAVGFIGRSQRYSMIIENGVITS-LNEEIE 146

Query: 152 SDNCATDPYEISSPENVL 169
              C     +IS  E +L
Sbjct: 147 RTTC-----DISGGETIL 159


>gi|13476239|ref|NP_107809.1| peroxiredoxin-like protein [Mesorhizobium loti MAFF303099]
 gi|14027000|dbj|BAB53954.1| peroxiredoxin-like protein [Mesorhizobium loti MAFF303099]
          Length = 160

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 84/145 (57%), Gaps = 10/145 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P+  F     T+  DG+KA     + + ++F GK+V LF +PGAFTPTCS++ LPG+ 
Sbjct: 8   KLPEATFK----TMTADGAKA-----ITSAEIFPGKKVVLFGVPGAFTPTCSNNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           + +D +   G++ +  +SVND  VM AW +    ++ +  L DGS +F + +G+      
Sbjct: 59  ENHDAILARGVDTIAVVSVNDVHVMGAWARFTGGEDKILFLADGSADFAKAVGLDNDLSA 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVE 148
            G GLRS R+  ++ D  V +  +E
Sbjct: 119 GGMGLRSKRFSMIVDDGKVTALNIE 143


>gi|92119187|ref|YP_578916.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal
           allergen [Nitrobacter hamburgensis X14]
 gi|91802081|gb|ABE64456.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal
           allergen [Nitrobacter hamburgensis X14]
          Length = 161

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 5/141 (3%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           ++V   LPD +      D     +T D+F G++V LFA+PGA+T TC    LP       
Sbjct: 3   IKVGDRLPDATFRIMTDDGVQVKSTGDIFKGRKVALFAVPGAYTGTCHKQHLPSIFLSAR 62

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFG 127
            ++ +G++E+  +SVND FVMN W +  + +N    L DG+ +F R +GM       G G
Sbjct: 63  AIKDKGVDEIAIVSVNDVFVMNTWKRDTDQRNEATFLADGNADFARAIGMEFDASEKGLG 122

Query: 128 LRSWRYGALIKDMVVESWFVE 148
           +RS RY  L++D VV++  +E
Sbjct: 123 IRSKRYSMLVEDGVVKTLNLE 143


>gi|195631536|gb|ACG36663.1| peroxiredoxin-5 [Zea mays]
          Length = 193

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 82/140 (58%), Gaps = 7/140 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F GK+V +F LPGA+T  CS   +P ++K  D L+ +GI+ V C++VND +V++ W 
Sbjct: 60  KDIFYGKKVVIFGLPGAYTGVCSQAHVPSYKKXIDKLKAKGIDSVICVAVNDPYVLDGWA 119

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           KKL+ K+ ++   D  G F + + + +       G RS R+ A + D  ++S+ VEE  S
Sbjct: 120 KKLDAKDTIEFYGDFDGSFHKSLDLEIDLSAALLGRRSHRWSAFVDDGKIKSFNVEEAPS 179

Query: 153 DNCATDPYEISSPENVLKVI 172
           D      +++S  E +L  I
Sbjct: 180 D------FKVSGAEVILDQI 193


>gi|319784688|ref|YP_004144164.1| redoxin [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317170576|gb|ADV14114.1| Redoxin domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 160

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 83/145 (57%), Gaps = 10/145 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P V F     T+  DG+K      +   ++F GK+V LF +PGAFTPTCS++ LPG+ 
Sbjct: 8   KLPDVTFK----TMTDDGAKP-----ITGAEIFPGKKVVLFGVPGAFTPTCSNNHLPGYL 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           + +D +   G++ +  +SVND  VM AW +    ++ +  L DGSG+F + +G+      
Sbjct: 59  ENHDAILARGVDTIAVVSVNDVHVMGAWARFTGGESKILFLADGSGDFAKAVGLDNDLSA 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVE 148
            G GLRS R+  ++ D  V +  VE
Sbjct: 119 SGMGLRSKRFSMIVDDGKVTALNVE 143


>gi|222147807|ref|YP_002548764.1| peroxiredoxin [Agrobacterium vitis S4]
 gi|221734795|gb|ACM35758.1| peroxiredoxin [Agrobacterium vitis S4]
          Length = 161

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 76/121 (62%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +++T+DLF  K+V LFA+PGAFTPTC+ + LPG+ +  D L  +G++E+  LSVND  VM
Sbjct: 24  EISTEDLFKDKKVVLFAVPGAFTPTCTLNHLPGYLEHRDALLAKGVDEIAVLSVNDWHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D    F++ +G+ +       G+RS RY  L+++ VV+S  +E
Sbjct: 84  GAWAQHSGGMGKIHFLADWDASFSKALGLDMDLSAGALGVRSKRYSMLVENGVVKSLDIE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|242014300|ref|XP_002427829.1| peroxiredoxin-5, putative [Pediculus humanus corporis]
 gi|212512298|gb|EEB15091.1| peroxiredoxin-5, putative [Pediculus humanus corporis]
          Length = 152

 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 77/128 (60%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           +N  DL   K+V +F +PGAFTP+CS + LPG+     +LR +G++E+ C+SVND FVM 
Sbjct: 19  INMADLCKNKKVVVFGVPGAFTPSCSRNHLPGYLHRQAELRKKGVDEIICISVNDTFVME 78

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK  E    +++  D  G +T+ +G+      +G G+RS RY  ++   +V    VE 
Sbjct: 79  AWGKLYEADGKIRMFADPEGTYTKTIGLDFLVPKLG-GIRSKRYSMVVDKGIVTHISVEP 137

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 138 DGVGLSCS 145


>gi|332559367|ref|ZP_08413689.1| redoxin domain-containing protein [Rhodobacter sphaeroides WS8N]
 gi|332277079|gb|EGJ22394.1| redoxin domain-containing protein [Rhodobacter sphaeroides WS8N]
          Length = 162

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V   +   G+ V +FA+PGAFTPTC    +P F +  D    +G++E+ C+SVND FV
Sbjct: 23  EQVQLSERLKGRNVVIFAVPGAFTPTCHSAHVPSFIRTKDQFAGKGVDEIICVSVNDPFV 82

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWG+        + +L D  G FTR +G+      VG   RS RY    KD VV    
Sbjct: 83  MKAWGESTGASGAGITMLSDADGAFTRALGLAFDAPPVGLIGRSRRYALQAKDGVVAVIH 142

Query: 147 VEE 149
           +EE
Sbjct: 143 LEE 145


>gi|163760343|ref|ZP_02167425.1| hypothetical protein HPDFL43_03531 [Hoeflea phototrophica DFL-43]
 gi|162282294|gb|EDQ32583.1| hypothetical protein HPDFL43_03531 [Hoeflea phototrophica DFL-43]
          Length = 161

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 74/121 (61%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +V + DLF GK+V +FA+PGAFTPTC  + LPG+ +  D +  +G++E+  +SVNDAFVM
Sbjct: 24  EVQSGDLFGGKKVVVFAVPGAFTPTCHLNHLPGYLENRDAILAKGVDEIAVISVNDAFVM 83

Query: 90  NAWGKKLE-IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW K       ++ L D    FT+ +GM +       G+RS RY  +++D  V +  +E
Sbjct: 84  AAWEKATNGAGKLRYLSDWDASFTKAVGMEMDLSAGTLGVRSKRYSMIVEDGKVTALNIE 143

Query: 149 E 149
           +
Sbjct: 144 D 144


>gi|227821116|ref|YP_002825086.1| peroxiredoxin-like protein [Sinorhizobium fredii NGR234]
 gi|227340115|gb|ACP24333.1| peroxiredoxin-like protein [Sinorhizobium fredii NGR234]
          Length = 161

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 73/121 (60%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +V T  LF GKRV LFA+PGAFTPTCS + LPG+ +  D +   G++++  ++VND  VM
Sbjct: 24  EVTTDQLFKGKRVVLFAVPGAFTPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDLHVM 83

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW      +  +  L D +  FT+ +G+ +       G+RS RY  L++D VV++  VE
Sbjct: 84  GAWATSSGGMGKIHFLSDWNAAFTKALGLDIDLSAGTLGIRSKRYSMLVEDGVVKALNVE 143

Query: 149 E 149
           +
Sbjct: 144 D 144


>gi|209886440|ref|YP_002290297.1| hybrid peroxiredoxin hyPrx5 [Oligotropha carboxidovorans OM5]
 gi|209874636|gb|ACI94432.1| hybrid peroxiredoxin hyPrx5 [Oligotropha carboxidovorans OM5]
          Length = 161

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 71/118 (60%), Gaps = 1/118 (0%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
            T D+F GK+V LFA+PGA+T TC    +P   +    ++ +GI+ +  ++VND FVMNA
Sbjct: 26  TTDDIFKGKKVALFAVPGAYTGTCHKMHMPSVFQSAAAIKAKGIDTIAVVAVNDVFVMNA 85

Query: 92  WGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           W +  +  N  + L DG+ EFT+  G+       G GLRS RY  L++D VV+ + +E
Sbjct: 86  WKRDTDFNNEAIYLADGNAEFTKAAGLDFDGSGHGLGLRSKRYSMLVEDGVVKKFNLE 143


>gi|194702068|gb|ACF85118.1| unknown [Zea mays]
 gi|195605920|gb|ACG24790.1| peroxiredoxin-5 [Zea mays]
          Length = 193

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 82/140 (58%), Gaps = 7/140 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F GK+V +F LPGA+T  CS   +P ++K  D L+ +GI+ V C++VND +V++ W 
Sbjct: 60  KDIFYGKKVVIFGLPGAYTGVCSQAHVPSYKKNIDKLKAKGIDSVICVAVNDPYVLDGWA 119

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           KKL+ K+ ++   D  G F + + + +       G RS R+ A + D  ++S+ VEE  S
Sbjct: 120 KKLDAKDTIEFYGDFDGSFHKSLDLEIDLSAALLGRRSHRWSAFVDDGKIKSFNVEEAPS 179

Query: 153 DNCATDPYEISSPENVLKVI 172
           D      +++S  E +L  I
Sbjct: 180 D------FKVSGAEVILDQI 193


>gi|322796535|gb|EFZ19009.1| hypothetical protein SINV_03933 [Solenopsis invicta]
          Length = 187

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN   + A K++ +F +PGAFTP CS   LPG+    D+L+ +GI E++C+SVND FVM 
Sbjct: 54  VNLAQVAAQKKIIIFGVPGAFTPGCSKTHLPGYVTKADELKSKGISEIFCISVNDPFVMA 113

Query: 91  AWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWGK+      V++L D   EFT  M + V    +G G RS RY  ++++  V+   VE
Sbjct: 114 AWGKEHGATGKVRMLADPKSEFTDAMDLGVDLAVLG-GKRSKRYSMIVENGTVKELNVE 171


>gi|242056949|ref|XP_002457620.1| hypothetical protein SORBIDRAFT_03g010530 [Sorghum bicolor]
 gi|241929595|gb|EES02740.1| hypothetical protein SORBIDRAFT_03g010530 [Sorghum bicolor]
          Length = 193

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 83/140 (59%), Gaps = 7/140 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F GK+V +F LPGA+T  CS   +P ++K  D L+ +GI+ V C++VND +V+N W 
Sbjct: 60  KDIFYGKKVVIFGLPGAYTGVCSQAHVPSYKKNIDKLKAKGIDSVICVAVNDPYVLNGWA 119

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KLE K+ ++   D  G F + + + +       G RS R+ A + +  ++S+ VEE  S
Sbjct: 120 EKLEAKDAIEFYGDFDGSFHKSLDLEIDLSAALLGRRSHRWSAFVDNGKIKSFNVEEVPS 179

Query: 153 DNCATDPYEISSPENVLKVI 172
           D      +++SS E +L  I
Sbjct: 180 D------FKVSSAEVILDQI 193


>gi|316935789|ref|YP_004110771.1| redoxin domain-containing protein [Rhodopseudomonas palustris DX-1]
 gi|315603503|gb|ADU46038.1| Redoxin domain protein [Rhodopseudomonas palustris DX-1]
          Length = 161

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 74/119 (62%), Gaps = 3/119 (2%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPG-FEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
            T D+F GK+V LFA+PGA+T TC    LP  F   Y  L+ +G++ +  +SVNDAFVMN
Sbjct: 26  TTDDVFKGKKVALFAVPGAYTGTCHKMHLPSIFLNAYA-LKDKGVDTIAIVSVNDAFVMN 84

Query: 91  AWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +  + ++  + L DG+ EFT+ +GM +     G G RS RY  L+ D VV++  +E
Sbjct: 85  AWKRDTDQRDEAIFLADGNAEFTKAIGMEMDGSGFGLGTRSLRYSMLVDDGVVKTLNLE 143


>gi|149915469|ref|ZP_01903996.1| antioxidant, AhpC/Tsa family, putative [Roseobacter sp. AzwK-3b]
 gi|149810758|gb|EDM70599.1| antioxidant, AhpC/Tsa family, putative [Roseobacter sp. AzwK-3b]
          Length = 162

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V   D  AG++V +FA+PGAFTPTC    +P F +  D    +G++E+ C+SVND FV
Sbjct: 23  ESVTLSDKTAGRKVVIFAVPGAFTPTCHSAHVPSFMRTKDQFAEKGVDEIICISVNDPFV 82

Query: 89  MNAWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWGK     +  + +L D    FT+ +GM       G   RS RY  L++D  V    
Sbjct: 83  MRAWGKDTGAADAGITMLGDPDSAFTKAVGMDFDAPPAGLVARSKRYAMLVEDGTVTVLH 142

Query: 147 VEE 149
            EE
Sbjct: 143 QEE 145


>gi|6166493|gb|AAF04856.1|AF197952_1 thioredoxin peroxidase PMP20 [Homo sapiens]
          Length = 214

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 76  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 135

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 136 EWGRATKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 195

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 196 EPDGTGLTCSLAPNIIS 212


>gi|85714342|ref|ZP_01045330.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/
           Malallergen [Nitrobacter sp. Nb-311A]
 gi|85698789|gb|EAQ36658.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/
           Malallergen [Nitrobacter sp. Nb-311A]
          Length = 161

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 78/142 (54%), Gaps = 5/142 (3%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           ++V   LPD +     +D     NT D+F  ++V LFA+PGA+T TC    LP       
Sbjct: 3   IKVGDRLPDATFRIMTEDGVQTKNTNDIFKDRKVALFAVPGAYTGTCHKQHLPSIFASAR 62

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFG 127
            ++ +G+ E+  +SVND FV+NAW +  + +N    L DG+ +F + + M       G G
Sbjct: 63  AIKDKGVNEIAIVSVNDVFVLNAWKRDTDQRNEATFLADGNADFAKALDMTFDGSEKGLG 122

Query: 128 LRSWRYGALIKDMVVESWFVEE 149
           +RS RY  L++D VV+   VE+
Sbjct: 123 IRSKRYSMLVEDGVVKKLNVED 144


>gi|85704564|ref|ZP_01035666.1| AhpC/TSA family protein [Roseovarius sp. 217]
 gi|85670972|gb|EAQ25831.1| AhpC/TSA family protein [Roseovarius sp. 217]
          Length = 162

 Score = 95.5 bits (236), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 84/159 (52%), Gaps = 10/159 (6%)

Query: 16  ATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI 75
           AT+L  G K  +  D+  + L AG++V +FA+PGA+TPTCS   +P F +   +   +G+
Sbjct: 12  ATLLRMGEKGPEGVDL--KSLTAGRKVVIFAVPGAYTPTCSSAHVPSFVRTKAEFDAKGV 69

Query: 76  EEVYCLSVNDAFVMNAWGKKLEIKNVKL--LPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
           +E+ CLSVND FVM AWG+        L  L D    FT+ +GM       G   RS RY
Sbjct: 70  DEIVCLSVNDPFVMKAWGEATGATEAGLTMLADPESAFTKSIGMEFDAPPAGLLGRSKRY 129

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
             +++D  V +    E     C     EI++ E++L  I
Sbjct: 130 AMVVEDGTV-TVLHAEASPGTC-----EITAGESLLAAI 162


>gi|20139172|sp|Q9GLW9|PRDX5_PAPHA RecName: Full=Peroxiredoxin-5, mitochondrial; AltName:
           Full=Peroxiredoxin V; Short=Prx-V; AltName:
           Full=Thioredoxin reductase; Flags: Precursor
 gi|10305334|gb|AAG13451.2|AF110734_1 peroxiredoxin 5 [Papio hamadryas]
          Length = 215

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 83/137 (60%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ + CLSVNDAFV  
Sbjct: 77  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVLACLSVNDAFVTG 136

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  +++  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 137 EWGRAHKVEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 196

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 197 EPDGTGLTCSLAPSIIS 213


>gi|195996401|ref|XP_002108069.1| hypothetical protein TRIADDRAFT_49711 [Trichoplax adhaerens]
 gi|190588845|gb|EDV28867.1| hypothetical protein TRIADDRAFT_49711 [Trichoplax adhaerens]
          Length = 159

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 77/130 (59%), Gaps = 2/130 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
            +V+  +L A K+  +F +PGAFTP C    LPG+   YD +  +G++ + C+SVNDAFV
Sbjct: 21  NNVDIAELVANKKAIIFGVPGAFTPGCHRSHLPGYVADYDKIVAKGVDIIICVSVNDAFV 80

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           ++AWGK +  +N V +L D    FT+ +GM +    +   +RS RY  ++ D V+ +  V
Sbjct: 81  VDAWGKSVGAENKVVMLADPVAAFTKAIGMDLDATPILGNIRSKRYSMILSDGVLTNLNV 140

Query: 148 E-EGFSDNCA 156
           E +G    C+
Sbjct: 141 EPDGTGLTCS 150


>gi|168059448|ref|XP_001781714.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162666798|gb|EDQ53443.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 170

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 72/117 (61%), Gaps = 1/117 (0%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           DL   KRV  F +PGAFTPTCS   +PGF +   ++   GI E+ C++VND FV+  W K
Sbjct: 29  DLVREKRVVFFGVPGAFTPTCSLKHVPGFIERAAEILDRGINEIVCITVNDPFVVKEWEK 88

Query: 95  KL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
              E K+V+ L DGS  +T+K+G+ +   + G G+RS RY  +I D VV    +EEG
Sbjct: 89  TYPENKHVRFLCDGSAIWTKKIGLELDLYDRGMGVRSRRYSLMICDTVVRIANIEEG 145


>gi|325292163|ref|YP_004278027.1| peroxiredoxin protein [Agrobacterium sp. H13-3]
 gi|325060016|gb|ADY63707.1| peroxiredoxin protein [Agrobacterium sp. H13-3]
          Length = 161

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 70/121 (57%), Gaps = 1/121 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +  T  LF GK V LFA+PGAFTPTCS + LPG+ +  D +  + ++++  +SVND  VM
Sbjct: 24  ETTTDALFGGKTVVLFAVPGAFTPTCSLNHLPGYLENRDAILAKSVDDIAVVSVNDWHVM 83

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            AW +    +  +  L D    FT+ +G+       G G+RS RY  L+KD VV S  VE
Sbjct: 84  GAWAQSSGGQGKIHFLADWDAAFTKALGLDADLSGGGLGVRSKRYSMLVKDGVVTSLNVE 143

Query: 149 E 149
           E
Sbjct: 144 E 144


>gi|83953272|ref|ZP_00961994.1| AhpC/TSA family protein [Sulfitobacter sp. NAS-14.1]
 gi|83842240|gb|EAP81408.1| AhpC/TSA family protein [Sulfitobacter sp. NAS-14.1]
          Length = 169

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 71/138 (51%), Gaps = 8/138 (5%)

Query: 10  VFHMRVAT--VLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGF 63
           V HM ++    LPD +      D    V   D   G++V +FA+PGA+TPTC    +P F
Sbjct: 5   VTHMTISQGDTLPDATLVQMGPDGPQPVQMADKLKGRKVVVFAVPGAYTPTCDSAHVPSF 64

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYK 121
            +  D    +G++E+ C+S ND FVM AWGK        + +L D +  FT+ +GM    
Sbjct: 65  VRTKDQFDAKGVDEIICVSCNDPFVMAAWGKSTGATAAGITMLADANSAFTKAIGMEFSA 124

Query: 122 DNVGFGLRSWRYGALIKD 139
           +  G   RS RY  L+ D
Sbjct: 125 EPAGLISRSKRYAMLVDD 142


>gi|148252528|ref|YP_001237113.1| putative peroxiredoxin [Bradyrhizobium sp. BTAi1]
 gi|146404701|gb|ABQ33207.1| Putative peroxiredoxin [Bradyrhizobium sp. BTAi1]
          Length = 145

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 81/140 (57%), Gaps = 9/140 (6%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPG-FEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
            T D+F GK+V LFA+PGA+T TC    LP  F   Y  L+ +G++ +  +SVNDAFVMN
Sbjct: 10  TTDDIFKGKKVALFAVPGAYTGTCHKMHLPSIFLNAYA-LKGKGVDTIAIISVNDAFVMN 68

Query: 91  AWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  + ++  + L DG+ +FT+ +GM +     G G+RS RY  L++D VV    +E 
Sbjct: 69  AWKRDTDQRDEAVFLADGNADFTKAIGMELDASGHGLGIRSKRYSMLVEDGVVTKLNLE- 127

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A    E+S  + +L
Sbjct: 128 -----AAPGKVEVSGGDTLL 142


>gi|297688285|ref|XP_002821616.1| PREDICTED: peroxiredoxin-5, mitochondrial-like isoform 1 [Pongo
           abelii]
 gi|6563212|gb|AAF17200.1|AF112212_1 putative peroxisomal antioxidant enzyme [Homo sapiens]
 gi|6746355|gb|AAF27531.1|AF124993_1 peroxisomal membrane protein 20 [Homo sapiens]
 gi|6523289|emb|CAB62210.1| human thiol peroxidase homologous protein [Homo sapiens]
          Length = 162

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 24  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 83

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 84  EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 143

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 144 EPDGTGLTCSLAPNIIS 160


>gi|46015018|pdb|1OC3|A Chain A, Human Peroxiredoxin 5
 gi|46015019|pdb|1OC3|B Chain B, Human Peroxiredoxin 5
 gi|46015020|pdb|1OC3|C Chain C, Human Peroxiredoxin 5
 gi|197304977|pdb|2VL2|C Chain C, Oxidized And Reduced Forms Of Human Peroxiredoxin 5
 gi|197304978|pdb|2VL3|A Chain A, Oxidized And Reduced Forms Of Human Peroxiredoxin 5
 gi|197304979|pdb|2VL3|B Chain B, Oxidized And Reduced Forms Of Human Peroxiredoxin 5
 gi|197304980|pdb|2VL3|C Chain C, Oxidized And Reduced Forms Of Human Peroxiredoxin 5
          Length = 172

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 34  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 93

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 94  EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 153

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 154 EPDGTGLTCSLAPNIIS 170


>gi|15826629|pdb|1HD2|A Chain A, Human Peroxiredoxin 5
 gi|16975155|pdb|1H4O|A Chain A, Monoclinic Form Of Human Peroxiredoxin 5
 gi|16975156|pdb|1H4O|B Chain B, Monoclinic Form Of Human Peroxiredoxin 5
 gi|16975157|pdb|1H4O|C Chain C, Monoclinic Form Of Human Peroxiredoxin 5
 gi|16975158|pdb|1H4O|D Chain D, Monoclinic Form Of Human Peroxiredoxin 5
 gi|16975159|pdb|1H4O|E Chain E, Monoclinic Form Of Human Peroxiredoxin 5
 gi|16975160|pdb|1H4O|F Chain F, Monoclinic Form Of Human Peroxiredoxin 5
 gi|16975161|pdb|1H4O|G Chain G, Monoclinic Form Of Human Peroxiredoxin 5
 gi|16975162|pdb|1H4O|H Chain H, Monoclinic Form Of Human Peroxiredoxin 5
          Length = 161

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 23  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 83  EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 142

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 143 EPDGTGLTCSLAPNIIS 159


>gi|254491829|ref|ZP_05105008.1| Redoxin superfamily [Methylophaga thiooxidans DMS010]
 gi|224463307|gb|EEF79577.1| Redoxin superfamily [Methylophaga thiooxydans DMS010]
          Length = 143

 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 69/110 (62%), Gaps = 1/110 (0%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK 99
           K + +F +PGA+TP CS   LPGF +  D ++  G +E++C++VNDAFVM +WG++ +  
Sbjct: 15  KTIVIFGVPGAYTPLCSAQHLPGFVEHADAIKAAGADEIWCMAVNDAFVMASWGRENQAT 74

Query: 100 N-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
             V+++ DGS E+ + +G+       G G+R +R+  ++KD  V    VE
Sbjct: 75  GKVRMMADGSAEYAKALGLDRDLTGGGMGVRCYRFAMIVKDGTVTYLGVE 124


>gi|302148804|pdb|3MNG|A Chain A, Wild Type Human Prxv With Dtt Bound As A Competitive
           Inhibitor
          Length = 173

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 35  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 94

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 95  EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 154

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 155 EPDGTGLTCSLAPNIIS 171


>gi|6912238|ref|NP_036226.1| peroxiredoxin-5, mitochondrial isoform a precursor [Homo sapiens]
 gi|6103724|gb|AAF03750.1|AF110731_1 antioxidant enzyme B166 [Homo sapiens]
 gi|8745394|gb|AAF78899.1|AF231705_1 Alu co-repressor 1 [Homo sapiens]
 gi|9802048|gb|AAF99605.1|AF242525_1 hypothetical protein SBBI10 [Homo sapiens]
 gi|48146523|emb|CAG33484.1| PRDX5 [Homo sapiens]
 gi|77864624|gb|ABB05181.1| peroxiredoxin 5 [Homo sapiens]
 gi|83405871|gb|AAI10984.1| Peroxiredoxin 5 [Homo sapiens]
 gi|109731135|gb|AAI13726.1| Peroxiredoxin 5 [Homo sapiens]
 gi|109731385|gb|AAI13724.1| Peroxiredoxin 5 [Homo sapiens]
 gi|313882794|gb|ADR82883.1| peroxiredoxin 5 [synthetic construct]
          Length = 214

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 76  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 135

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 136 EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 195

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 196 EPDGTGLTCSLAPNIIS 212


>gi|317373539|sp|P30044|PRDX5_HUMAN RecName: Full=Peroxiredoxin-5, mitochondrial; AltName: Full=Alu
           corepressor 1; AltName: Full=Antioxidant enzyme B166;
           Short=AOEB166; AltName: Full=Liver tissue 2D-page spot
           71B; AltName: Full=PLP; AltName: Full=Peroxiredoxin V;
           Short=Prx-V; AltName: Full=Peroxisomal antioxidant
           enzyme; AltName: Full=TPx type VI; AltName:
           Full=Thioredoxin peroxidase PMP20; AltName:
           Full=Thioredoxin reductase; Flags: Precursor
          Length = 214

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 76  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 135

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 136 EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 195

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 196 EPDGTGLTCSLAPNIIS 212


>gi|297688287|ref|XP_002821617.1| PREDICTED: peroxiredoxin-5, mitochondrial-like isoform 2 [Pongo
           abelii]
          Length = 216

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 78  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 137

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 138 EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 197

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 198 EPDGTGLTCSLAPNIIS 214


>gi|114638293|ref|XP_001164621.1| PREDICTED: hypothetical protein LOC743467 isoform 5 [Pan
           troglodytes]
 gi|332836563|ref|XP_003313107.1| PREDICTED: hypothetical protein LOC743467 [Pan troglodytes]
          Length = 214

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 76  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 135

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 136 EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 195

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 196 EPDGTGLTCSLAPNIIS 212


>gi|195055428|ref|XP_001994621.1| GH17340 [Drosophila grimshawi]
 gi|193892384|gb|EDV91250.1| GH17340 [Drosophila grimshawi]
          Length = 157

 Score = 94.7 bits (234), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 79/129 (61%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE-GIEEVYCLSVNDAFVM 89
           +NT DL  GK+V +F +PGAFTP CS   LPG+    D L+ E G++E+ C+SVND FVM
Sbjct: 22  INTADLTNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADSLKGEQGVDEIVCVSVNDPFVM 81

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V++L D SG     + + +    +G G+RS RY  ++++  V+   VE
Sbjct: 82  SAWGKQHGADGKVRMLADPSGALATALDVNIDLPPLG-GVRSKRYSMVVQNGEVKELNVE 140

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 141 PDGTGLSCS 149


>gi|149203460|ref|ZP_01880430.1| Redoxin [Roseovarius sp. TM1035]
 gi|149143293|gb|EDM31332.1| Redoxin [Roseovarius sp. TM1035]
          Length = 185

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 83/159 (52%), Gaps = 10/159 (6%)

Query: 16  ATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI 75
           AT+L  G K  +  D+  + L AG++V +FA+PGA+TPTCS   +P F +        G+
Sbjct: 35  ATLLKLGEKGPEAVDL--KSLTAGRKVVIFAVPGAYTPTCSAAHVPSFIRTKAQFDAAGV 92

Query: 76  EEVYCLSVNDAFVMNAWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
           +E+ C+SVND FVM AWG+        + +L D    FT+ +G+       G   RS RY
Sbjct: 93  DEIICVSVNDPFVMKAWGEATGATEAGITMLADAESAFTKAIGLDFDAPPAGLLARSKRY 152

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
              ++D  V    VEE     C     E+++ E++L  +
Sbjct: 153 AMAVEDGTVTVLHVEES-PGTC-----EVTAGESLLAAM 185


>gi|77464478|ref|YP_353982.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Rhodobacter
           sphaeroides 2.4.1]
 gi|77388896|gb|ABA80081.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Rhodobacter
           sphaeroides 2.4.1]
          Length = 162

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V   +   G+ V +FA+PGAFTPTC    +P F +  D    +G++E+ C+SVND FV
Sbjct: 23  EQVQLSERLKGRNVVIFAVPGAFTPTCHSAHVPSFIRTKDQFAGKGVDEIICVSVNDPFV 82

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWG+        + +L D  G FT+ +G+      VG   RS RY    KD VV    
Sbjct: 83  MKAWGESTGASGAGITMLADADGAFTKALGLAFDAPPVGLIGRSRRYALQAKDGVVAVIH 142

Query: 147 VEE 149
           +EE
Sbjct: 143 LEE 145


>gi|79320786|ref|NP_001031239.1| TPX1 (thioredoxin-dependent peroxidase 1); antioxidant/
           oxidoreductase [Arabidopsis thaliana]
 gi|332196327|gb|AEE34448.1| peroxiredoxin-2B [Arabidopsis thaliana]
          Length = 121

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 66/101 (65%), Gaps = 6/101 (5%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           + V  V+PDG+ +F     Q +  +   L AGK+V LF +PGAFTPTCS   +PGF +  
Sbjct: 4   IAVGDVVPDGTISFFDENDQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKA 63

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDG 107
           ++L+ +G++E+ C SVND FVM AWGK   E K+VK + DG
Sbjct: 64  EELKSKGVDEIICFSVNDPFVMKAWGKTYPENKHVKFVADG 104


>gi|126463318|ref|YP_001044432.1| redoxin domain-containing protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104982|gb|ABN77660.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 162

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V   +   G+ V +FA+PGAFTPTC    +P F +  D    +G++E+ C+SVND FV
Sbjct: 23  EQVQLSERLKGRNVVIFAVPGAFTPTCHSAHVPSFIRTKDQFAGKGVDEIICVSVNDPFV 82

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWG+        + +L D  G FT+ +G+      VG   RS RY    KD VV    
Sbjct: 83  MKAWGESTGASGAGITMLSDADGAFTKALGLAFDAPPVGLIGRSRRYALQAKDGVVAVIH 142

Query: 147 VEE 149
           +EE
Sbjct: 143 LEE 145


>gi|221640370|ref|YP_002526632.1| Thiol peroxidase [Rhodobacter sphaeroides KD131]
 gi|221161151|gb|ACM02131.1| Thiol peroxidase [Rhodobacter sphaeroides KD131]
          Length = 162

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V   +   G+ V +FA+PGAFTPTC    +P F +  D    +G++E+ C+SVND FV
Sbjct: 23  EQVQLSERLKGRNVVIFAVPGAFTPTCHSAHVPSFIRTKDQFAGKGVDEIICVSVNDPFV 82

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWG+        + +L D  G FT+ +G+      VG   RS RY    KD VV    
Sbjct: 83  MKAWGESTGASGAGITMLSDADGTFTKALGLAFDAPPVGLIGRSRRYALQAKDGVVAVIH 142

Query: 147 VEE 149
           +EE
Sbjct: 143 LEE 145


>gi|296278281|pdb|2WFC|A Chain A, Crystal Structure Of Peroxiredoxin 5 From Arenicola Marina
 gi|296278282|pdb|2WFC|B Chain B, Crystal Structure Of Peroxiredoxin 5 From Arenicola Marina
 gi|296278283|pdb|2WFC|C Chain C, Crystal Structure Of Peroxiredoxin 5 From Arenicola Marina
 gi|296278284|pdb|2WFC|D Chain D, Crystal Structure Of Peroxiredoxin 5 From Arenicola Marina
          Length = 167

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 80/135 (59%), Gaps = 2/135 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LFAGK+  LFA+PGAFTP  S   LPG+ +    +  +G++ + C++VND+FVM+
Sbjct: 23  VNMAELFAGKKGVLFAVPGAFTPGSSKTHLPGYVEQAAAIHGKGVDIIACMAVNDSFVMD 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AWGK     + V++L D  G FT+ + M +    V   +RS RY  +I+D VV    VE 
Sbjct: 83  AWGKAHGADDKVQMLADPGGAFTKAVDMELDLSAVLGNVRSKRYSLVIEDGVVTKVNVEP 142

Query: 149 EGFSDNCATDPYEIS 163
           +G    C+  P  +S
Sbjct: 143 DGKGLTCSLAPNILS 157


>gi|154246537|ref|YP_001417495.1| redoxin domain-containing protein [Xanthobacter autotrophicus Py2]
 gi|154160622|gb|ABS67838.1| Redoxin domain protein [Xanthobacter autotrophicus Py2]
          Length = 161

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 68/119 (57%), Gaps = 1/119 (0%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
            T ++F GK+V LFA+PGAFTPTC  + LPG+    D ++ +G++ +  +SVND FVM A
Sbjct: 26  TTDEIFKGKKVVLFAVPGAFTPTCHKNHLPGYVHEADAIKAKGVDAIAVVSVNDPFVMGA 85

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           W K       +  L D    F+  + +       G G+RS RY  +++D VV S  VE+
Sbjct: 86  WEKASGADGKIVFLADPDAAFSTALDLTFDGSAAGLGVRSKRYSMVVEDGVVTSLNVED 144


>gi|146343358|ref|YP_001208406.1| putative peroxiredoxin [Bradyrhizobium sp. ORS278]
 gi|146196164|emb|CAL80191.1| Putative peroxiredoxin [Bradyrhizobium sp. ORS278]
          Length = 145

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 80/140 (57%), Gaps = 9/140 (6%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPG-FEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
            T D+F GK+V LFA+PGA+T TC    LP  F   Y  L+ +G++ +  +SVNDAFVMN
Sbjct: 10  TTDDIFKGKKVALFAVPGAYTGTCHKMHLPSIFLNAYA-LKDKGVDTIAIVSVNDAFVMN 68

Query: 91  AWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           AW +  + ++  + L DG+ EFT+ +GM +     G G+RS RY  L++D  V    +E 
Sbjct: 69  AWKRDTDQRDEAVFLADGNAEFTKAIGMELDASGAGLGIRSKRYSMLVEDGKVTKLNLE- 127

Query: 150 GFSDNCATDPYEISSPENVL 169
                 A    E+S  + +L
Sbjct: 128 -----AAPGKVEVSGGDTLL 142


>gi|119594653|gb|EAW74247.1| hCG2016877, isoform CRA_c [Homo sapiens]
          Length = 420

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 282 VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 341

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 342 EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 401

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 402 EPDGTGLTCSLAPNIIS 418


>gi|170096060|ref|XP_001879250.1| peroxiredoxin [Laccaria bicolor S238N-H82]
 gi|164645618|gb|EDR09865.1| peroxiredoxin [Laccaria bicolor S238N-H82]
          Length = 165

 Score = 94.4 bits (233), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 86/148 (58%), Gaps = 10/148 (6%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDL----FAGKRVFLFALPGAFTPTCSDHQLPGF 63
           ++V   +P+GS  +     + +D  T  L    + GK+V LF++PGAFTPTC  + LPG+
Sbjct: 3   LKVGDTIPEGSFKYIPYTSELEDSVTTALSTNEWKGKKVVLFSVPGAFTPTCHANHLPGY 62

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKD 122
            + YD  + +G++ +  ++ NDAFVM+ WG+   +K+ +  L D   +++  +G+     
Sbjct: 63  LQNYDAFKAKGVDVIAVVAANDAFVMSGWGRFEGVKDKILTLTDTDAKWSASLGLDKDLS 122

Query: 123 NVGFGLRSWRYGALIKDMVVESWFVEEG 150
             G G R+WR+  +I D+VV+   VE G
Sbjct: 123 AAGLGHRTWRFAIVIDDLVVKYIGVEPG 150


>gi|294084678|ref|YP_003551436.1| Redoxin domain-containing protein [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664251|gb|ADE39352.1| Redoxin domain protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 161

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 82/145 (56%), Gaps = 13/145 (8%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           +T D F   RV +FA+PGAFTPTCS   +P + +  D L+  GI+++ CLS+NDA VM+A
Sbjct: 26  STDDYFKDCRVVMFAVPGAFTPTCSARHMPSYLEHADALKQAGIDKIACLSINDAHVMHA 85

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG--FGLRSWRYGALIKDMVVESWFVE 148
           WG+  +    + ++ D  G F+R +G+ V   N+G   G R+ R   ++ + +V    +E
Sbjct: 86  WGETNQADGIIDMIADMDGSFSRALGIEV---NMGAILGKRATRCAMIVDNGLVTHVLME 142

Query: 149 EGFSDNCATDPYEISSPENVLKVIR 173
           E          + +SS ENVL  + 
Sbjct: 143 E-------PGEFVVSSAENVLATLN 160


>gi|192293108|ref|YP_001993713.1| Redoxin domain protein [Rhodopseudomonas palustris TIE-1]
 gi|192286857|gb|ACF03238.1| Redoxin domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 161

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 83/142 (58%), Gaps = 7/142 (4%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG-FEKIY 67
           ++V   LPD       +D      T D+F GK+V LFA+PGA+T TC    LP  F   Y
Sbjct: 3   IKVGDRLPDAQFRVMTEDGVQVKTTDDIFKGKKVALFAVPGAYTGTCHKMHLPSIFLNAY 62

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDNVGF 126
             ++ +G++ +  +SVNDAFVM+AW +  + +N  + L DG+ +FT+ +GM +     G 
Sbjct: 63  A-MKDKGVDTIAIVSVNDAFVMSAWKRDTDQRNEAIFLGDGNADFTKAIGMEMDGSGFGL 121

Query: 127 GLRSWRYGALIKDMVVESWFVE 148
           G RS RY  L++D VV++  +E
Sbjct: 122 GTRSLRYSMLVEDGVVKTLNLE 143


>gi|20139171|sp|Q9GLW7|PRDX5_CERAE RecName: Full=Peroxiredoxin-5, mitochondrial; AltName:
           Full=Peroxiredoxin V; Short=Prx-V; AltName:
           Full=Thioredoxin reductase; Flags: Precursor
 gi|10305338|gb|AAG13453.2|AF110736_1 peroxiredoxin 5 [Chlorocebus aethiops]
          Length = 215

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ + CLSVNDAFV  
Sbjct: 77  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVLACLSVNDAFVTG 136

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 137 EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 196

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 197 EPDGTGLTCSLAPSIIS 213


>gi|332374822|gb|AEE62552.1| unknown [Dendroctonus ponderosae]
          Length = 189

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 77/128 (60%), Gaps = 3/128 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +L  GK+V +FA+PGAFTP CS   LPG+     +L+ +GI ++ C+SVND FVM 
Sbjct: 56  VNLGELTKGKKVIVFAVPGAFTPGCSKTHLPGYVAKAAELKQQGISDIICVSVNDPFVMA 115

Query: 91  AWGK-KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
           AW K +  +  ++LL D S    + + + V    +G G+RS RY  +++D  + S  VE 
Sbjct: 116 AWAKDQGTVGKIRLLADPSAALAKALDLTVDIAPLG-GIRSKRYSMVVEDGKITSLQVEP 174

Query: 149 EGFSDNCA 156
           +G   +C+
Sbjct: 175 DGTGLSCS 182


>gi|90078122|dbj|BAE88741.1| unnamed protein product [Macaca fascicularis]
          Length = 215

 Score = 94.0 bits (232), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ + CLSVNDAFV  
Sbjct: 77  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVLACLSVNDAFVTG 136

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 137 EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 196

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 197 EPDGTGLTCSLAPSIIS 213


>gi|27376428|ref|NP_767957.1| peroxiredoxin [Bradyrhizobium japonicum USDA 110]
 gi|27349568|dbj|BAC46582.1| peroxiredoxin [Bradyrhizobium japonicum USDA 110]
          Length = 161

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 75/119 (63%), Gaps = 3/119 (2%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPG-FEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
            T D+F GK+V LFA+PGA+T TC    LP  F   Y  ++ +G++ +  +SVNDAFVMN
Sbjct: 26  TTDDIFKGKKVALFAVPGAYTGTCHKMHLPSIFLNAYA-IKDKGVDTIAIISVNDAFVMN 84

Query: 91  AWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +  + ++  + L DG+ +FT+ +GM +     G G+RS RY  L++D VV+   +E
Sbjct: 85  AWKRDTDQRDEAVFLADGNADFTKAIGMELDASANGLGIRSKRYSMLVEDGVVKKLNLE 143


>gi|320170602|gb|EFW47501.1| thioredoxin peroxidase PMP20 [Capsaspora owczarzaki ATCC 30864]
          Length = 190

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 71/119 (59%), Gaps = 2/119 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+  +LF GK+  LF +PGAFTP CS   LPG+ K Y+ L+ +G E +  ++VND FVM 
Sbjct: 55  VDIAELFKGKKGILFGVPGAFTPGCSKTHLPGYVKDYEKLKAKGAEVIAVIAVNDGFVMQ 114

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWG     +  V++L D + E T+ +G+      +G GLR+ R+ A++ D V     +E
Sbjct: 115 AWGAAHNAEGKVRMLADPTAELTKALGLEFNAPPLG-GLRTTRFSAVLNDGVFTHVNIE 172


>gi|255720853|ref|XP_002545361.1| hypothetical protein CTRG_00142 [Candida tropicalis MYA-3404]
 gi|240135850|gb|EER35403.1| hypothetical protein CTRG_00142 [Candida tropicalis MYA-3404]
          Length = 173

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 81/149 (54%), Gaps = 16/149 (10%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           ++N + LF    V + A+PGAFTPTCS+  +P + K   D + +G+E++  LS ND FVM
Sbjct: 31  ELNLKQLFKDNTVVVTAVPGAFTPTCSEQHIPDYLKHLQDFKSKGVEKIVVLSANDPFVM 90

Query: 90  NAWGKKLEIKN----VKLLPDGSGEFTRKMGMLVYKD--NVGFGLRSWRYGALIKDMVVE 143
            AWGK L   N    +    D +G  ++++G     D   VGFGLR  RY  ++K+  + 
Sbjct: 91  AAWGKALGYTNEENFIVFATDPNGAISKELGEDYVADLSGVGFGLRLQRYACIVKNGEIT 150

Query: 144 SWFVEE--GFSDNCATDPYEISSPENVLK 170
               E+  GF+        EISS E VLK
Sbjct: 151 YLKSEDELGFT--------EISSAETVLK 171


>gi|89070937|ref|ZP_01158166.1| AhpC/TSA family protein [Oceanicola granulosus HTCC2516]
 gi|89043487|gb|EAR49700.1| AhpC/TSA family protein [Oceanicola granulosus HTCC2516]
          Length = 162

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 78/136 (57%), Gaps = 4/136 (2%)

Query: 16  ATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI 75
           AT+L  G+   +  D+    + AG++V +F LPGA+T TC+   +P F +  D L  +G+
Sbjct: 12  ATLLRIGNDGPETVDLGA--MLAGRKVVIFGLPGAYTGTCTSAHVPSFIRSMDALGAKGV 69

Query: 76  EEVYCLSVNDAFVMNAWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
           + V C +VND FVM AWG+        +++L D SG+F + +G+      VGF  RS RY
Sbjct: 70  DAVVCTAVNDPFVMKAWGESTGAAEAGIEMLADASGQFAKAIGLDFDNPAVGFYGRSKRY 129

Query: 134 GALIKDMVVESWFVEE 149
             + +D VV+   VE+
Sbjct: 130 ALMAEDGVVKVLNVED 145


>gi|195389825|ref|XP_002053574.1| GJ23970 [Drosophila virilis]
 gi|194151660|gb|EDW67094.1| GJ23970 [Drosophila virilis]
          Length = 184

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/129 (39%), Positives = 80/129 (62%), Gaps = 4/129 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE-GIEEVYCLSVNDAFVM 89
           +NT +L  GK+V  F +PGAFTP CS   LPG+  + D L+ E GI+E+ C+SVND FVM
Sbjct: 49  INTGELTNGKKVIFFGVPGAFTPGCSKTHLPGYVTLADSLKAEQGIDEIVCVSVNDPFVM 108

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V++L D +G F   + + +    +G G+RS RY  ++++  V+   +E
Sbjct: 109 SAWGKEHGAAGKVRMLADPAGIFASALDVNIDLPPLG-GVRSKRYSMVVQNGEVKELNIE 167

Query: 149 -EGFSDNCA 156
            +G   +C+
Sbjct: 168 PDGTGLSCS 176


>gi|321459888|gb|EFX70936.1| hypothetical protein DAPPUDRAFT_202014 [Daphnia pulex]
          Length = 197

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 77/130 (59%), Gaps = 6/130 (4%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +L AGK+V +F +PGAFTP CS   LPG+   ++  + +G++E+ C+SVND FVM 
Sbjct: 61  VNIAELTAGKKVIIFGVPGAFTPGCSKTHLPGYVSDFEKFKSKGVDEIVCVSVNDPFVMA 120

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG--FGLRSWRYGALIKDMVVESWFV 147
           AWGK       V++L D +G F +   +   KD  G    +R  R+  L++D VV++  V
Sbjct: 121 AWGKDQNADGKVRMLADTNGAFAKAADL--EKDLSGPLGSVRCQRFSMLVEDGVVKALNV 178

Query: 148 E-EGFSDNCA 156
           E +G    C+
Sbjct: 179 EPDGTGLTCS 188


>gi|126346087|ref|XP_001373469.1| PREDICTED: similar to hCG2016877,, partial [Monodelphis domestica]
          Length = 192

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 82/138 (59%), Gaps = 6/138 (4%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  D L+ +G + V CLSVND FV++
Sbjct: 54  VNVAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQADALKSKGAQVVACLSVNDVFVVS 113

Query: 91  AWG--KKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWF 146
            WG  +K E K V+LL D SG F +   +L+    V  FG R   R+  +++D VV++  
Sbjct: 114 EWGLSQKAEGK-VRLLADPSGAFGKATDLLLDDSLVPLFGNRRLKRFSMVVQDGVVKALN 172

Query: 147 VE-EGFSDNCATDPYEIS 163
           VE +G    C+  P  +S
Sbjct: 173 VEPDGTGLTCSLAPNLLS 190


>gi|254475599|ref|ZP_05088985.1| peroxiredoxin TPx2 [Ruegeria sp. R11]
 gi|214029842|gb|EEB70677.1| peroxiredoxin TPx2 [Ruegeria sp. R11]
          Length = 162

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 67/123 (54%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + VN  +L  G+ V +FA+PGAFTPTC    +P F +  D L  +G++E+ C++ ND FV
Sbjct: 22  EQVNMANLTKGRTVAIFAVPGAFTPTCHSAHVPSFIRSKDALAAKGVDEIICIAANDPFV 81

Query: 89  MNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AW +    +   + +L D    FT  +GM +    VG   RS RY  L+KD  V    
Sbjct: 82  MKAWAEATGADAAGITMLSDAECGFTDAIGMRLDAPAVGLVGRSLRYAMLVKDGEVAIMN 141

Query: 147 VEE 149
            EE
Sbjct: 142 AEE 144


>gi|255720873|ref|XP_002545371.1| hypothetical protein CTRG_00152 [Candida tropicalis MYA-3404]
 gi|240135860|gb|EER35413.1| hypothetical protein CTRG_00152 [Candida tropicalis MYA-3404]
          Length = 173

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 84/151 (55%), Gaps = 16/151 (10%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           D++ ++LF    V +  +PGAFTPTCS+  +P + K  +D + +G+++V  LS ND FVM
Sbjct: 30  DLDLKELFDKNTVVITGVPGAFTPTCSEQHIPDYLKHLEDFKAKGVKKVIVLSANDPFVM 89

Query: 90  NAWGKKLEIKN----VKLLPDGSGEFTRKMG--MLVYKDNVGFGLRSWRYGALIKDMVVE 143
            AWGK L   N    V    D +G  ++++G   +V    VGFGLR  RY  ++K+  + 
Sbjct: 90  AAWGKALGYTNEENYVVFATDPNGAISKQLGEDYVVDLSAVGFGLRLQRYACVVKNGEIT 149

Query: 144 SWFVEE--GFSDNCATDPYEISSPENVLKVI 172
               EE  GF+        EISS E +LK I
Sbjct: 150 YLKGEEELGFT--------EISSAETILKNI 172


>gi|115523724|ref|YP_780635.1| redoxin domain-containing protein [Rhodopseudomonas palustris
           BisA53]
 gi|115517671|gb|ABJ05655.1| Redoxin domain protein [Rhodopseudomonas palustris BisA53]
          Length = 161

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 75/119 (63%), Gaps = 3/119 (2%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPG-FEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           +T D+F GK+V +FA+PGA+T TC    LP  F   Y  L+ +G++ +  +SVNDAFVM 
Sbjct: 26  STDDVFKGKKVAVFAVPGAYTGTCHKMHLPSIFLNAYA-LKDKGVDTIAIVSVNDAFVMG 84

Query: 91  AWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AW +  + ++  + L DG+ +FT+ +GM +     G G+RS RY AL++D VV    +E
Sbjct: 85  AWKRDTDQRDEAIFLADGNADFTKAIGMELDASGNGLGIRSHRYSALVEDGVVTKLNLE 143


>gi|332018975|gb|EGI59514.1| Peroxiredoxin-5, mitochondrial [Acromyrmex echinatior]
          Length = 152

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN   + A K++ +F +PGAFTP CS   LPG+    D+ + +GI E++C+SVND FVM 
Sbjct: 19  VNLAQITAQKKIVVFGVPGAFTPGCSKTHLPGYIVKADEFKSKGISEIFCISVNDPFVMA 78

Query: 91  AWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWGK+      +++L D   EFT  M + V    +G G RS RY  ++++ +V+   +E
Sbjct: 79  AWGKEHGATGKIRMLADPKAEFTDAMDLAVDLSVLG-GKRSKRYSMVVENGIVKEINIE 136


>gi|260432156|ref|ZP_05786127.1| peroxiredoxin-2E-2 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415984|gb|EEX09243.1| peroxiredoxin-2E-2 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 161

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 77/136 (56%), Gaps = 8/136 (5%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL-- 96
           G++V +FA+PGAFT TC+   +P F +  D    +G++E+ C++VND FVM AWG+    
Sbjct: 32  GRKVVIFAVPGAFTGTCTTAHVPSFMRTTDQFAAKGVDEIICVAVNDPFVMQAWGESTGA 91

Query: 97  EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               + +L D + EFT+ +GM       G   RS RY  L++D  V +  +EE     C 
Sbjct: 92  TAAGLTMLADPASEFTKAIGMDFDAPPAGLFGRSKRYAMLVEDGKVVALNLEES-PGTC- 149

Query: 157 TDPYEISSPENVLKVI 172
               E+S+ E +L+VI
Sbjct: 150 ----EVSAGEGLLEVI 161


>gi|39937328|ref|NP_949604.1| peroxiredoxin-like protein [Rhodopseudomonas palustris CGA009]
 gi|39651186|emb|CAE29709.1| peroxiredoxin-like protein [Rhodopseudomonas palustris CGA009]
          Length = 161

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 83/142 (58%), Gaps = 7/142 (4%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG-FEKIY 67
           ++V   LPD       +D      T D+F GK+V LFA+PGA+T TC    LP  F   Y
Sbjct: 3   IKVGDRLPDAQFRVMTEDGVQVKTTDDIFKGKKVALFAVPGAYTGTCHKMHLPSIFLNAY 62

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDNVGF 126
             ++ +G++ +  +SVNDAFVM+AW +  + +N  + L DG+ +FT+ +GM +     G 
Sbjct: 63  A-MKDKGVDTIAIVSVNDAFVMSAWKRDTDQRNEAIFLGDGNADFTKAIGMEMDGSGFGL 121

Query: 127 GLRSWRYGALIKDMVVESWFVE 148
           G RS RY  +++D VV++  +E
Sbjct: 122 GTRSLRYSMVVEDGVVKTLNLE 143


>gi|91978488|ref|YP_571147.1| peroxiredoxin-like protein [Rhodopseudomonas palustris BisB5]
 gi|91684944|gb|ABE41246.1| peroxiredoxin-like protein [Rhodopseudomonas palustris BisB5]
          Length = 163

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 83/146 (56%), Gaps = 12/146 (8%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG-F 63
           ++P+  F +  A    DG +        T D+F GK+V LFA+PGA+T TC    +P  F
Sbjct: 10  RLPEATFRLMTA----DGVET-----KTTGDIFKGKKVALFAVPGAYTGTCHKMHVPSIF 60

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKD 122
              Y  ++ +G++ +  +SVNDAFVMNAW +  + ++  + L DG+ EFT+ +GM +   
Sbjct: 61  LNAYA-IKDKGVDTIAIVSVNDAFVMNAWKRDTDQRDEAIFLADGNAEFTKAIGMELDGS 119

Query: 123 NVGFGLRSWRYGALIKDMVVESWFVE 148
             G G RS RY  L++D VV    +E
Sbjct: 120 GFGLGTRSLRYSMLVEDGVVTKLNLE 145


>gi|71017727|ref|XP_759094.1| hypothetical protein UM02947.1 [Ustilago maydis 521]
 gi|46098886|gb|EAK84119.1| hypothetical protein UM02947.1 [Ustilago maydis 521]
          Length = 253

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 81/140 (57%), Gaps = 2/140 (1%)

Query: 5   QIPQVVF-HMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGF 63
           QIP   F ++  A  L DG+       + T + F GK+V + A+PGA+TPTC  + +P +
Sbjct: 90  QIPNTTFTYVPWAPELADGTACGAPTKIQTHEAFKGKKVVIVAVPGAYTPTCHVNHIPPY 149

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKD 122
            K  D  + +G+++V  L+ ND FVM+AWG + + ++ V    D + EF++ +G +    
Sbjct: 150 IKQIDSFKSKGVDQVIVLAQNDPFVMSAWGVQNKAEDKVIFATDLNLEFSKAIGSIADLS 209

Query: 123 NVGFGLRSWRYGALIKDMVV 142
            +GFG R+ RY  ++ D+ V
Sbjct: 210 AMGFGQRTGRYALIVDDLKV 229


>gi|146415758|ref|XP_001483849.1| hypothetical protein PGUG_04578 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146392322|gb|EDK40480.1| hypothetical protein PGUG_04578 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 173

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 78/140 (55%), Gaps = 12/140 (8%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           LF GK + L + PGAFTPTC++  +PG+ K  D+ + +G++++  L+ ND FV  AWGK 
Sbjct: 37  LFPGKTIVLTSAPGAFTPTCTEQHVPGYLKKIDEFKQKGVDKIIILTANDPFVNAAWGKA 96

Query: 96  LEIKN----VKLLPDGSGEFTRKMGMLVYKD--NVGFGLRSWRYGALIKDMVVESWFVEE 149
           L  K+    V    D +   ++++G     D    GFGLR+ RY A++KD   E    E 
Sbjct: 97  LGYKDEENYVVFATDPNAALSKELGDEYLADLTGAGFGLRTGRYAAIVKDGKTEYLKAEN 156

Query: 150 GFSDNCATDPYEISSPENVL 169
           G S        +I++ EN+L
Sbjct: 157 GGSLT------DIATAENIL 170


>gi|225707038|gb|ACO09365.1| Peroxiredoxin-5, mitochondrial precursor [Osmerus mordax]
          Length = 182

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%), Gaps = 1/95 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+   LF GK+  LFA+PGAFTP CS   LPGF +    LR +G++EV C+SVNDAFVM 
Sbjct: 50  VSMDQLFKGKKGVLFAVPGAFTPGCSKTHLPGFVEQAAVLRSKGVQEVACVSVNDAFVMA 109

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNV 124
           AWGK+      V++L D +G FT+ + +++  D +
Sbjct: 110 AWGKEHGTDGKVRMLADPTGAFTQAVDLMLDSDQI 144


>gi|86137169|ref|ZP_01055747.1| AhpC/TSA family protein [Roseobacter sp. MED193]
 gi|85826493|gb|EAQ46690.1| AhpC/TSA family protein [Roseobacter sp. MED193]
          Length = 162

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 78/160 (48%), Gaps = 12/160 (7%)

Query: 19  LPDGS----KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           LPD +     A   + V   D   G++V +FA+PGAFTPTC    +P F +  D    +G
Sbjct: 8   LPDATLTQMGAEGPEQVQMLDKVTGRKVAIFAVPGAFTPTCHSAHVPSFIRTKDQFAAKG 67

Query: 75  IEEVYCLSVNDAFVMNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWR 132
           ++E+ C+S ND FVM AWG+        + +L D    FT  +GM       G   RS R
Sbjct: 68  VDEIICVSANDPFVMQAWGEATGANAAGITMLADAESAFTDAIGMRFDAPPAGLIGRSLR 127

Query: 133 YGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           Y  L++D VV     EE     C     E+S+ E +L  I
Sbjct: 128 YAMLVEDGVVTVLNREEN-PGQC-----ELSAGEGLLDSI 161


>gi|15218878|ref|NP_176774.1| type 2 peroxiredoxin-related / thiol specific antioxidant / mal
           allergen family protein [Arabidopsis thaliana]
 gi|75326793|sp|Q7G959|PRX2A_ARATH RecName: Full=Peroxiredoxin-2A; AltName: Full=Peroxiredoxin IIA;
           AltName: Full=Thioredoxin reductase 2A
 gi|6227024|gb|AAF06060.1|AC009513_16 Contains similarity to gb|AF121355 peroxiredoxin TPx1, may be a
           pseudogene [Arabidopsis thaliana]
 gi|67633486|gb|AAY78667.1| type 2 peroxiredoxin-related thiol-specific antioxidant
           [Arabidopsis thaliana]
 gi|332196329|gb|AEE34450.1| peroxiredoxin-2A [Arabidopsis thaliana]
          Length = 553

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 81/133 (60%), Gaps = 8/133 (6%)

Query: 15  VATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           V   +PDGS +F     Q + V+   L AGK+V LF +PGAF PTCS + + GF +  ++
Sbjct: 6   VGDFVPDGSISFFDDDDQLQTVSVHSLAAGKKVILFGVPGAFPPTCSMNHVNGFIEKAEE 65

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLR 129
           L+  G++E+ CLS +D F++ A     E K+VK + DGSGE+ + +G+ +   + G G+R
Sbjct: 66  LKSNGVDEIICLSGDDPFMITACS---ENKHVKFVEDGSGEYIQLLGLELEVKDKGLGVR 122

Query: 130 SWRYGALIKDMVV 142
           S  +  L+ ++ V
Sbjct: 123 SRGFALLLDNLKV 135


>gi|83944231|ref|ZP_00956686.1| AhpC/TSA family protein [Sulfitobacter sp. EE-36]
 gi|83844775|gb|EAP82657.1| AhpC/TSA family protein [Sulfitobacter sp. EE-36]
          Length = 162

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 20  PDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVY 79
           PDG +  Q  D        G++V +FA+PGA+TPTC    +P F +  D    +G++E+ 
Sbjct: 19  PDGPQPVQMAD-----KLKGRKVVVFAVPGAYTPTCDSAHVPSFVRTKDQFDAKGVDEII 73

Query: 80  CLSVNDAFVMNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           C+S ND FVM AWG+        + +L D +  FT+ +GM    +  G   RS RY  L+
Sbjct: 74  CVSCNDPFVMAAWGESTGATAAGITMLADANSAFTKAIGMEFSAEPAGLISRSKRYAMLV 133

Query: 138 KD 139
            D
Sbjct: 134 DD 135


>gi|55792575|gb|AAV65381.1| peroxiredoxin [Prototheca wickerhamii]
          Length = 154

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (64%), Gaps = 1/97 (1%)

Query: 48  PGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPD 106
           PGAFTPTCS   +PGF    D L+ +G++ + C+SVNDAFVM+AW K+L     + +L D
Sbjct: 53  PGAFTPTCSLKHVPGFIDNADKLKAKGVDTIGCVSVNDAFVMDAWAKQLGADGKILMLAD 112

Query: 107 GSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVE 143
           GSG FT+ +G  +   + G G RS  Y  L++D VV+
Sbjct: 113 GSGTFTKAVGAELDLSDKGLGQRSRVYSMLVEDGVVK 149


>gi|328787790|ref|XP_624806.3| PREDICTED: peroxiredoxin-5, mitochondrial [Apis mellifera]
          Length = 185

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 72/119 (60%), Gaps = 2/119 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN   +  GK++ +F +PGAFTP CS   LPG+ +   DL+ +GI E++C+SVND FVM 
Sbjct: 52  VNLAKISNGKKIIVFGVPGAFTPGCSKTHLPGYIQKASDLKSKGISEIFCISVNDPFVMA 111

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWGK    +  V++L D + +FT  + + V    +G G RS RY  ++ + ++    +E
Sbjct: 112 AWGKAQGAEGKVRMLADPAAQFTDALELSVDLPVLG-GKRSKRYSMVLDNGIITELNIE 169


>gi|294678929|ref|YP_003579544.1| peroxiredoxin [Rhodobacter capsulatus SB 1003]
 gi|294477749|gb|ADE87137.1| peroxiredoxin [Rhodobacter capsulatus SB 1003]
          Length = 162

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 75/139 (53%), Gaps = 4/139 (2%)

Query: 13  MRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC 72
           +  AT+L  G+   +  D+    L AG++V +FA+PGA+T  C+   +P F +       
Sbjct: 9   LPAATLLKIGANGPEAVDLAA--LTAGRKVVIFAVPGAYTGVCTTAHVPSFIRTKPQFGA 66

Query: 73  EGIEEVYCLSVNDAFVMNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRS 130
           +G++E+ C+SVND FVM AWG+        + LL D    FT+ +GM      VG   RS
Sbjct: 67  KGVDEILCVSVNDPFVMAAWGEATGATAAGITLLADAEAAFTKAIGMAFSAPPVGLIDRS 126

Query: 131 WRYGALIKDMVVESWFVEE 149
            RY  L++D VV+    EE
Sbjct: 127 ARYAMLVEDGVVKVLNREE 145


>gi|224144638|ref|XP_002325358.1| type IIF peroxiredoxin [Populus trichocarpa]
 gi|222862233|gb|EEE99739.1| type IIF peroxiredoxin [Populus trichocarpa]
          Length = 203

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 80/140 (57%), Gaps = 7/140 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F GK+V +F LPGA+T  CS   +P ++ I D  + +GI+ V C++VND + MNAW 
Sbjct: 70  KDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKNIIDKFKAKGIDSVICVAVNDPYTMNAWA 129

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL+ K+ ++   D  G   + + +         G RS R+ A ++D +V+   VEE  S
Sbjct: 130 EKLQAKDAIEFYGDFDGSLHKSLELNKDLSVALLGHRSERWSAYVEDGMVKVLNVEEAPS 189

Query: 153 DNCATDPYEISSPENVLKVI 172
           D      +++SS E +L  I
Sbjct: 190 D------FKVSSGEVILGQI 203


>gi|149461406|ref|XP_001513863.1| PREDICTED: similar to chromosome 6 open reading frame 97
           [Ornithorhynchus anatinus]
          Length = 297

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 79/135 (58%), Gaps = 4/135 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN ++LF GK+  LF +PGAFTP CS   LPG  +    LR +G E V CLSVND FV++
Sbjct: 163 VNLEELFKGKKGVLFGVPGAFTPGCSKTHLPGIVEQAGALRAKGAEVVACLSVNDVFVVS 222

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE- 148
            WG+    +  V+LL D +G F +   + + +    +  R WR+  +++D VV+S  VE 
Sbjct: 223 EWGRANGAEGKVRLLADPTGAFGKMSDLRLLE--CFWAPRGWRFSMVVQDGVVKSLNVEP 280

Query: 149 EGFSDNCATDPYEIS 163
           +G   +C+  P  +S
Sbjct: 281 DGTGLSCSLAPNLLS 295


>gi|296420727|ref|XP_002839920.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636127|emb|CAZ84111.1| unnamed protein product [Tuber melanosporum]
          Length = 156

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 81/140 (57%), Gaps = 5/140 (3%)

Query: 13  MRVATVLPDGSKAFQW--KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDL 70
           + V + +P  + A  W  KD NT  L +  +  +  +PGAFTP CS H +PG+ + YD L
Sbjct: 2   ISVGSSIP-AAPASLWVEKDNNTVSLPSSGKYIIVGVPGAFTPPCSSH-VPGYVENYDKL 59

Query: 71  RCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLR 129
           + +GI  VY ++VND FV+NAW ++L +  +V  L D  GEFTR +G+      +    R
Sbjct: 60  QAKGISAVYVVAVNDIFVVNAWKEQLAKGSSVHFLSDSKGEFTRLVGLDFDASGLLGNAR 119

Query: 130 SWRYGALIKDMVVESWFVEE 149
           S RY A+++D  V +  VE 
Sbjct: 120 SQRYVAVVEDGKVTNLQVEN 139


>gi|146279039|ref|YP_001169198.1| redoxin domain-containing protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557280|gb|ABP71893.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 162

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 66/123 (53%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V   +   G+ V +FA+PGA+TPTC    +P F +  +    +G+EE+ C+SVND FV
Sbjct: 23  EQVQLSERLKGRSVVIFAVPGAYTPTCHSAHVPSFIRTKEQFADKGVEEILCISVNDPFV 82

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWG+        + +L D  G FT+ +G+      VG   RS RY    +D VV    
Sbjct: 83  MKAWGESTGASEAGITMLSDADGAFTKALGLSFDAPPVGLIGRSKRYALHARDGVVTVLH 142

Query: 147 VEE 149
           +EE
Sbjct: 143 LEE 145


>gi|327290849|ref|XP_003230134.1| PREDICTED: peroxiredoxin-5, mitochondrial-like [Anolis
           carolinensis]
          Length = 206

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 79/135 (58%), Gaps = 7/135 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN   LF GK+  LF +PGAFTP CS   LPG+ +    L+ +G+E + CLSVND FVM 
Sbjct: 67  VNLASLFKGKKGVLFGVPGAFTPGCSKTHLPGYVEKAGQLKGKGVEIIACLSVNDVFVMK 126

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG--FGL-RSWRYGALIKDMVVESWF 146
            WG     +  V++L D +G F +   +L+ K+ +   FG  RS R+  ++ D +V+S  
Sbjct: 127 EWGNAHHAEGKVRMLADPTGAFGKATNLLLDKEPLRDLFGTNRSKRFSMVVDDGIVKSLN 186

Query: 147 VEE---GFSDNCATD 158
           VEE   G + + AT+
Sbjct: 187 VEEDGTGLTCSLATN 201


>gi|126740843|ref|ZP_01756528.1| AhpC/TSA family protein [Roseobacter sp. SK209-2-6]
 gi|126718139|gb|EBA14856.1| AhpC/TSA family protein [Roseobacter sp. SK209-2-6]
          Length = 198

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 62/113 (54%), Gaps = 2/113 (1%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL--E 97
           ++V +FA+PGAFTPTC    +P F +  D+   +G++E+ C+S ND FVM AWG+     
Sbjct: 69  RKVVIFAVPGAFTPTCHSAHVPSFIRTKDEFISKGVDEIICVSTNDPFVMQAWGEATGAN 128

Query: 98  IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
              + +L D    FT  +GM       G   RS RY  LI D VV    +EEG
Sbjct: 129 AAGITMLADAESAFTDAIGMRFDAPPAGLIGRSLRYAMLIDDGVVSVLNLEEG 181


>gi|197304975|pdb|2VL2|A Chain A, Oxidized And Reduced Forms Of Human Peroxiredoxin 5
 gi|197304976|pdb|2VL2|B Chain B, Oxidized And Reduced Forms Of Human Peroxiredoxin 5
          Length = 172

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 75/121 (61%), Gaps = 3/121 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 34  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 93

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 94  EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 153

Query: 148 E 148
           E
Sbjct: 154 E 154


>gi|197304981|pdb|2VL9|A Chain A, Oxidized Form Of Human Peroxiredoxin 5
 gi|197304982|pdb|2VL9|B Chain B, Oxidized Form Of Human Peroxiredoxin 5
 gi|197304983|pdb|2VL9|C Chain C, Oxidized Form Of Human Peroxiredoxin 5
 gi|197304984|pdb|2VL9|D Chain D, Oxidized Form Of Human Peroxiredoxin 5
          Length = 173

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V  LSVNDAFV  
Sbjct: 35  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVASLSVNDAFVTG 94

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 95  EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 154

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 155 EPDGTGLTCSLAPNIIS 171


>gi|55670364|pdb|1URM|A Chain A, Human Peroxiredoxin 5, C47s Mutant
          Length = 172

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP  S   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 34  VNLAELFKGKKGVLFGVPGAFTPGSSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 93

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSW-RYGALIKDMVVESWFV 147
            WG+  + +  V+LL D +G F ++  +L+    V  FG R   R+  +++D +V++  V
Sbjct: 94  EWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNV 153

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 154 EPDGTGLTCSLAPNIIS 170


>gi|195107361|ref|XP_001998282.1| GI23880 [Drosophila mojavensis]
 gi|193914876|gb|EDW13743.1| GI23880 [Drosophila mojavensis]
          Length = 157

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/121 (42%), Positives = 74/121 (61%), Gaps = 8/121 (6%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE-GIEEVYCLSVNDAFVM 89
           +NT +L  GK+V  F +PGAFTP CS   LPG+    D L+ E G++E+ C+SVND FVM
Sbjct: 22  INTGELTNGKKVIFFGVPGAFTPGCSKTHLPGYVSGADSLKAEQGVDEIVCVSVNDPFVM 81

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +AWGK+      V++L D +G F   + + +    +G G+RS RY      MVVE+  V+
Sbjct: 82  SAWGKEHGATGKVRMLADPAGLFASALDVNIDLPPLG-GVRSKRY-----SMVVENGEVK 135

Query: 149 E 149
           E
Sbjct: 136 E 136


>gi|83950502|ref|ZP_00959235.1| AhpC/TSA family protein [Roseovarius nubinhibens ISM]
 gi|83838401|gb|EAP77697.1| AhpC/TSA family protein [Roseovarius nubinhibens ISM]
          Length = 162

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V+  D   G+++ +FALPGA+T  C +  +P F +  + L+ +G++EV C+SVND FV
Sbjct: 23  EQVSLDDKAKGRKLAIFALPGAYTGVCHNAHVPSFVRNMEALKAKGVDEVICISVNDPFV 82

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWG+    K   + +L D    FT+ MGM       G   RS RY  +++D VV    
Sbjct: 83  MGAWGESTGAKEAGIAMLGDADASFTKAMGMEFSAPPAGLIDRSKRYAMVVEDGVVTLLQ 142

Query: 147 VEE 149
            EE
Sbjct: 143 AEE 145


>gi|50897517|gb|AAT85821.1| putative peroxiredoxin [Glossina morsitans morsitans]
          Length = 168

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (57%), Gaps = 12/151 (7%)

Query: 14  RVATVLP-----DGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           +V   LP     +GS A +   +N  +L A K+V +F +PGAFTP CS   LPG+    D
Sbjct: 14  KVGDTLPSVELFEGSPANK---INISELTAKKKVVIFGVPGAFTPGCSKTHLPGYVDSAD 70

Query: 69  DLRCE-GIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGF 126
           +L+ E  + E+ C+SVND FVM+AWGK+      V++L D S  F + M + +    +G 
Sbjct: 71  ELKKELNVNEIICISVNDPFVMSAWGKEHGADGKVRMLADPSAAFVKAMDLTIDLPPLG- 129

Query: 127 GLRSWRYGALIKDMVVESWFVE-EGFSDNCA 156
           G+RS R+  +++D  V +  VE +G   +C+
Sbjct: 130 GIRSKRFSMIVEDAKVLALNVEPDGTGLSCS 160


>gi|99082312|ref|YP_614466.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Ruegeria sp.
           TM1040]
 gi|99038592|gb|ABF65204.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Ruegeria sp.
           TM1040]
          Length = 161

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 75/144 (52%), Gaps = 8/144 (5%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V  QDL  G+++ +FA+PGAFTPTC    +P F +  D    +G++E+ C+S ND FVM 
Sbjct: 24  VAIQDLAKGRKLAIFAVPGAFTPTCHSAHVPSFIRTKDQFAAKGVDEIICISGNDPFVMK 83

Query: 91  AWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWG+        + +L D    FT  +GM       G   RS RY  +++D  V+   +E
Sbjct: 84  AWGEATGATEAGITMLADAECSFTDAIGMRFDAPPAGLIGRSKRYAMIVEDGEVKILHLE 143

Query: 149 EGFSDNCATDPYEISSPENVLKVI 172
           E     C     E+S+ E +L  +
Sbjct: 144 ES-PGTC-----EVSAGEGLLDAL 161


>gi|219125139|ref|XP_002182845.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405639|gb|EEC45581.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 202

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 70/119 (58%), Gaps = 5/119 (4%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           DV   DL AGK+V +F +PGAFTP CS   LP F +  ++L+  G++   C++ NDA+ M
Sbjct: 69  DVKIVDLIAGKKVAIFGVPGAFTPGCSKSHLPSFMEAQEELKGRGVDMTICVATNDAYTM 128

Query: 90  NAWGKKLEIKNV--KLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
            AWG+     +V  + L D SG  T+++G+++       G+R+ R+  + +D  V  +F
Sbjct: 129 EAWGRTSGGSDVGIRFLADNSGTLTKELGLVM---ETPVGIRTKRFSLIAEDGKVTKYF 184


>gi|312282819|dbj|BAJ34275.1| unnamed protein product [Thellungiella halophila]
          Length = 201

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 79/139 (56%), Gaps = 7/139 (5%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           D+F GK+V +F LPGA+T  CS   +P ++   D  + +GI+ V C+SVND + +N W +
Sbjct: 69  DIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSQIDKFKAKGIDSVICVSVNDPYAINGWAE 128

Query: 95  KLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSD 153
           KL+ K+ ++   D  G+F + +G+         G RS R+ A ++D  V++  VEE  SD
Sbjct: 129 KLDAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAVNVEEAPSD 188

Query: 154 NCATDPYEISSPENVLKVI 172
                 +++S  E +L  I
Sbjct: 189 ------FKVSGAEVILGQI 201


>gi|86748468|ref|YP_484964.1| peroxiredoxin-like protein [Rhodopseudomonas palustris HaA2]
 gi|86571496|gb|ABD06053.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal
           allergen [Rhodopseudomonas palustris HaA2]
          Length = 161

 Score = 90.9 bits (224), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 83/146 (56%), Gaps = 12/146 (8%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG-F 63
           ++P+  F +  A    DG ++       T D+F GK+V LFA+PGA+T TC    LP  F
Sbjct: 8   RLPEATFRVMTA----DGVQS-----KTTDDIFKGKKVALFAVPGAYTGTCHKMHLPSIF 58

Query: 64  EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKL-LPDGSGEFTRKMGMLVYKD 122
              Y  ++ +G++ +  +SVNDAFVM+AW +  + ++  + L DG+ +FT+ +GM +   
Sbjct: 59  LNAYA-IKDKGVDTIAIVSVNDAFVMSAWKRDTDQRDEAIFLADGNSDFTKAIGMEMDGS 117

Query: 123 NVGFGLRSWRYGALIKDMVVESWFVE 148
             G G RS RY  L+ D VV    +E
Sbjct: 118 GFGLGTRSLRYSMLVDDGVVTKLNLE 143


>gi|294891353|ref|XP_002773537.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239878709|gb|EER05353.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 184

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 83/150 (55%), Gaps = 4/150 (2%)

Query: 11  FHMRVATVLPDGS--KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           F + V   LP+ +  +A      + +D+F   +  LF +PGAFTPTC    LPGF + YD
Sbjct: 26  FSVAVGDALPNVTVREADPGDTKSLRDIFGNDKGILFGVPGAFTPTCDQSHLPGFIRDYD 85

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGK-KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFG 127
            L+ +G++ V C++VND FVM AWGK K     V++L D  GE  + +G      +V   
Sbjct: 86  KLQQKGVKTVACMAVNDPFVMQAWGKIKGADGKVRMLSDVDGEAAKALGTNFDATDVLGP 145

Query: 128 LRSWRYGALIKDMVVESWFVE-EGFSDNCA 156
           +R+ R+ A++ +  +    VE +G   +C+
Sbjct: 146 IRTKRFAAIVDNGKITDLEVEPDGTGLSCS 175


>gi|320580345|gb|EFW94568.1| putative peroxiredoxin [Pichia angusta DL-1]
          Length = 189

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 74/125 (59%), Gaps = 5/125 (4%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K+++  +L  GK + + A PGAFTPTC++  +P F +  ++L+ +G +E+  L+ ND FV
Sbjct: 52  KELDLAELAPGKTLVIVAAPGAFTPTCTERHIPAFVQHAEELKKKGADEIIVLTTNDPFV 111

Query: 89  MNAWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESW 145
            +AWGK L      VK   D SGEF++K+G+ V  D   F   R+ RY  + KD VV   
Sbjct: 112 QSAWGKALGNTKGVVKFATDPSGEFSKKLGLAV--DGAPFVTYRTGRYALIAKDGVVTYV 169

Query: 146 FVEEG 150
            VE G
Sbjct: 170 GVETG 174


>gi|2462742|gb|AAB71961.1| Unknown protein [Arabidopsis thaliana]
          Length = 164

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 90/168 (53%), Gaps = 15/168 (8%)

Query: 13  MRVATVLPDGSKAF-----QWKDVNTQDLFAGKRVFLFALP-GAFT-PTCSDHQLPGFEK 65
           + V  V+PDG+ +F     Q + V+   + A      F L  G F     S   +PGF  
Sbjct: 4   ITVGDVVPDGTISFFDENDQLQTVSVHSIAAADGFLDFDLRIGVFGFSEVSMSHVPGFIG 63

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             ++L+ +GI+E+ C SVND FVM AWGK   E K+VK + DGSGE+T  +G+ +   + 
Sbjct: 64  KAEELKSKGIDEIICFSVNDPFVMKAWGKTYQENKHVKFVADGSGEYTHLLGLELDLKDK 123

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G G+RS R+  L+ ++ V    VE G         + +SS E++LK +
Sbjct: 124 GLGIRSRRFALLLDNLKVTVANVENG-------GEFTVSSAEDILKAL 164


>gi|114766813|ref|ZP_01445747.1| AhpC/TSA family protein [Pelagibaca bermudensis HTCC2601]
 gi|114541007|gb|EAU44065.1| AhpC/TSA family protein [Roseovarius sp. HTCC2601]
          Length = 162

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 72/136 (52%), Gaps = 8/136 (5%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI 98
           G++V +FA+PGAFTPTC    +P F +  D    +G++E+ C+SVND FVM AWG+    
Sbjct: 33  GRKVVIFAVPGAFTPTCHSAHVPSFIRTKDSFAEKGVDEIICVSVNDPFVMKAWGEATGA 92

Query: 99  --KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
               + +L D    FT+ +GM       G   RS RY  L++D  V +    E     C 
Sbjct: 93  TEAGITMLGDPESAFTKAIGMDFTAPPAGLIARSKRYAMLVEDGTV-TLLHAEASPGEC- 150

Query: 157 TDPYEISSPENVLKVI 172
               EIS+ E +L+ +
Sbjct: 151 ----EISAGEGLLEAM 162


>gi|115435844|ref|NP_001042680.1| Os01g0266600 [Oryza sativa Japonica Group]
 gi|75203325|sp|Q9SDD6|PRX2F_ORYSJ RecName: Full=Peroxiredoxin-2F, mitochondrial; AltName:
           Full=Peroxiredoxin IIF; AltName: Full=Thioredoxin
           reductase 2F; Flags: Precursor
 gi|6630684|dbj|BAA88530.1| putative thioredoxin peroxidase [Oryza sativa Japonica Group]
 gi|6815076|dbj|BAA90363.1| putative thioredoxin peroxidase [Oryza sativa Japonica Group]
 gi|113532211|dbj|BAF04594.1| Os01g0266600 [Oryza sativa Japonica Group]
 gi|215764983|dbj|BAG86680.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 198

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 79/140 (56%), Gaps = 7/140 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F GK+V +F LPGA+T  CS   +P ++   D L+ +G++ V C+SVND + +N W 
Sbjct: 65  KDIFHGKKVVIFGLPGAYTGVCSQAHVPSYKNNIDKLKAKGVDSVICVSVNDPYALNGWA 124

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL+ K+ ++   D  G F + + + V       G RS R+ A + D  ++++ VE   S
Sbjct: 125 EKLQAKDAIEFYGDFDGSFHKSLDLEVDLSAALLGRRSHRWSAFVDDGKIKAFNVEVAPS 184

Query: 153 DNCATDPYEISSPENVLKVI 172
           D      +++S  E +L  I
Sbjct: 185 D------FKVSGAEVILDQI 198


>gi|327506368|gb|AEA92625.1| peroxiredoxin type II [Dunaliella viridis]
          Length = 159

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 84/142 (59%), Gaps = 12/142 (8%)

Query: 13  MRVATVLPDGSKAFQWK---DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           ++V   LPD  K F+     +V  +DLFAGK+  + A+PGAFTP CS   LPG+ + +D 
Sbjct: 3   IKVGDALPD-VKVFEGTPGGEVKLRDLFAGKKGVIVAVPGAFTPGCSKTHLPGYVQNFDK 61

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGK-KLEIKNVKLLPDGSGEFTRK--MGMLVYKDNVGF 126
            +  G + V CL+ ND FVM+AWG+ +     V++L D + E T+   +GM    D +G 
Sbjct: 62  FKAAGADIVACLATNDPFVMSAWGEAQGATGKVRMLSDMNAEATKAFDLGM----DAMGL 117

Query: 127 GLRSWRYGALIKDMVVESWFVE 148
             R+ RY  +I+D VV++  ++
Sbjct: 118 -TRAQRYSMVIQDNVVKALNLQ 138


>gi|299134144|ref|ZP_07027337.1| Redoxin domain protein [Afipia sp. 1NLS2]
 gi|298590891|gb|EFI51093.1| Redoxin domain protein [Afipia sp. 1NLS2]
          Length = 161

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 70/117 (59%), Gaps = 1/117 (0%)

Query: 33  TQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW 92
           T ++F GK+V LFA+PGA+T TC    +P   +    ++ +G++ +  +SVND FVMNAW
Sbjct: 27  TDEIFKGKKVALFAVPGAYTGTCHKMHMPSVFQNAAAIKAKGVDTIAVVSVNDVFVMNAW 86

Query: 93  GKKLEIKNVKL-LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            +  +  N  + L DGS +F + +G+ +     G G+RS RY  L+ + VV+   +E
Sbjct: 87  KRDTDFNNEAIYLADGSADFAKAIGLDIDLSARGLGIRSNRYSMLVDNGVVKKLNLE 143


>gi|194218400|ref|XP_001489792.2| PREDICTED: similar to peroxiredoxin 5 [Equus caballus]
          Length = 264

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 77/137 (56%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +    L+ +G+E V CL+VND FV  
Sbjct: 126 VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAAALKAKGVEVVACLTVNDVFVTE 185

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFGLRSW-RYGALIKDMVVESWFV 147
            WG+    K  V+LL D +G F ++   +L       FG R   R+  +I+D +V+S  V
Sbjct: 186 EWGRAHNTKGKVRLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRFSMVIEDGIVKSLNV 245

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  IS
Sbjct: 246 EPDGTGLTCSLAPNIIS 262


>gi|37783267|gb|AAP42502.1| peroxiredoxin [Ipomoea batatas]
          Length = 193

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 68/121 (56%), Gaps = 1/121 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F GK V +F LPGA+T  CS   +P ++   D  + +GI+ V C++VND + MN W 
Sbjct: 60  KDIFKGKNVVIFGLPGAYTGVCSAQHVPSYKNNIDKFKAKGIDSVICVAVNDPYTMNGWA 119

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL+ K+ ++   D  G F + + + +       G+RS R+ A I D   +   +E+  S
Sbjct: 120 EKLQAKDAIEFYGDFDGSFHKSLDLTIDLSGALLGIRSHRWSAYIADGQAKGLNIEQAPS 179

Query: 153 D 153
           D
Sbjct: 180 D 180


>gi|18397457|ref|NP_566268.1| PRXIIF (PEROXIREDOXIN IIF); antioxidant/ peroxidase [Arabidopsis
           thaliana]
 gi|25090885|sp|Q9M7T0|PRX2F_ARATH RecName: Full=Peroxiredoxin-2F, mitochondrial; AltName:
           Full=Peroxiredoxin IIF; AltName: Full=Thioredoxin
           reductase 2F; Flags: Precursor
 gi|15450355|gb|AAK96471.1| AT3g06050/F24F17_3 [Arabidopsis thaliana]
 gi|20466103|gb|AAM19973.1| AT3g06050/F24F17_3 [Arabidopsis thaliana]
 gi|332640816|gb|AEE74337.1| peroxiredoxin-2F [Arabidopsis thaliana]
          Length = 201

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (57%), Gaps = 1/121 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F GK+V +F LPGA+T  CS   +P ++   D  + +GI+ V C+SVND F +N W 
Sbjct: 68  SDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVICVSVNDPFAINGWA 127

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL  K+ ++   D  G+F + +G+         G RS R+ A ++D  V++  VEE  S
Sbjct: 128 EKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAVNVEEAPS 187

Query: 153 D 153
           D
Sbjct: 188 D 188


>gi|321459887|gb|EFX70935.1| hypothetical protein DAPPUDRAFT_93418 [Daphnia pulex]
          Length = 159

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 77/130 (59%), Gaps = 6/130 (4%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +L AGK+V +  +PGAFTP CS   LP +   ++  + +GI+E+ C++VND +VM 
Sbjct: 23  VNIAELTAGKKVIIIGVPGAFTPCCSKSHLPSYISDFEKFKSKGIDEIVCVAVNDPYVMA 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG--FGLRSWRYGALIKDMVVESWFV 147
           AWGK       V++L D +G F + + +   KD  G    +R  R+  L++D VV++  V
Sbjct: 83  AWGKDQNANGKVRMLADTNGAFAKALDL--EKDLSGPLGNVRCQRFSMLVEDGVVKALNV 140

Query: 148 E-EGFSDNCA 156
           E +G   +C+
Sbjct: 141 EPDGTGASCS 150


>gi|312271189|gb|ADQ57292.1| peroxiredoxin V [Argopecten irradians]
          Length = 188

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 71/121 (58%), Gaps = 4/121 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VNT + FA  +  +F +PGAFTP CS   LPG+ + +  L  +G++ V C+SVND FVM 
Sbjct: 51  VNTAEAFASGKHIIFGVPGAFTPGCSKTHLPGYTEDFSKLEAKGVKSVNCVSVNDPFVMQ 110

Query: 91  AWGK-KLEIKNVKLLPDGSGEFTRKMG--MLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG+ +     V++L D  G FT ++G  +   KD +G  +R  R+  ++ D  +E   V
Sbjct: 111 AWGENQGAAGKVRMLADTCGAFTSQLGLDLPAVKDVLG-NVRCKRFAMVVNDGKIEKLNV 169

Query: 148 E 148
           E
Sbjct: 170 E 170


>gi|21553531|gb|AAM62624.1| unknown [Arabidopsis thaliana]
          Length = 201

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (57%), Gaps = 1/121 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F GK+V +F LPGA+T  CS   +P ++   D  + +GI+ V C+SVND F +N W 
Sbjct: 68  SDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVICVSVNDPFAINGWA 127

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL  K+ ++   D  G+F + +G+         G RS R+ A ++D  V++  VEE  S
Sbjct: 128 EKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAVNVEEAPS 187

Query: 153 D 153
           D
Sbjct: 188 D 188


>gi|7658343|gb|AAF66133.1| unknown protein; 13384-11892 [Arabidopsis thaliana]
          Length = 199

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (57%), Gaps = 1/121 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F GK+V +F LPGA+T  CS   +P ++   D  + +GI+ V C+SVND F +N W 
Sbjct: 66  SDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVICVSVNDPFAINGWA 125

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL  K+ ++   D  G+F + +G+         G RS R+ A ++D  V++  VEE  S
Sbjct: 126 EKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAVNVEEAPS 185

Query: 153 D 153
           D
Sbjct: 186 D 186


>gi|110678293|ref|YP_681300.1| anti-oxidant AhpCTSA family protein [Roseobacter denitrificans OCh
           114]
 gi|109454409|gb|ABG30614.1| antioxidant, AhpC/Tsa family, putative [Roseobacter denitrificans
           OCh 114]
          Length = 162

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 8/132 (6%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL--E 97
           ++V +FA+PGAFTPTC    +P F +       +G+EE+ C+SVND FVM AWG+     
Sbjct: 34  RKVVIFAVPGAFTPTCHSAHVPSFVRTKAQFDAKGVEEIICVSVNDPFVMQAWGEATGAT 93

Query: 98  IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCAT 157
              + +L D    FT+ +GM       G   RS RY  L++D  V +   EE     C  
Sbjct: 94  AAGITMLGDADSSFTKALGMDFSAPPAGLTDRSKRYAMLVEDGKV-TLLQEEESPGTC-- 150

Query: 158 DPYEISSPENVL 169
              E+S+ E +L
Sbjct: 151 ---EVSAGEALL 159


>gi|126728473|ref|ZP_01744289.1| AhpC/TSA family protein [Sagittula stellata E-37]
 gi|126711438|gb|EBA10488.1| AhpC/TSA family protein [Sagittula stellata E-37]
          Length = 162

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 71/121 (58%), Gaps = 2/121 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+  +L  G+++ +FALPGAFT TC++  +P F K  D    +G++E+ C++VND FVM+
Sbjct: 25  VDLSELAKGRKLLIFALPGAFTGTCTNAHVPSFIKTKDAFAEKGVDEIVCIAVNDPFVMD 84

Query: 91  AWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           +W +    +   +  L D    FT+ MGM      VGF  RS RY  +++D  V+   ++
Sbjct: 85  SWSRHTGGDKAGITFLADPDAAFTKAMGMNFTAPPVGFYDRSKRYAMVVEDGTVKGLNLD 144

Query: 149 E 149
           +
Sbjct: 145 D 145


>gi|298293035|ref|YP_003694974.1| redoxin [Starkeya novella DSM 506]
 gi|296929546|gb|ADH90355.1| Redoxin domain protein [Starkeya novella DSM 506]
          Length = 161

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 77/146 (52%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           Q+P   F  RVAT   DG         +++++F  K+V LFA+PGAFTPTC  + LP F 
Sbjct: 8   QLPSATF--RVATA--DGPVP-----KSSEEIFKNKKVVLFAVPGAFTPTCHKNHLPSFI 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK-NVKLLPDGSGEFTRKMGMLVYKDN 123
              D+L  +G+  +   +VND FV+ AW K    +  +  L DG+ +F + +GM      
Sbjct: 59  ARADELFAKGVSVIAVTAVNDPFVLAAWEKASNAEGKILFLSDGNADFAKAIGMDFDASA 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
            G G RS RY  L+ D  V    VE+
Sbjct: 119 AGLGTRSKRYSMLVDDGEVLILNVED 144


>gi|149688674|gb|ABR27748.1| peroxiredoxin [Chlamys farreri]
          Length = 187

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 70/119 (58%), Gaps = 1/119 (0%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  + FA  +  +F +PGAFTP CS   LPG+ + ++ L+ +G+  V C++VND F+M 
Sbjct: 51  VNAAEAFATGKHIIFGVPGAFTPGCSKTHLPGYVENFEKLQSKGVTSVSCVAVNDPFIMK 110

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWG+  + +  V++L D  G FT+ +G+ +    V   +R  R+  ++ D  +E   VE
Sbjct: 111 AWGENQKAEGKVRMLADTCGAFTKSLGLDLDLTEVLGNVRCKRFSMVVNDGKIEHLMVE 169


>gi|89052930|ref|YP_508381.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Jannaschia sp.
           CCS1]
 gi|88862479|gb|ABD53356.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Jannaschia sp.
           CCS1]
          Length = 162

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 90/159 (56%), Gaps = 10/159 (6%)

Query: 16  ATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI 75
           AT+L  G++  +  +++T  L  G++V +FA+PGA+T  C++  LP F +  +    +G+
Sbjct: 12  ATLLRMGAEGPEPVELDT--LTKGRKVAIFAVPGAYTGVCTEAHLPSFMRNMNGFEAKGV 69

Query: 76  EEVYCLSVNDAFVMNAWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
           E+V C++VND FV++ W          + +L D +  FT+ +GM    + VGF  RS RY
Sbjct: 70  EKVICIAVNDPFVLDTWATTTGAAETGIVMLADPAATFTKAVGMNWTAEAVGFHDRSKRY 129

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
               +D VV++   E    DN  T   E+S+ E++L VI
Sbjct: 130 ALYAEDGVVKTLHEE----DNAGT--CEVSAGESLLAVI 162


>gi|257167993|gb|ACV49770.1| putative peroxiredoxin [Pichia angusta]
          Length = 193

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 5/125 (4%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K+++  +L  GK + + A PGAFTPTC++  +P F +  ++L+ +G +E+  L+ ND FV
Sbjct: 56  KELDLAELAPGKTLVIVAAPGAFTPTCTERHIPAFVQHAEELKKKGADEIIVLTTNDPFV 115

Query: 89  MNAWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGF-GLRSWRYGALIKDMVVESW 145
            +AWGK L      VK   D SG F++K+G+ V  D   F   R+ RY  + KD VV   
Sbjct: 116 QSAWGKALGNSKGVVKFATDPSGAFSKKLGLAV--DGAPFVTYRTGRYALIAKDGVVTYV 173

Query: 146 FVEEG 150
            VE G
Sbjct: 174 GVETG 178


>gi|255629103|gb|ACU14896.1| unknown [Glycine max]
          Length = 197

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 72/121 (59%), Gaps = 1/121 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F  K+V +F LPGA+T  CS+  +P +++  D  + +GI+ V C+++ND + MNAW 
Sbjct: 64  KDIFKDKKVVIFGLPGAYTGVCSNKHVPPYKENIDKFKAKGIDSVICVAINDPYTMNAWA 123

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL+ K+ ++   D  G F + + ++        G RS R+ A + D  V++  VEE  S
Sbjct: 124 EKLQAKDAIEFYGDFDGSFHKSLELVTDLSGALLGTRSERWSAYVVDGKVKALNVEEAPS 183

Query: 153 D 153
           D
Sbjct: 184 D 184


>gi|148234370|ref|NP_001085580.1| peroxiredoxin 5 [Xenopus laevis]
 gi|49119374|gb|AAH72972.1| MGC82521 protein [Xenopus laevis]
          Length = 189

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 72/123 (58%), Gaps = 4/123 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN +DLF  K+  LF +PGAFTP CS   LPG+     +L+  G   V C+SVND FV++
Sbjct: 50  VNIRDLFTNKKGVLFGVPGAFTPGCSKTHLPGYVAQAAELKSRGAAVVACISVNDVFVVS 109

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG--FG-LRSWRYGALIKDMVVESWF 146
            WGK  E +  V +L D  GEF +  G+L+ K  +   FG  R  R+  +++D  +++  
Sbjct: 110 EWGKVHEAEGKVCMLADPCGEFAKACGLLLDKKELSELFGNQRCKRFSMVVEDGKIKAIN 169

Query: 147 VEE 149
           VEE
Sbjct: 170 VEE 172


>gi|259417360|ref|ZP_05741279.1| peroxiredoxin-2E-2 [Silicibacter sp. TrichCH4B]
 gi|259346266|gb|EEW58080.1| peroxiredoxin-2E-2 [Silicibacter sp. TrichCH4B]
          Length = 161

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 75/146 (51%), Gaps = 8/146 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V   DL  G+++ +FA+PGAFTPTC    +P F +  D    +G++E+ C+S ND FV
Sbjct: 22  EQVEISDLAQGRKLAIFAVPGAFTPTCHSAHVPSFIRTKDQFAAKGVDEIICVSGNDPFV 81

Query: 89  MNAWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWG+        + +L D    FT  +GM       G   RS RY  +++D  V+   
Sbjct: 82  MKAWGETTGAAEAGISMLADAECAFTDAIGMRFDAPPAGLIGRSKRYAMIVEDGEVKILH 141

Query: 147 VEEGFSDNCATDPYEISSPENVLKVI 172
           +EE     C     E+S+ E +L  +
Sbjct: 142 LEES-PGTC-----EVSAGEALLDAL 161


>gi|312271187|gb|ADQ57291.1| peroxiredoxin V [Argopecten irradians]
          Length = 188

 Score = 89.0 bits (219), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 71/121 (58%), Gaps = 4/121 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VNT + FA  +  +F +PGAFTP CS   LPG+ + +  L  +G++ V C+SVND FVM 
Sbjct: 51  VNTAEAFASGKHIIFGVPGAFTPGCSKTHLPGYIEDFSKLEAKGVKSVNCVSVNDPFVMQ 110

Query: 91  AWGK-KLEIKNVKLLPDGSGEFTRKMG--MLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG+ +     V++L D  G FT ++G  +   KD +G  +R  R+  ++ D  +E   V
Sbjct: 111 AWGENQGAAGKVRMLADTCGAFTSQLGLDLPAVKDVLG-NVRCKRFAMVVNDGKIEKLNV 169

Query: 148 E 148
           E
Sbjct: 170 E 170


>gi|47523086|ref|NP_999309.1| peroxiredoxin-5, mitochondrial [Sus scrofa]
 gi|10305336|gb|AAG13452.2|AF110735_1 peroxiredoxin 5 [Sus scrofa]
          Length = 162

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 78/139 (56%), Gaps = 4/139 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +GI+ V CLSVND FV
Sbjct: 22  KKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGIQVVACLSVNDVFV 81

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFGLRSW-RYGALIKDMVVESW 145
              WG+    +  V+LL D +G F ++   +L       FG R   R+  +I+D +V+S 
Sbjct: 82  TEMWGRAHNTEGKVRLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRFSMVIEDGIVKSL 141

Query: 146 FVEEGFSD-NCATDPYEIS 163
            VE   +   C+  P  IS
Sbjct: 142 NVEPDDTGLTCSLAPNIIS 160


>gi|297833346|ref|XP_002884555.1| hypothetical protein ARALYDRAFT_477906 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297330395|gb|EFH60814.1| hypothetical protein ARALYDRAFT_477906 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 201

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 70/121 (57%), Gaps = 1/121 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F GK+V +F LPGA+T  CS   +P ++   D  + +GI+ V C+SVND + +N W 
Sbjct: 68  SDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVVCVSVNDPYAINGWA 127

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL  K+ ++   D  G+F + +G+         G RS R+ A ++D  V++  VEE  S
Sbjct: 128 EKLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAVNVEEAPS 187

Query: 153 D 153
           D
Sbjct: 188 D 188


>gi|149391021|gb|ABR25528.1| peroxiredoxin 5 cell rescue, defense and virulence [Oryza sativa
           Indica Group]
          Length = 116

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 70/123 (56%), Gaps = 8/123 (6%)

Query: 51  FTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSG 109
           FTPTCS+  +PGF    + L+ +G++++  +SVND FVM AW K   E K+VK L DG G
Sbjct: 1   FTPTCSNQHVPGFINQAEQLKAKGVDDILLVSVNDPFVMKAWAKSYPENKHVKFLADGLG 60

Query: 110 EFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            +T+ +G+ +     G G+RS R+  L  ++ V    +EEG         + IS  E +L
Sbjct: 61  TYTKALGLELDLSEKGLGIRSRRFALLADNLKVTVANIEEG-------GQFTISGAEEIL 113

Query: 170 KVI 172
           K +
Sbjct: 114 KAL 116


>gi|125569838|gb|EAZ11353.1| hypothetical protein OsJ_01220 [Oryza sativa Japonica Group]
          Length = 520

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 74/134 (55%), Gaps = 1/134 (0%)

Query: 21  DGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYC 80
           D   A  +     +D+F GK+V +F LPGA+T  CS   +P ++   D L+ +G++ V C
Sbjct: 52  DEGVATNFSTTPLKDIFHGKKVVIFGLPGAYTGVCSQAHVPSYKNNIDKLKAKGVDSVIC 111

Query: 81  LSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           +SVND + +N W +KL+ K+ ++   D  G F + + + V       G RS R+ A + D
Sbjct: 112 VSVNDPYALNGWAEKLQAKDAIEFYGDFDGSFHKSLDLEVDLSAALLGRRSHRWSAFVDD 171

Query: 140 MVVESWFVEEGFSD 153
             ++++ VE   SD
Sbjct: 172 GKIKAFNVEVAPSD 185


>gi|255630784|gb|ACU15753.1| unknown [Glycine max]
          Length = 197

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 71/121 (58%), Gaps = 1/121 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F  K+V +F LPGA+T  CS+  +P + +  D  + +GI+ V C+++ND + MNAW 
Sbjct: 64  KDIFKDKKVVIFGLPGAYTGVCSNKHVPPYRENIDKFKAKGIDSVICVAINDPYTMNAWA 123

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL+ K+ ++   D  G F + + ++        G RS R+ A + D  V++  VEE  S
Sbjct: 124 EKLQAKDAIEFYGDFDGSFHKSLELVTDLSGALLGTRSERWSAYVVDGKVKALNVEEAPS 183

Query: 153 D 153
           D
Sbjct: 184 D 184


>gi|74354725|gb|AAI03074.1| PRDX5 protein [Bos taurus]
          Length = 162

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF LPGAFTP CS   LPGF +  D L+ +GI+ V CL+VND FV  
Sbjct: 24  VNLAELFKGKKGVLFGLPGAFTPGCSKTHLPGFVEQADALKAKGIQVVACLTVNDVFVTE 83

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGF--GLRSWRYGALIKDMVVESWFV 147
            W +  + +  V+LL D SG F ++  +L+    +      R  R+  +I+D +V+S  V
Sbjct: 84  EWARAHKAEGKVRLLADPSGTFGKETDLLLDDSLLFLFGNHRLKRFSMVIEDGIVKSLNV 143

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  +S
Sbjct: 144 EPDGTGLTCSLAPNILS 160


>gi|126726172|ref|ZP_01742014.1| antioxidant, AhpC/Tsa family protein [Rhodobacterales bacterium
           HTCC2150]
 gi|126705376|gb|EBA04467.1| antioxidant, AhpC/Tsa family protein [Rhodobacterales bacterium
           HTCC2150]
          Length = 162

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 84/166 (50%), Gaps = 12/166 (7%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           + V   LP+ +  +   D     + +++  G++V +F LPGA+T TCS   +P F +  D
Sbjct: 3   LSVGDTLPNATLRYFGDDGPATRSIEEITKGRKVVIFGLPGAYTRTCSAAHVPSFIRTKD 62

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNV--KLLPDGSGEFTRKMGMLVYKDNVGF 126
               +GI+EV C+SVND FVM +WG       V   +L D   EFT+ + ML   + VG 
Sbjct: 63  QFDAKGIDEVICVSVNDVFVMQSWGIDTGATEVGITMLADPVAEFTKAIDMLFTGEPVGL 122

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
             R  R+  + +D VV  +  EE     C      ISS E++L  I
Sbjct: 123 IDRCKRFSLVAEDGVVTVYH-EETEKGGCT-----ISSGEDLLAAI 162


>gi|331213315|ref|XP_003319339.1| hypothetical protein PGTG_01513 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309298329|gb|EFP74920.1| hypothetical protein PGTG_01513 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 170

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 71/117 (60%), Gaps = 1/117 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D + GK++ LF +PGAFT TCS + LP + K   +L+ +GI  +YC++ NDAFVM+ WG
Sbjct: 37  TDQWKGKKIVLFGVPGAFTKTCSANHLPAYVKKAGELKSKGISGIYCIASNDAFVMSGWG 96

Query: 94  KKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           + L   ++V+++ D + ++  + G+ V     G G R  R+  +I D+ V    +EE
Sbjct: 97  RLLGSNEHVEMISDSTLKWLEEAGLTVDLSAHGLGKRGTRFALVIDDLKVTYVGIEE 153


>gi|302683813|ref|XP_003031587.1| hypothetical protein SCHCODRAFT_67750 [Schizophyllum commune H4-8]
 gi|300105280|gb|EFI96684.1| hypothetical protein SCHCODRAFT_67750 [Schizophyllum commune H4-8]
          Length = 171

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 69/106 (65%), Gaps = 1/106 (0%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI 98
           GK+V LF++PGAFTPTC  + LP + K YD+ + +G++ +  ++ ND FVM+ W +   +
Sbjct: 43  GKKVVLFSVPGAFTPTCHVNHLPPYLKKYDEFKAKGVDIIAVVAANDPFVMSGWARVEGL 102

Query: 99  KN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVE 143
           K+ +  L D +  +  ++G+ V   + GFG+R+ R+ A+I D+ V+
Sbjct: 103 KDKILALSDANAAWASQLGLSVDLSSKGFGIRTGRWAAIIDDLTVK 148


>gi|163732598|ref|ZP_02140043.1| antioxidant, AhpC/Tsa family, putative [Roseobacter litoralis Och
           149]
 gi|161393958|gb|EDQ18282.1| antioxidant, AhpC/Tsa family, putative [Roseobacter litoralis Och
           149]
          Length = 162

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 69/132 (52%), Gaps = 8/132 (6%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL--E 97
           ++V +FA+PGAFTPTC    +P F +       +G+EE+ C+SVND FVM AWG+     
Sbjct: 34  RKVVIFAVPGAFTPTCHSAHVPSFVRTKAQFDAKGVEEIICVSVNDPFVMQAWGEATGAT 93

Query: 98  IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCAT 157
              + +L D    FT+ +GM       G   RS RY  L+++  V +   EE     C  
Sbjct: 94  AAGITMLGDADSSFTKALGMDFSAPPAGLTDRSKRYAMLVENGKV-TLLQEEESPGTC-- 150

Query: 158 DPYEISSPENVL 169
              E+S+ E +L
Sbjct: 151 ---EVSAGEALL 159


>gi|146345491|sp|Q9BGI1|PRDX5_BOVIN RecName: Full=Peroxiredoxin-5, mitochondrial; AltName:
           Full=Peroxiredoxin V; Short=Prx-V; AltName:
           Full=Thioredoxin reductase; Flags: Precursor
 gi|296471572|gb|DAA13687.1| peroxiredoxin-5, mitochondrial precursor [Bos taurus]
          Length = 219

 Score = 87.8 bits (216), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF LPGAFTP CS   LPGF +  D L+ +GI+ V CL+VND FV  
Sbjct: 81  VNLAELFKGKKGVLFGLPGAFTPGCSKTHLPGFVEQADALKAKGIQVVACLTVNDVFVTE 140

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGF--GLRSWRYGALIKDMVVESWFV 147
            W +  + +  V+LL D SG F ++  +L+    +      R  R+  +I+D +V+S  V
Sbjct: 141 EWARAHKAEGKVRLLADPSGTFGKETDLLLDDSLLFLFGNHRLKRFSMVIEDGIVKSLNV 200

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  +S
Sbjct: 201 EPDGTGLTCSLAPNILS 217


>gi|27807445|ref|NP_777174.1| peroxiredoxin-5, mitochondrial precursor [Bos taurus]
 gi|12407851|gb|AAG53661.1|AF305564_1 peroxiredoxin 5 [Bos taurus]
          Length = 219

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 78/137 (56%), Gaps = 4/137 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF LPGAFTP CS   LPGF +  D L+ +GI+ V CL+VND FV  
Sbjct: 81  VNLAELFKGKKGVLFGLPGAFTPGCSKTHLPGFVEQADALKAKGIQVVACLTVNDVFVTE 140

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGF--GLRSWRYGALIKDMVVESWFV 147
            W +  + +  V+LL D SG F ++  +L+    +      R  R+  +I+D +V+S  V
Sbjct: 141 EWARTHKAEGKVRLLADPSGTFGKETDLLLDDSLLFLFGNHRLKRFSMVIEDGIVKSLNV 200

Query: 148 E-EGFSDNCATDPYEIS 163
           E +G    C+  P  +S
Sbjct: 201 EPDGTGLTCSLAPNILS 217


>gi|84685320|ref|ZP_01013218.1| AhpC/TSA family protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84666477|gb|EAQ12949.1| AhpC/TSA family protein [Rhodobacterales bacterium HTCC2654]
          Length = 148

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 2/121 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V    L +G++V +F LPGAFT TC+   +P F +  D L+ +G++EV C+SVND FVM 
Sbjct: 11  VELSALTSGRKVVIFGLPGAFTGTCTTAHVPSFIRNMDALKNKGVDEVVCVSVNDPFVMG 70

Query: 91  AWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           AWG      +  + +L D   + T  MG+      VG   RS RY  +  + VV+ +  E
Sbjct: 71  AWGASTGANDAGITMLGDAECKLTEAMGLRFDAPPVGLIARSKRYALMADNGVVKVFQAE 130

Query: 149 E 149
           E
Sbjct: 131 E 131


>gi|149244744|ref|XP_001526915.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146449309|gb|EDK43565.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 193

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 84/153 (54%), Gaps = 17/153 (11%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           D+N Q+  +G  V +  +PGAF+P C+ + +P + K  D  + +G+E+++ ++VND FV 
Sbjct: 46  DLN-QETASGTSVII-GVPGAFSPGCTKNHIPEYLKNLDAFKGKGVEQIFVVAVNDPFVT 103

Query: 90  NAWGKKLEIKN---------VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140
            AWG++L   N         V+ L D +G FTR +G+L     V    RS RY  L++D 
Sbjct: 104 KAWGEQLLKDNSAPTSATEAVRFLADSTGAFTRDLGLLFDATKVFGNERSKRYALLVRDG 163

Query: 141 VVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
            V   FVE    DN + D   +S+   VL +++
Sbjct: 164 KVAEAFVEP---DNTSVD---VSAAPKVLNILQ 190


>gi|50553945|ref|XP_504381.1| YALI0E25091p [Yarrowia lipolytica]
 gi|49650250|emb|CAG79980.1| YALI0E25091p [Yarrowia lipolytica]
          Length = 196

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 3/106 (2%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
            AGK+V   ++PGAFTPTC+ + +P + +  D L+ +G+++V  +S ND FV++AWG+ L
Sbjct: 65  LAGKKVVFVSVPGAFTPTCTANHIPPYIENVDKLKAKGVDKVVVISANDPFVLSAWGRAL 124

Query: 97  EIKNVKLL---PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           +           DG+  F++ +G  V   +VGFG R+ RY  ++ D
Sbjct: 125 KAPKDNFFIFASDGNAAFSKSIGQAVDLASVGFGERTARYAIIVDD 170


>gi|310814993|ref|YP_003962957.1| redoxin [Ketogulonicigenium vulgare Y25]
 gi|308753728|gb|ADO41657.1| redoxin [Ketogulonicigenium vulgare Y25]
          Length = 162

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 4/136 (2%)

Query: 16  ATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI 75
           AT+L  G+   +  +V+   L AG++V +F LPG FT TC+   +P F +       +G+
Sbjct: 12  ATLLRLGAGGVEQVEVDA--LTAGRKVVIFGLPGPFTGTCTTAHVPSFIRTRAAFADKGV 69

Query: 76  EEVYCLSVNDAFVMNAWGKKLE--IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
           +EV C++V+DAFVM AWG        ++ +L D    FT+ +G+      +GF  RS RY
Sbjct: 70  DEVICIAVSDAFVMKAWGDSTGAIAGDISMLADPLSTFTKAIGLNFSNPAIGFVDRSLRY 129

Query: 134 GALIKDMVVESWFVEE 149
               +D VV+   VEE
Sbjct: 130 ALFAEDGVVKVLSVEE 145


>gi|57099689|ref|XP_533241.1| PREDICTED: similar to Peroxiredoxin 5, mitochondrial precursor
           (Prx-V) (Peroxisomal antioxidant enzyme) (PLP)
           (Thioredoxin reductase) (Thioredoxin peroxidase PMP20)
           (Antioxidant enzyme B166) (AOEB166) (TPx type VI) (Liver
           tissue 2D-page spot 71B) (Alu corepre... [Canis
           familiaris]
          Length = 162

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 79/138 (57%), Gaps = 4/138 (2%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           +VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ + CLSVND FV 
Sbjct: 23  EVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFMEQAEALKAKGVQVIACLSVNDVFVT 82

Query: 90  NAWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFG-LRSWRYGALIKDMVVESWF 146
            AWG+       V+LL D +G F ++   +L       FG  R  R+  +I++ +V+S  
Sbjct: 83  EAWGRAHNSGGKVRLLADPTGAFGKETDLLLDDSLVSLFGNHRLKRFSMVIENGIVKSLN 142

Query: 147 VE-EGFSDNCATDPYEIS 163
           VE +G    C+  P  +S
Sbjct: 143 VEPDGTGLTCSLAPNILS 160


>gi|3914387|sp|P56578|MALF3_MALFU RecName: Full=Putative peroxiredoxin; AltName: Full=MF2; AltName:
           Full=Thioredoxin reductase; AltName: Allergen=Mal f 3
 gi|3445492|dbj|BAA32436.1| MF2 [Malassezia furfur]
          Length = 166

 Score = 87.4 bits (215), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 72/119 (60%), Gaps = 1/119 (0%)

Query: 33  TQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW 92
           + + + GK+V + A+PGAFTPTC+ + +P + +   +L+ +G++EV  +S ND FV++AW
Sbjct: 34  SHERWKGKKVVIVAVPGAFTPTCTANHVPPYVEKIQELKSKGVDEVVVISANDPFVLSAW 93

Query: 93  GKKLEIK-NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           G     K N+    D + EF++     +   + G GLR+ RY  +  D+ VE + ++EG
Sbjct: 94  GITEHAKDNLTFAQDVNCEFSKHFNATLDLSSKGMGLRTARYALIANDLKVEYFGIDEG 152


>gi|56698554|ref|YP_168930.1| anti-oxidant AhpCTSA family protein [Ruegeria pomeroyi DSS-3]
 gi|56680291|gb|AAV96957.1| antioxidant, AhpC/Tsa family [Ruegeria pomeroyi DSS-3]
          Length = 161

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 75/142 (52%), Gaps = 6/142 (4%)

Query: 13  MRVATVLPDGS-KAFQWKDVNTQDL---FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           + V   LPD +   F  K   T DL     G++V +F LPGAFT  CS   LP F +   
Sbjct: 2   ISVGDTLPDATFMVFSDKGPETVDLEPKLKGRKVVMFGLPGAFTRGCSMTHLPSFIRTRQ 61

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKK--LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            L  +G++EV C+SVND FVM AWG++       + +L D + EFT+ +G+      VG 
Sbjct: 62  ALADKGVDEVICVSVNDPFVMTAWGQQSGAAEAGITMLADPTAEFTKAIGLAFSAPVVGL 121

Query: 127 GLRSWRYGALIKDMVVESWFVE 148
             R  R+  + +D VV+   +E
Sbjct: 122 YDRCQRFALMAEDGVVKVLNLE 143


>gi|116791600|gb|ABK26037.1| unknown [Picea sitchensis]
          Length = 193

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 80/147 (54%), Gaps = 7/147 (4%)

Query: 27  QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDA 86
           Q+      DLF GK+V +F LPGAFT  CS   +P + K  +  + +G++ V C+SVND 
Sbjct: 53  QFATTPLSDLFGGKKVVIFGLPGAFTGVCSAQHVPSYLKNAEKFKEKGVDSVVCVSVNDP 112

Query: 87  FVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESW 145
           +V+N W +KL+ K  ++   D  G F + + + +       G RS R+ AL+ D  +++ 
Sbjct: 113 YVVNGWAEKLQAKEAIEFYGDFDGRFHKSLELDLDLSAALLGHRSQRWSALVDDGKIKTL 172

Query: 146 FVEEGFSDNCATDPYEISSPENVLKVI 172
            VE+  S+      +++S  E +L  I
Sbjct: 173 NVEKVPSE------FKVSGAETILGQI 193


>gi|294931949|ref|XP_002780067.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239889911|gb|EER11862.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 159

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 66/116 (56%), Gaps = 1/116 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F  K   LF +PGAFTPTC    LP + K YD L+ +G+E + C++VND+FVM AWG
Sbjct: 26  NDVFGKKTGILFGVPGAFTPTCDQTHLPSYLKDYDQLKAKGVEVIACMAVNDSFVMQAWG 85

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           K    +  + +L D   +  + +G+      V   +R  R+ A+I+D  + +  VE
Sbjct: 86  KTTGAEGKIHMLADIKADTAKALGVDFDVTPVLGNVRCKRFAAIIRDGSIAAIEVE 141


>gi|150951285|ref|XP_001387583.2| predicted protein [Scheffersomyces stipitis CBS 6054]
 gi|149388467|gb|EAZ63560.2| predicted protein [Pichia stipitis CBS 6054]
          Length = 177

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 80/146 (54%), Gaps = 20/146 (13%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           FAGK V + A+PGAFTPTC++  +P + K  +  + +G+ ++  LS ND FVM AWGK L
Sbjct: 42  FAGKTVVITAVPGAFTPTCTEQHIPDYLKNLEKFKAKGVSKIVVLSANDPFVMAAWGKAL 101

Query: 97  EIKN----VKLLPDGSGEFTRKMGMLVYKD--NVGFGLRSWRYGALIKDMVVESWFVEE- 149
             K+    +    D   + + ++G     D  + GFG+R+ RY AL+ D   E  F+E  
Sbjct: 102 GYKDEENYIVFATDPLAKISSELGDSYVADLSSAGFGVRTARYAALVVDG--EISFLENE 159

Query: 150 ---GFSDNCATDPYEISSPENVLKVI 172
              GF+        EISS +N+L  I
Sbjct: 160 DSLGFT--------EISSAKNLLDRI 177


>gi|302824165|ref|XP_002993728.1| hypothetical protein SELMODRAFT_236794 [Selaginella moellendorffii]
 gi|300138452|gb|EFJ05220.1| hypothetical protein SELMODRAFT_236794 [Selaginella moellendorffii]
          Length = 159

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 76/155 (49%), Gaps = 13/155 (8%)

Query: 13  MRVATVLPDG------SKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKI 66
           +++   LPDG      +       ++ + LFA KRV L  +PGA+TP      +PG+   
Sbjct: 2   IQLGDTLPDGILYHIDAATRILHILSIRHLFAHKRVLLLGVPGAYTPK----HIPGYITK 57

Query: 67  YDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNV 124
              L  +GI  +YCL+VND FV + W K     N  V+ L DGS  FT+ +GM +     
Sbjct: 58  APSLHAKGITNIYCLTVNDPFVTHQWSKTFADNNDAVRFLADGSATFTKALGMDIDLTRH 117

Query: 125 GFGLRSWRYGALIKDMVVESWFVE-EGFSDNCATD 158
           G G+R  R+     ++ V    VE  G + N A D
Sbjct: 118 GMGVRGRRFVLFADNLRVRKLIVEYPGEAANIAVD 152


>gi|298705866|emb|CBJ29011.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 225

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 69/115 (60%), Gaps = 1/115 (0%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K+ + +D+FAGK+  L  +PGAFTPTCS   LP F      L  +G E V  +SVNDA+V
Sbjct: 48  KEFSIRDVFAGKKGVLVGVPGAFTPTCSAVHLPEFVDKSGVLAAKGAELVAFISVNDAYV 107

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVV 142
           M AW    + K+ V +L DG+G+ +  +GM+V     G G R  R+  +++D VV
Sbjct: 108 MKAWEDSQQAKDKVLMLADGNGDLSAALGMMVDLSAQGMGPRCKRFLCVVEDGVV 162


>gi|116792304|gb|ABK26311.1| unknown [Picea sitchensis]
          Length = 193

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 80/147 (54%), Gaps = 7/147 (4%)

Query: 27  QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDA 86
           Q+      DLF GK+V +F LPGAFT  CS   +P + K  +  + +G++ + C+SVND 
Sbjct: 53  QFATTPLSDLFGGKKVVIFGLPGAFTGVCSAQHVPSYLKNAEKFKEKGVDSIVCVSVNDP 112

Query: 87  FVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESW 145
           +V+N W +KL+ K  ++   D  G F + + + +       G RS R+ AL+ D  +++ 
Sbjct: 113 YVVNGWAEKLQAKEAIEFYGDFDGRFHKSLELDLDLSAALLGHRSQRWSALVDDGKIKTL 172

Query: 146 FVEEGFSDNCATDPYEISSPENVLKVI 172
            VE+  S+      +++S  E +L  I
Sbjct: 173 NVEKVPSE------FKVSGAETILGQI 193


>gi|254456637|ref|ZP_05070066.1| peroxisomal membrane protein a
           (Pmp20)UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate
           aminotransferase
           (UDP-(beta-L-threo-pentapyranosyl-4''-ulose
           diphosphate)aminotransferase), putative [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207083639|gb|EDZ61065.1| peroxisomal membrane protein a
           (Pmp20)UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate
           aminotransferase
           (UDP-(beta-L-threo-pentapyranosyl-4''-ulose
           diphosphate)aminotransferase), putative [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 162

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 78/145 (53%), Gaps = 7/145 (4%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K + T +LF   +  +  +PGAFT  CS   LPG+   ++  + +GI ++ C+SVND  V
Sbjct: 24  KKIFTSELFDNNKTIVIGVPGAFTKVCSAKHLPGYVNNFEVAKKKGISKIICVSVNDPNV 83

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           M AWG   +++N + +  D   EFT+ +G  + + + G G+RS RY  L+++ +      
Sbjct: 84  MKAWGDSQKVENKIFMAADPYCEFTKSIGADIDRFDRGQGMRSTRYTMLVENNIATKIKA 143

Query: 148 EEGFSDNCATDPYEISSPENVLKVI 172
           EE       T   EIS+ EN L  I
Sbjct: 144 EED------TATCEISAAENFLDSI 162


>gi|301762644|ref|XP_002916710.1| PREDICTED: peroxiredoxin-5, mitochondrial-like [Ailuropoda
           melanoleuca]
          Length = 219

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 75/133 (56%), Gaps = 4/133 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  D L+ +G++ + CLSVND FV  
Sbjct: 81  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQADALKAKGVQVIACLSVNDVFVTE 140

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFG-LRSWRYGALIKDMVVESWFV 147
            WG+       V+LL D +G F ++   +L       FG  R  R+  +++D +V+S  V
Sbjct: 141 EWGRAHNSGGKVRLLADPTGAFGKETDLLLDDSLVSLFGNHRLKRFSMVVEDGIVKSLNV 200

Query: 148 E-EGFSDNCATDP 159
           E +G    C+  P
Sbjct: 201 EPDGTGLTCSLAP 213


>gi|260948908|ref|XP_002618751.1| hypothetical protein CLUG_02210 [Clavispora lusitaniae ATCC 42720]
 gi|238848623|gb|EEQ38087.1| hypothetical protein CLUG_02210 [Clavispora lusitaniae ATCC 42720]
          Length = 184

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 76/146 (52%), Gaps = 11/146 (7%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           DVN  D  A  +  +  +PGAF+P CS   +PG+ K   +   +G +  Y ++VNDAFV 
Sbjct: 43  DVNLADETASGKSIIIGVPGAFSPACSASHIPGYFKKLREFNEKGYKSFYIVAVNDAFVT 102

Query: 90  NAWGKKL-----EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVES 144
            AWG+ L         V+ L D  GEF++ + +L          RS RY  +++D VV+ 
Sbjct: 103 KAWGEALFAHLVGTNQVRFLADPKGEFSKDLDVLFDASKFFGNERSKRYALIVEDGVVKK 162

Query: 145 WFVEEGFSDNCATDPYEISSPENVLK 170
            F+E    DN + D   +SS + VLK
Sbjct: 163 TFIEP---DNTSVD---VSSADAVLK 182


>gi|255552287|ref|XP_002517188.1| peroxiredoxin, putative [Ricinus communis]
 gi|223543823|gb|EEF45351.1| peroxiredoxin, putative [Ricinus communis]
          Length = 201

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 78/140 (55%), Gaps = 7/140 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F GK+V +F LPGA+T  CS   +P ++K  D  + +GI+ V C++VND +V+N W 
Sbjct: 68  KDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKKNVDKFKAKGIDSVICVAVNDPYVLNGWA 127

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL+  + ++   D  G F + + +         G RS R+ A +++  V+   VEE  S
Sbjct: 128 EKLQANDAIEFYGDFDGSFHKSLELDKDLSVALLGFRSHRWSAYVENGKVKVLNVEEAPS 187

Query: 153 DNCATDPYEISSPENVLKVI 172
           D      +++S  E +L  I
Sbjct: 188 D------FKVSGGEVILGQI 201


>gi|4138171|emb|CAA09883.1| allergen [Malassezia sympodialis]
          Length = 172

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 73/118 (61%), Gaps = 1/118 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D + GK+V + A+PGAFTP C  + +PGF +  ++L+ +G++EV  ++VNDAFVM+ WG
Sbjct: 38  HDRWKGKKVVVVAIPGAFTPACHQNHIPGFVEKINELKAKGVDEVVVIAVNDAFVMSGWG 97

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
             +  K+ +    D    F++ +G  +   + G G+R+ RY  ++ D+ +  + ++EG
Sbjct: 98  VTVGGKDQIVYACDNDLAFSKALGGTLDLTSGGMGVRTARYAVVLDDLKITYFGMDEG 155


>gi|118590734|ref|ZP_01548135.1| probable peroxiredoxin protein [Stappia aggregata IAM 12614]
 gi|118436710|gb|EAV43350.1| probable peroxiredoxin protein [Stappia aggregata IAM 12614]
          Length = 162

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 79/146 (54%), Gaps = 10/146 (6%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++P+  F++  A    DG       +++T +L +GK V LF +PGAFTPTC  + LPGF 
Sbjct: 8   RLPEATFNIMTA----DGPG-----EMSTGELTSGKTVVLFGVPGAFTPTCHMNHLPGFI 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDN 123
           +  + L+ +G++ +  LSVND FVM+AW K     + +  L D    F    G+ +    
Sbjct: 59  EHAETLKNKGVDTIAVLSVNDVFVMDAWKKASNAGDSITFLSDTGAAFVEAAGLGLGPAP 118

Query: 124 VGFGLRSWRYGALIKDMVVESWFVEE 149
           +   LRS R+  + KD VV    +E+
Sbjct: 119 IFGHLRSQRFALIAKDGVVTFMAIED 144


>gi|225432560|ref|XP_002281011.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|297737000|emb|CBI26201.3| unnamed protein product [Vitis vinifera]
          Length = 201

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 70/121 (57%), Gaps = 1/121 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           ++LF  K+V +F LPGA+T  CS   +P ++K  D  + +GI+ V C++VND + +NAW 
Sbjct: 68  KELFKDKKVVIFGLPGAYTGVCSAQHVPSYKKNVDKFKAKGIDSVICVAVNDPYTLNAWA 127

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KLE K+ ++   D  G F + + + V       G RS R+ A + D  V++  +E   S
Sbjct: 128 EKLEAKDAIEFYGDFDGSFHKSLDLEVDLSAALLGPRSHRWSAYVVDGKVKALNIESAPS 187

Query: 153 D 153
           +
Sbjct: 188 E 188


>gi|167539637|ref|XP_001751178.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163770187|gb|EDQ84010.1| predicted protein [Monosiga brevicollis MX1]
          Length = 195

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 78/145 (53%), Gaps = 4/145 (2%)

Query: 8   QVVFHMRVATVLPDG--SKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65
                ++V   +PD   S+   +  +  ++LFAGK+  LF +PGAFTP C    LPG+ +
Sbjct: 37  SATMALKVGDTIPDATVSETDLYTTLKLRELFAGKKGILFGIPGAFTPGCHKTHLPGYVQ 96

Query: 66  IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
             ++L+ +GI+ + C+ VND FVM  WG+ +     V++L D     ++ +G+       
Sbjct: 97  RAEELKGKGIDVIACMGVNDPFVMAGWGETVGATGKVRMLADKDASASKALGVYWEGSEA 156

Query: 125 GFGL-RSWRYGALIKDMVVESWFVE 148
            FG  R  R+  LI+D +++   VE
Sbjct: 157 IFGSGRCKRFSMLIEDNIIKVINVE 181


>gi|255263083|ref|ZP_05342425.1| hybrid peroxiredoxin hyPrx5 [Thalassiobium sp. R2A62]
 gi|255105418|gb|EET48092.1| hybrid peroxiredoxin hyPrx5 [Thalassiobium sp. R2A62]
          Length = 162

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 73/140 (52%), Gaps = 8/140 (5%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           D+    RV +F LPGA+T  CS   +P F +  D  R +G++ + C++VND FV++AW K
Sbjct: 29  DIIGNGRVVVFGLPGAYTGVCSTAHVPSFVRTADTFRAKGVDRIVCVTVNDPFVLDAWSK 88

Query: 95  KLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
                   + +L D    FT+ +GM      VG   RS RY  L++D VV+   +E    
Sbjct: 89  DTGAGEAGITMLGDPDATFTKAIGMDFTAPPVGLINRSKRYSMLVEDGVVKILNLEGSLG 148

Query: 153 DNCATDPYEISSPENVLKVI 172
           + C     EIS+ E +L  +
Sbjct: 149 E-C-----EISAGETLLDAM 162


>gi|163737141|ref|ZP_02144559.1| Redoxin [Phaeobacter gallaeciensis BS107]
 gi|161389745|gb|EDQ14096.1| Redoxin [Phaeobacter gallaeciensis BS107]
          Length = 162

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 75/146 (51%), Gaps = 8/146 (5%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V+  +L  G+ V +FA+PGAFTPTC    +P F +  D L  +G++E+ C++ ND FV
Sbjct: 22  EQVSMAELTKGRTVAIFAVPGAFTPTCHSAHVPSFIRNKDALTAKGVDEIICIAGNDPFV 81

Query: 89  MNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AW +        + +L D    FT  +GM +     G   RS RY  L +D  VE   
Sbjct: 82  MKAWSEATGAGAAGITMLSDAECGFTDAIGMRLDAPAAGLIGRSLRYAMLARDGKVEIMN 141

Query: 147 VEEGFSDNCATDPYEISSPENVLKVI 172
            E+     C     E+S+ E +L+ I
Sbjct: 142 AEDN-PGQC-----ELSAGEALLEAI 161


>gi|281350661|gb|EFB26245.1| hypothetical protein PANDA_004844 [Ailuropoda melanoleuca]
          Length = 157

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 75/133 (56%), Gaps = 4/133 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  D L+ +G++ + CLSVND FV  
Sbjct: 19  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQADALKAKGVQVIACLSVNDVFVTE 78

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFG-LRSWRYGALIKDMVVESWFV 147
            WG+       V+LL D +G F ++   +L       FG  R  R+  +++D +V+S  V
Sbjct: 79  EWGRAHNSGGKVRLLADPTGAFGKETDLLLDDSLVSLFGNHRLKRFSMVVEDGIVKSLNV 138

Query: 148 E-EGFSDNCATDP 159
           E +G    C+  P
Sbjct: 139 EPDGTGLTCSLAP 151


>gi|218678137|ref|ZP_03526034.1| Redoxin domain protein [Rhizobium etli CIAT 894]
          Length = 133

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           ++ T+ LF+GKRV LFA+PGAFTPTCS + LPG+ +  D +  +G++++  ++VND  VM
Sbjct: 28  EITTEQLFSGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILGKGVDDIAVIAVNDWHVM 87

Query: 90  NAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
            AW +    +  +  L D    FT+ +G+         GLRS RY
Sbjct: 88  GAWAQSSGGLGKIHFLADWDAGFTKAVGLDADLSAGSLGLRSKRY 132


>gi|6755114|ref|NP_036151.1| peroxiredoxin-5, mitochondrial precursor [Mus musculus]
 gi|20141789|sp|P99029|PRDX5_MOUSE RecName: Full=Peroxiredoxin-5, mitochondrial; AltName:
           Full=Antioxidant enzyme B166; Short=AOEB166; AltName:
           Full=Liver tissue 2D-page spot 2D-0014IV; AltName:
           Full=PLP; AltName: Full=Peroxiredoxin V; Short=Prx-V;
           AltName: Full=Peroxisomal antioxidant enzyme; AltName:
           Full=Thioredoxin peroxidase PMP20; AltName:
           Full=Thioredoxin reductase; Flags: Precursor
 gi|6166491|gb|AAF04855.1|AF197951_1 thioredoxin peroxidase PMP20 [Mus musculus]
 gi|14198231|gb|AAH08174.1| Peroxiredoxin 5 [Mus musculus]
 gi|148701310|gb|EDL33257.1| peroxiredoxin 5, isoform CRA_b [Mus musculus]
          Length = 210

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VN  +LF GK+  LF +PGAFTP CS   LPGF +    L+ +G + V CLSVND FV
Sbjct: 70  KKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFV 129

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFGLRSW-RYGALIKDMVVESW 145
           +  WG+  + +  V+LL D +G F +    +L       FG R   R+  +I + +V++ 
Sbjct: 130 IEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKAL 189

Query: 146 FVE-EGFSDNCATDPYEIS 163
            VE +G    C+  P  +S
Sbjct: 190 NVEPDGTGLTCSLAPNILS 208


>gi|74193815|dbj|BAE22835.1| unnamed protein product [Mus musculus]
          Length = 199

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VN  +LF GK+  LF +PGAFTP CS   LPGF +    L+ +G + V CLSVND FV
Sbjct: 59  KKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFV 118

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFGLRSW-RYGALIKDMVVESW 145
           +  WG+  + +  V+LL D +G F +    +L       FG R   R+  +I + +V++ 
Sbjct: 119 IEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKAL 178

Query: 146 FVE-EGFSDNCATDPYEIS 163
            VE +G    C+  P  +S
Sbjct: 179 NVEPDGTGLTCSLAPNILS 197


>gi|114638295|ref|XP_001164542.1| PREDICTED: peroxiredoxin 5 isoform 3 [Pan troglodytes]
          Length = 180

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 76  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 135

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
            WG+  + +  V+LL D +G F ++  +L+
Sbjct: 136 EWGRAHKAEGKVRLLADPTGAFGKETDLLL 165


>gi|6746357|gb|AAF27532.1|AF124994_1 peroxisomal membrane protein 20 [Mus musculus]
 gi|10129957|gb|AAG13450.1|AF110733_1 peroxiredoxin 5 [Mus musculus]
 gi|12832325|dbj|BAB22058.1| unnamed protein product [Mus musculus]
 gi|12833934|dbj|BAB22720.1| unnamed protein product [Mus musculus]
          Length = 162

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VN  +LF GK+  LF +PGAFTP CS   LPGF +    L+ +G + V CLSVND FV
Sbjct: 22  KKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFV 81

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFGLRSW-RYGALIKDMVVESW 145
           +  WG+  + +  V+LL D +G F +    +L       FG R   R+  +I + +V++ 
Sbjct: 82  IEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKAL 141

Query: 146 FVE-EGFSDNCATDPYEIS 163
            VE +G    C+  P  +S
Sbjct: 142 NVEPDGTGLTCSLAPNILS 160


>gi|332249784|ref|XP_003274038.1| PREDICTED: peroxiredoxin-5, mitochondrial-like [Nomascus
           leucogenys]
          Length = 203

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ V CLSVNDAFV  
Sbjct: 80  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTG 139

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
            WG+  + +  V+LL D +G F ++  +L+
Sbjct: 140 EWGRAHKAEGKVRLLADPTGAFGKETDLLL 169


>gi|74220848|dbj|BAE31390.1| unnamed protein product [Mus musculus]
          Length = 208

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VN  +LF GK+  LF +PGAFTP CS   LPGF +    L+ +G + V CLSVND FV
Sbjct: 68  KKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFV 127

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFGLRSW-RYGALIKDMVVESW 145
           +  WG+  + +  V+LL D +G F +    +L       FG R   R+  +I + +V++ 
Sbjct: 128 IEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKAL 187

Query: 146 FVE-EGFSDNCATDPYEIS 163
            VE +G    C+  P  +S
Sbjct: 188 NVEPDGTGLTCSLAPNILS 206


>gi|302822111|ref|XP_002992715.1| hypothetical protein SELMODRAFT_135849 [Selaginella moellendorffii]
 gi|300139456|gb|EFJ06196.1| hypothetical protein SELMODRAFT_135849 [Selaginella moellendorffii]
          Length = 183

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 79/175 (45%), Gaps = 29/175 (16%)

Query: 13  MRVATVLPDG------SKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTC----------- 55
           +++   LPDG      +       ++ + LFA KRV L  +PGA+TP+C           
Sbjct: 2   IQLGDTLPDGILYHIDAATRILHILSIRHLFAHKRVLLLGVPGAYTPSCRQVTFFPRSCL 61

Query: 56  ---------SDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN--VKLL 104
                    S   +PG+      L  +GI  +YCL+VND FV + W K     N  V+ L
Sbjct: 62  ISSYSLRLSSVEHIPGYISKAPSLHAKGITNIYCLTVNDPFVTHQWSKTFADNNDAVRFL 121

Query: 105 PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE-EGFSDNCATD 158
            DGS  FT+ +GM +     G G+R  R+     ++ V    VE  G + N A D
Sbjct: 122 ADGSATFTKALGMDIDLTRHGMGVRGRRFVLFADNLRVRKLIVEYPGEAANIAVD 176


>gi|294888096|ref|XP_002772348.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239876467|gb|EER04164.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 159

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 65/116 (56%), Gaps = 1/116 (0%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F  K   LF +PGAFTPTC    LP + K YD L+ +G+E + C++VND+FVM AWG
Sbjct: 26  NDVFGKKTGILFGVPGAFTPTCDQTHLPSYLKDYDQLKGKGVEVIACMAVNDSFVMQAWG 85

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           K       + +L D   +  + +G+      V   +R  R+ A+I+D  + +  VE
Sbjct: 86  KATGAGGKIHMLADIKADTAKALGVDFDVTPVLGNVRCKRFAAIIRDGSIAAIEVE 141


>gi|217071078|gb|ACJ83899.1| unknown [Medicago truncatula]
          Length = 199

 Score = 85.1 bits (209), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 75/140 (53%), Gaps = 7/140 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F  K+V +F LPGA+T  CS   +P ++   +  + +G++ V C+SVND + +NAW 
Sbjct: 66  NDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKDNIEKFKAKGVDSVICVSVNDPYTVNAWA 125

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +KL+ K+ ++   D  G F + + +         G RS R+ A + D  V++  VEE  S
Sbjct: 126 EKLQAKDAIEFYGDFDGSFHKSLELTTDLSGALLGTRSERWSAYVVDGKVKALNVEEAPS 185

Query: 153 DNCATDPYEISSPENVLKVI 172
           D       ++S  E +L  I
Sbjct: 186 D------VKVSGAETILGQI 199


>gi|157093003|gb|ABV22156.1| peroxiredoxin V protein [Perkinsus chesapeaki]
          Length = 159

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 68/115 (59%), Gaps = 1/115 (0%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           D+F  K+  LF +PGAFTPTC    LPG+ K Y+ L+ +G+E + C++VND+FVM AWGK
Sbjct: 27  DVFGKKKGILFGVPGAFTPTCDQTHLPGYLKDYEKLKEKGVEVIACMAVNDSFVMQAWGK 86

Query: 95  KLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
                  + +L D   +  + +G+      V   +R  R+ A+I+D  +++  VE
Sbjct: 87  ASGADGKIHMLADIKADTAKALGVDFDVTPVLGNVRCKRFAAVIEDGKIKAIEVE 141


>gi|163740446|ref|ZP_02147840.1| AhpC/TSA family protein [Phaeobacter gallaeciensis 2.10]
 gi|161386304|gb|EDQ10679.1| AhpC/TSA family protein [Phaeobacter gallaeciensis 2.10]
          Length = 162

 Score = 84.7 bits (208), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 65/123 (52%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V+  +L  G+ V +FA+PGAFTPTC    +P F +  D L  +G++E+ C++ ND FV
Sbjct: 22  EQVSMAELTKGRTVAIFAVPGAFTPTCHSAHVPSFIRNKDALAAKGVDEIICIAGNDPFV 81

Query: 89  MNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AW +        + +L D    FT  +GM +     G   RS RY  L +D  VE   
Sbjct: 82  MKAWSEATGAGAAGITMLSDAECGFTDAIGMRLDAPAAGLIGRSLRYAMLARDGKVEIMN 141

Query: 147 VEE 149
            E+
Sbjct: 142 AED 144


>gi|261192801|ref|XP_002622807.1| peroxisomal matrix protein [Ajellomyces dermatitidis SLH14081]
 gi|239589289|gb|EEQ71932.1| peroxisomal matrix protein [Ajellomyces dermatitidis SLH14081]
 gi|327355324|gb|EGE84181.1| peroxiredoxin [Ajellomyces dermatitidis ATCC 18188]
          Length = 166

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 66/103 (64%), Gaps = 9/103 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK-- 94
           +A K+V LFA+PGAFTP+CS++ LPG+ K  + +R +G++ +  ++ NDAFVM+AWGK  
Sbjct: 43  WADKKVVLFAVPGAFTPSCSENHLPGYIKNQESMRAKGVDVIAVIAYNDAFVMSAWGKAN 102

Query: 95  KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           K+   ++  L DG   F++ +G  +       G R+ RY  +I
Sbjct: 103 KVTGNDILFLSDGDAAFSKNIGWTM-------GERTGRYALII 138


>gi|163915087|ref|NP_001106525.1| peroxiredoxin 5 [Xenopus (Silurana) tropicalis]
 gi|159155852|gb|AAI54897.1| LOC100127718 protein [Xenopus (Silurana) tropicalis]
          Length = 162

 Score = 84.3 bits (207), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (58%), Gaps = 4/123 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+ +D+FA K+  LF +PGAFTP CS   LPG+     +L+  G   + C+SVND FVM+
Sbjct: 23  VSIRDVFANKKGVLFGVPGAFTPGCSKTHLPGYVAQAAELKSRGAAVIACISVNDIFVMS 82

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG--FG-LRSWRYGALIKDMVVESWF 146
            W K  + +  V +L D  G+F +  G+L+ K  +   FG  R  R+  +++D  V++  
Sbjct: 83  EWAKAYDAEGKVCMLADPCGDFAKACGLLLDKKELSELFGNQRCKRFSMVVEDGKVKAIN 142

Query: 147 VEE 149
           VEE
Sbjct: 143 VEE 145


>gi|307941659|ref|ZP_07657014.1| peroxiredoxin-2E-1, ic [Roseibium sp. TrichSKD4]
 gi|307775267|gb|EFO34473.1| peroxiredoxin-2E-1, ic [Roseibium sp. TrichSKD4]
          Length = 160

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 72/142 (50%), Gaps = 6/142 (4%)

Query: 13  MRVATVLPDGSKAFQWKD----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           ++V   LPD +      D    V + DLF GK V LF +PGAFTPTC  + LPGF +   
Sbjct: 3   IKVGDQLPDATFKVMTADGPGEVKSADLFGGKTVVLFGVPGAFTPTCHMNHLPGFIEHEA 62

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFG 127
            ++ +G++ +  +SVND FVM+AW K       V  L D    F + +G+       G  
Sbjct: 63  TIKAKGVDTIGVVSVNDLFVMDAWEKASSATGKVSFLSDTDASFVQSIGLSFDAPIFGHA 122

Query: 128 LRSWRYGALIKDMVVESWFVEE 149
            R+ R+  + KD  V    VEE
Sbjct: 123 -RAQRFALIAKDGEVTFLSVEE 143


>gi|299739322|ref|XP_001835206.2| thioredoxin-dependent peroxidase [Coprinopsis cinerea okayama7#130]
 gi|298403721|gb|EAU86553.2| thioredoxin-dependent peroxidase [Coprinopsis cinerea okayama7#130]
          Length = 171

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 84/152 (55%), Gaps = 14/152 (9%)

Query: 13  MRVATVLPDGS-KAFQWKDVNTQDLFAG------------KRVFLFALPGAFTPTCSDHQ 59
           ++V   +P+ + K   W +    +L  G            K+V + ++PGAFTPTC  + 
Sbjct: 5   IKVGDAIPEATFKYIPWTEALENNLACGSPVELSTNDWKNKKVVIVSVPGAFTPTCHTNH 64

Query: 60  LPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGML 118
           LP F + YD+ + +G++ +  L+ ND FVM+ WG+   +K+ +  + D + E+++K+G+ 
Sbjct: 65  LPPFLQKYDEFKKKGVDVIAVLAANDPFVMSGWGRFEGLKDKILTISDTNAEWSKKLGLE 124

Query: 119 VYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
                 G G+R+ RY  ++++ VV+   VE G
Sbjct: 125 KDLSAHGLGIRTARYAIILENNVVKYLGVESG 156


>gi|294899585|ref|XP_002776665.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239883820|gb|EER08481.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 166

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 66/115 (57%), Gaps = 1/115 (0%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           D+F  K   LF +PGAFTPTC    LP + K Y+ L+ +G+E + C++VND+FVM AWGK
Sbjct: 27  DVFGMKTGILFGVPGAFTPTCDQTHLPSYLKDYEQLKAKGVEVIACMAVNDSFVMQAWGK 86

Query: 95  KLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
               +  + +L D   +  + +G+      V   +R  R+ A+I+D  + +  VE
Sbjct: 87  ATGAEGKIHMLADIKADTAKALGVDFDVTPVLGNVRCKRFAAVIRDGKIAAIEVE 141


>gi|119385056|ref|YP_916112.1| redoxin domain-containing protein [Paracoccus denitrificans PD1222]
 gi|119374823|gb|ABL70416.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Paracoccus
           denitrificans PD1222]
          Length = 168

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 84/160 (52%), Gaps = 14/160 (8%)

Query: 19  LPDGS----KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           LP+G+     A   ++V   DL  G  V +FA+PGA+TPTC++  +P F K   + R +G
Sbjct: 17  LPEGTLLKLGANGPEEVAAADLAQG-LVAIFAVPGAYTPTCTNAHMPSFVKNAANFRDKG 75

Query: 75  IEEVYCLSVNDAFVMNAWGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWR 132
           +  + C++VND FV   W       +  +++L D  G FT+ +GM +       G RS R
Sbjct: 76  VSRLVCITVNDPFVAGKWAADTGATDAGIEVLADADGSFTKALGMNIQGAGWVNG-RSKR 134

Query: 133 YGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           Y  L+ D  +E   VEE      A     +SS E++L+++
Sbjct: 135 YAMLVSDGTIEELQVEE------APSACSVSSGESLLELV 168


>gi|294949205|ref|XP_002786095.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239900223|gb|EER17891.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 159

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 72/131 (54%), Gaps = 4/131 (3%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           D+F  K   LF +PGAFTPTC    LP + K Y+ L+ +G+E + C++VND+FVM AWGK
Sbjct: 27  DVFGMKTGILFGVPGAFTPTCDQTHLPSYLKDYEQLKAKGVEVIACMAVNDSFVMQAWGK 86

Query: 95  KLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE---G 150
               +  + +L D   +  + +G+      V   +R  R+ A+I+D  + +  VE    G
Sbjct: 87  VTGAEGKIHMLADIKADTAKALGVDFDVTPVLGNVRCKRFAAVIRDGKIAAIEVEPDNVG 146

Query: 151 FSDNCATDPYE 161
            S   A D Y+
Sbjct: 147 ASCTLAKDIYK 157


>gi|109109506|ref|XP_001114433.1| PREDICTED: peroxiredoxin-5, mitochondrial-like, partial [Macaca
           mulatta]
          Length = 123

 Score = 84.0 bits (206), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 59/90 (65%), Gaps = 1/90 (1%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +LF GK+  LF +PGAFTP CS   LPGF +  + L+ +G++ + CLSVNDAFV  
Sbjct: 19  VNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVLACLSVNDAFVTG 78

Query: 91  AWGKKLEIKN-VKLLPDGSGEFTRKMGMLV 119
            WG+  + +  V+LL D +G F ++  +L+
Sbjct: 79  EWGRAHKAEGKVRLLADPTGAFGKETDLLL 108


>gi|189095941|pdb|2PWJ|A Chain A, Structure Of A Mitochondrial Type Ii Peroxiredoxin From
           Pisum Sativum
 gi|189095942|pdb|2PWJ|B Chain B, Structure Of A Mitochondrial Type Ii Peroxiredoxin From
           Pisum Sativum
 gi|189095943|pdb|2PWJ|C Chain C, Structure Of A Mitochondrial Type Ii Peroxiredoxin From
           Pisum Sativum
 gi|189095944|pdb|2PWJ|D Chain D, Structure Of A Mitochondrial Type Ii Peroxiredoxin From
           Pisum Sativum
 gi|189095945|pdb|2PWJ|E Chain E, Structure Of A Mitochondrial Type Ii Peroxiredoxin From
           Pisum Sativum
 gi|189095946|pdb|2PWJ|F Chain F, Structure Of A Mitochondrial Type Ii Peroxiredoxin From
           Pisum Sativum
          Length = 171

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 76/140 (54%), Gaps = 7/140 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F  K+V +F LPGA+T  CS   +P ++   D  + +G++ V C+++ND + +NAW 
Sbjct: 38  NDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKHNIDKFKAKGVDSVICVAINDPYTVNAWA 97

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +K++ K+ ++   D  G F + + +         G+RS R+ A + D  V++  VEE  S
Sbjct: 98  EKIQAKDAIEFYGDFDGSFHKSLELTTDLSAGLLGIRSERWSAYVVDGKVKALNVEESPS 157

Query: 153 DNCATDPYEISSPENVLKVI 172
           D       ++S  E +L  I
Sbjct: 158 D------VKVSGAETILGQI 171


>gi|47775654|emb|CAG30523.1| mitochondrial peroxiredoxin [Pisum sativum]
          Length = 199

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 76/140 (54%), Gaps = 7/140 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F  K+V +F LPGA+T  CS   +P ++   D  + +G++ V C+++ND + +NAW 
Sbjct: 66  NDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKHNIDKFKAKGVDSVICVAINDPYTVNAWA 125

Query: 94  KKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           +K++ K+ ++   D  G F + + +         G+RS R+ A + D  V++  VEE  S
Sbjct: 126 EKIQAKDAIEFYGDFDGSFHKSLELTTDLSAGLLGIRSERWSAYVVDGKVKALNVEESPS 185

Query: 153 DNCATDPYEISSPENVLKVI 172
           D       ++S  E +L  I
Sbjct: 186 D------VKVSGAETILGQI 199


>gi|16758404|ref|NP_446062.1| peroxiredoxin-5, mitochondrial precursor [Rattus norvegicus]
 gi|20138819|sp|Q9R063|PRDX5_RAT RecName: Full=Peroxiredoxin-5, mitochondrial; AltName:
           Full=Antioxidant enzyme B166; Short=AOEB166; AltName:
           Full=PLP; AltName: Full=Peroxiredoxin V; Short=Prx-V;
           AltName: Full=Peroxisomal antioxidant enzyme; AltName:
           Full=Thioredoxin peroxidase PMP20; AltName:
           Full=Thioredoxin reductase; Flags: Precursor
 gi|6103726|gb|AAF03751.1|AF110732_1 antioxidant enzyme B166 [Rattus norvegicus]
          Length = 213

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VN  +LF  K+  LF +PGAFTP CS   LPGF +    L+ +G + V CLSVNDAFV
Sbjct: 73  KKVNLAELFKDKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDAFV 132

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFGLRSW-RYGALIKDMVVESW 145
              WG+  + +  V+LL D +G F ++   +L       FG R   R+  +I   VV++ 
Sbjct: 133 TAEWGRAHQAEGKVQLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRFSMVIDKGVVKAL 192

Query: 146 FVE-EGFSDNCATDPYEIS 163
            VE +G    C+  P  +S
Sbjct: 193 NVEPDGTGLTCSLAPNILS 211


>gi|194466270|gb|ACF74364.1| thioredoxin fold [Arachis hypogaea]
          Length = 93

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 5/86 (5%)

Query: 13 MRVATVLPDGSKAFQWKD-----VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
          + V  V+PDG+ AF   D     V+   L  GK+V +F +PGAFTPTCS   +PGF +  
Sbjct: 4  IAVGDVIPDGTLAFLDNDNKPQSVSIHSLAKGKKVIIFGVPGAFTPTCSLKHVPGFIERA 63

Query: 68 DDLRCEGIEEVYCLSVNDAFVMNAWG 93
          ++L+ +G++E+ C+SVND FVM +W 
Sbjct: 64 EELKGKGVDEIICISVNDPFVMKSWA 89


>gi|50549203|ref|XP_502072.1| YALI0C21043p [Yarrowia lipolytica]
 gi|49647939|emb|CAG82392.1| YALI0C21043p [Yarrowia lipolytica]
          Length = 162

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 82/157 (52%), Gaps = 11/157 (7%)

Query: 16  ATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI 75
           A  + +G+ + Q+   + QD+       +  +PGAF+P CS   +PG+  ++  L+  G+
Sbjct: 12  AVTVREGTPSCQF---DLQDVTKEGTHIIVGVPGAFSPACSAGHVPGYINLFPKLKERGV 68

Query: 76  EEVYCLSVNDAFVMNAWGKKLE--IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
           + V+ ++VNDAFV NAW + L+    +V+++ D +GEF+   G L          RS RY
Sbjct: 69  KTVWVVAVNDAFVTNAWAESLDAPADDVRIISDQAGEFSLAFGTLFDASEFFGNKRSARY 128

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
            A+I D  V   F E    D    D   +S  ENVLK
Sbjct: 129 AAVIMDGKVVEVFEE---PDKTGLD---VSKAENVLK 159


>gi|239610173|gb|EEQ87160.1| peroxiredoxin [Ajellomyces dermatitidis ER-3]
          Length = 166

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 65/103 (63%), Gaps = 9/103 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK-- 94
           +A K+V LFA+PGAFTP+CS++ LPG+    + +R +G++ +  ++ NDAFVM+AWGK  
Sbjct: 43  WADKKVVLFAVPGAFTPSCSENHLPGYIMNQESMRAKGVDVIAVIAYNDAFVMSAWGKAN 102

Query: 95  KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           K+   ++  L DG   F++ +G  +       G R+ RY  +I
Sbjct: 103 KVTGNDILFLSDGDAAFSKNIGWTM-------GERTGRYALII 138


>gi|218660838|ref|ZP_03516768.1| putative hydroperoxide reductase protein [Rhizobium etli IE4771]
          Length = 128

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 53/95 (55%)

Query: 5  QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
          Q+P V F  R        S+           + A   + LF+LPGAFTPTCS  QL  FE
Sbjct: 4  QVPIVTFRTRARRRAHIRSQPLPLGRRQPTTISAVSALILFSLPGAFTPTCSTFQLRDFE 63

Query: 65 KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK 99
            YD+ +  GI+E+YCLSVN +FVMNAW K   +K
Sbjct: 64 SPYDEFQKRGIDEIYCLSVNGSFVMNAWAKAQGLK 98


>gi|12844914|dbj|BAB26548.1| unnamed protein product [Mus musculus]
          Length = 211

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 74/135 (54%), Gaps = 4/135 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VN  +LF GK+  LF +PGAFTP C    LPGF +    L+ +G + V CLSVND FV
Sbjct: 71  KKVNLAELFKGKKGVLFGVPGAFTPGCYKTHLPGFVEQAGALKAKGAQVVACLSVNDVFV 130

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFGLRSW-RYGALIKDMVVESW 145
           +  WG+  + +  V+LL D +G F +    +L       FG R   R+  +I + +V++ 
Sbjct: 131 IEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKAL 190

Query: 146 FVE-EGFSDNCATDP 159
            VE +G    C+  P
Sbjct: 191 NVEPDGTGLTCSLAP 205


>gi|330861653|emb|CBX71831.1| hybrid peroxiredoxin hyPrx5 [Yersinia enterocolitica W22703]
          Length = 160

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 4/84 (4%)

Query: 89  MNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           MNAW      +N+  +PDG+GEFT+ M MLV K ++GFG RSWRY  L+++ VVE  FVE
Sbjct: 1   MNAWKADQHAENITFIPDGNGEFTKGMNMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVE 60

Query: 149 EGFSDNCATDPYEISSPENVLKVI 172
                N   DP+E+S  + +LK +
Sbjct: 61  P----NKPGDPFEVSDADTMLKYL 80


>gi|319411494|emb|CBQ73538.1| related to peroxisomal membrane protein 20 [Sporisorium reilianum]
          Length = 173

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 75/141 (53%), Gaps = 11/141 (7%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           D   GK V +  +PGAFTP CS  Q+PG+ +   +   +G++++Y ++VND F + AW  
Sbjct: 41  DNLTGKSV-IVGVPGAFTPPCS-SQVPGYIEHAAEFESKGVKDIYIVAVNDQFTVQAWKG 98

Query: 95  KL---EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           KL   +  NV  L D +G FT+ +G       +    RS RY  +++  VV   FVE+  
Sbjct: 99  KLGGDKAPNVHFLADDTGAFTKALGQDFDATGLLGNHRSKRYAFVVEGGVVRKAFVEDNA 158

Query: 152 SDNCATDPYEISSPENVLKVI 172
            D        ++S ENVLK I
Sbjct: 159 PD------VTVTSAENVLKAI 173


>gi|254438894|ref|ZP_05052388.1| Redoxin superfamily [Octadecabacter antarcticus 307]
 gi|198254340|gb|EDY78654.1| Redoxin superfamily [Octadecabacter antarcticus 307]
          Length = 162

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 2/113 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V+   L  G+ V +FA+PGA+T TC+   +P + +  D  +  G+EE+ C++VND FV
Sbjct: 23  EGVSVSTLTEGRTVVIFAVPGAYTGTCTTAHVPSYIRTKDTFKERGVEEIICVAVNDPFV 82

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           M AWG+        + +  D    FT+ MGM       G   RS RY  L+ D
Sbjct: 83  MGAWGEMTGATEAGITMAGDPESTFTKAMGMEFSAPPAGLIDRSKRYAMLVVD 135


>gi|326469456|gb|EGD93465.1| hypothetical protein TESG_01009 [Trichophyton tonsurans CBS 112818]
 gi|326485201|gb|EGE09211.1| AhpC/TSA family protein [Trichophyton equinum CBS 127.97]
          Length = 183

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 73/142 (51%), Gaps = 12/142 (8%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN     A  +  +   PGAFTP CS   +PGF    +  + +   +V+ +SVNDAFV  
Sbjct: 50  VNLASELAKGKGVIVGTPGAFTPGCSLSHVPGF---LNHPKLKDAGKVFVVSVNDAFVTK 106

Query: 91  AWGKKLEIK---NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG+ L+ +    V+ L D SGEF R+M +L     V    RS RY  L++D  V   FV
Sbjct: 107 AWGESLDPQKKSGVRFLADASGEFNRQMDLLFSSAKVFGNDRSKRYALLVEDGKVVKAFV 166

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN + D   +S  E VL
Sbjct: 167 EP---DNTSVD---VSRAEKVL 182


>gi|302755146|ref|XP_002960997.1| hypothetical protein SELMODRAFT_71806 [Selaginella moellendorffii]
 gi|300171936|gb|EFJ38536.1| hypothetical protein SELMODRAFT_71806 [Selaginella moellendorffii]
          Length = 156

 Score = 81.3 bits (199), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (53%), Gaps = 1/114 (0%)

Query: 27  QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDA 86
           Q+       +F  KRV +F  PGAFT  C+   +P + K  + L+ +G++ V C++VND 
Sbjct: 16  QFATTPLSQIFKDKRVVIFGTPGAFTGVCTKGHVPSYTKNVEQLKSKGVDSVICVAVNDP 75

Query: 87  FVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           + +NAW +K+  K  ++   D  G F + +G+         GLRS R+ A + D
Sbjct: 76  YTINAWAEKMNAKGKIQFFADFDGSFHKSLGLECDLSKALLGLRSQRWSAFVDD 129


>gi|303274805|ref|XP_003056717.1| peroxiredoxin, bacteria-like protein [Micromonas pusilla CCMP1545]
 gi|226461069|gb|EEH58362.1| peroxiredoxin, bacteria-like protein [Micromonas pusilla CCMP1545]
          Length = 173

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 73/147 (49%), Gaps = 5/147 (3%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V+     AGK+  +  LPGAFTPT S  Q+PG+    D L+  GI+EV    VNDA VM+
Sbjct: 24  VDMTSRLAGKKTIVVGLPGAFTPTUSTCQVPGYLAGQDALKAAGIDEVLVYCVNDAAVMS 83

Query: 91  AWGKKLEI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGL---RSWRYGALIKDMVVESW 145
           AW   ++I   N+  L D   E T+ +G+ +        L   R  R+ A + D VV+  
Sbjct: 84  AWADHMKIAGSNLTFLCDPRLELTKALGLELNHPGPMSKLGNTRCKRFAAYVVDGVVKHI 143

Query: 146 FVEEGFSDNCATDPYEISSPENVLKVI 172
            V E   D    D  E S  +N+L  I
Sbjct: 144 EVSEAEDDPAGDDRPEASCIDNMLAKI 170


>gi|51261175|gb|AAH78771.1| Peroxiredoxin 5 [Rattus norvegicus]
 gi|149062198|gb|EDM12621.1| peroxiredoxin 5, isoform CRA_c [Rattus norvegicus]
          Length = 213

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 75/139 (53%), Gaps = 4/139 (2%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VN  +LF  K+  LF +PGAFTP CS   LPGF +    L+ +G + V CLSVND FV
Sbjct: 73  KKVNLAELFKDKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFV 132

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKM-GMLVYKDNVGFGLRSW-RYGALIKDMVVESW 145
              WG+  + +  V+LL D +G F ++   +L       FG R   R+  +I   VV++ 
Sbjct: 133 TAEWGRAHQAEGKVQLLADPTGAFGKETDLLLDDSLVSLFGNRRLKRFSMVIDKGVVKAL 192

Query: 146 FVE-EGFSDNCATDPYEIS 163
            VE +G    C+  P  +S
Sbjct: 193 NVEPDGTGLTCSLAPNILS 211


>gi|302504433|ref|XP_003014175.1| hypothetical protein ARB_07480 [Arthroderma benhamiae CBS 112371]
 gi|291177743|gb|EFE33535.1| hypothetical protein ARB_07480 [Arthroderma benhamiae CBS 112371]
          Length = 247

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 74/138 (53%), Gaps = 13/138 (9%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           +L +GK V +   PGAFTP CS   +PGF    +  + +   +V+ +SVNDAFV  AWG+
Sbjct: 119 ELASGKGV-IVGTPGAFTPGCSLSHVPGF---LNHPKLKDAGKVFVVSVNDAFVTKAWGE 174

Query: 95  KLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
            L+      V+ L D SGEF R+M +L     V    RS RY  +++D  V   FVE   
Sbjct: 175 SLDPHKKSGVRFLADASGEFNRQMDLLFSSAKVFGNDRSKRYALVVEDGKVVKAFVEP-- 232

Query: 152 SDNCATDPYEISSPENVL 169
            DN + D   +S  E VL
Sbjct: 233 -DNTSVD---VSRAEKVL 246


>gi|71018187|ref|XP_759324.1| hypothetical protein UM03177.1 [Ustilago maydis 521]
 gi|46099174|gb|EAK84407.1| hypothetical protein UM03177.1 [Ustilago maydis 521]
          Length = 172

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 74/141 (52%), Gaps = 11/141 (7%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           D   GK + +  +PGAFTP CS  Q+PG+ +   + + +G+E +Y ++VND F + AW +
Sbjct: 40  DNLVGKSI-IVGVPGAFTPPCSS-QVPGYIQHASEFQSKGVEAIYIVAVNDQFTVKAWKE 97

Query: 95  KL---EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           KL       V  L D +G FT+ +G       +    RS RY  +++  VV   FVE+  
Sbjct: 98  KLGADTAPTVHFLADDTGAFTQAVGQDFDASGLLGNHRSKRYAFVVEGGVVRKAFVEDNA 157

Query: 152 SDNCATDPYEISSPENVLKVI 172
            D        ++S ENVLK I
Sbjct: 158 PD------VTVTSAENVLKAI 172


>gi|219124446|ref|XP_002182514.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405860|gb|EEC45801.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 204

 Score = 80.5 bits (197), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 68/136 (50%), Gaps = 3/136 (2%)

Query: 21  DGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYC 80
           +GS       V  +DLF  + V LF +P  FT TCS+   PG++ + DD    G++ + C
Sbjct: 54  EGSNMADDNAVTLKDLFKKQTVALFGVPAPFTGTCSNEHYPGYKALADDFLQAGVDRIVC 113

Query: 81  LSVNDAFVMNAWGKKL--EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIK 138
            SV D + M+ W K L  + + +  + D    F +  G+    D V  G RS R+  ++ 
Sbjct: 114 YSVADPYAMDGWAKALKNDAEKITFMADPDSLFAKAYGLDAAYDAVSLGQRSIRFSMVVA 173

Query: 139 DMVVESWF-VEEGFSD 153
           D  VE++  V++   D
Sbjct: 174 DGKVEAFHKVDDAVKD 189


>gi|302767182|ref|XP_002967011.1| hypothetical protein SELMODRAFT_68725 [Selaginella moellendorffii]
 gi|300165002|gb|EFJ31610.1| hypothetical protein SELMODRAFT_68725 [Selaginella moellendorffii]
          Length = 156

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 61/114 (53%), Gaps = 1/114 (0%)

Query: 27  QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDA 86
           Q+       +F  KRV +F  PGAFT  C+   +P + K  + L+ +G++ V C++VND 
Sbjct: 16  QFATTPLSQIFKDKRVVIFGTPGAFTGVCTKGHVPSYTKNVEQLKSKGVDSVICVAVNDP 75

Query: 87  FVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           + +NAW +K+  K  ++   D  G F + +G+         GLRS R+ A + D
Sbjct: 76  YTINAWAEKMNAKGKIQFFADFDGGFHKSLGLECDLSKALLGLRSQRWSAFVDD 129


>gi|68471010|ref|XP_720512.1| potential alkyl hydroperoxide reductase [Candida albicans SC5314]
 gi|68471468|ref|XP_720282.1| potential alkyl hydroperoxide reductase [Candida albicans SC5314]
 gi|46442142|gb|EAL01434.1| potential alkyl hydroperoxide reductase [Candida albicans SC5314]
 gi|46442382|gb|EAL01672.1| potential alkyl hydroperoxide reductase [Candida albicans SC5314]
 gi|238881601|gb|EEQ45239.1| hypothetical protein CAWG_03554 [Candida albicans WO-1]
          Length = 176

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 78/151 (51%), Gaps = 16/151 (10%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++ + LF    V + A+PGAFTPTC++  +P + K   D + +G++++  LS ND FVM 
Sbjct: 33  LDLKSLFPNNTVVVTAVPGAFTPTCTEQHIPDYLKHLKDFKDKGVKKIIVLSANDPFVMA 92

Query: 91  AWGKKL----EIKNVKLLPDGSGEFTRKMGMLVYKD--NVGFGLRSWRYGALIKDMVVES 144
           AW K L    E   V    D +   ++++G     D  + G GLR  RY +++ +  +  
Sbjct: 93  AWAKALGYTDEENYVIFATDPNASISKELGDGFVADLTSAGMGLRLQRYASIVVNGEITY 152

Query: 145 WFVEE--GFSDNCATDPYEISSPENVLKVIR 173
              E+  GFS        EISS E +LK I 
Sbjct: 153 LETEDSLGFS--------EISSAETILKRIH 175


>gi|241954344|ref|XP_002419893.1| peroxiredoxin type-2, putative; thiol-specific peroxiredoxin,
           putative [Candida dubliniensis CD36]
 gi|223643234|emb|CAX42108.1| peroxiredoxin type-2, putative [Candida dubliniensis CD36]
          Length = 176

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 78/151 (51%), Gaps = 16/151 (10%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           ++ + LF    V + A+PGAFTPTC++  +P + K   D + +G++++  LS ND FVM 
Sbjct: 33  LDLKSLFQNSTVVVTAVPGAFTPTCTEQHIPDYLKHLKDFKDKGVKKIIVLSANDPFVMA 92

Query: 91  AWGKKL----EIKNVKLLPDGSGEFTRKMGMLVYKD--NVGFGLRSWRYGALIKDMVVES 144
           AW K L    E   V    D +   ++++G     D  + G GLR  RY +++ +  +  
Sbjct: 93  AWAKALGYTDEENYVIFATDPNASISKELGDGFVADLTSAGMGLRLQRYASIVVNGEITY 152

Query: 145 WFVEE--GFSDNCATDPYEISSPENVLKVIR 173
              E+  GFS        EISS E +LK I 
Sbjct: 153 LETEDSLGFS--------EISSAETILKRIH 175


>gi|240273274|gb|EER36795.1| allergen Asp F3 [Ajellomyces capsulatus H143]
 gi|325095756|gb|EGC49066.1| conserved hypothetical protein [Ajellomyces capsulatus H88]
          Length = 166

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 62/103 (60%), Gaps = 9/103 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LFA+PGAFTP+CS   LPG+ K   +LR +G++ V  L+ NDAFVM+AWGK  
Sbjct: 43  WADKKVVLFAVPGAFTPSCSASHLPGYIKNLKNLRAKGVDVVAVLASNDAFVMSAWGKAN 102

Query: 97  EI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
            +   ++  L D    F++ +G  +       G R+ RY  +I
Sbjct: 103 MVTGNDILFLSDPDAAFSKSIGWTM-------GERTARYALII 138


>gi|5326864|gb|AAD42074.1|AF144753_1 peroxisomal membrane protein [Penicillium citrinum]
          Length = 167

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 80/143 (55%), Gaps = 14/143 (9%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           + N    FA K+V LFALPGAFTP CS + +P + +   +LR +G+++V  L+ NDA+VM
Sbjct: 35  NYNASKEFANKKVVLFALPGAFTPVCSANHVPEYIQKLPELRAKGVDQVAVLAYNDAYVM 94

Query: 90  NAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           +AWGK   +   ++  L D   +F++ +G   + D  G   R++RY  +I +  +     
Sbjct: 95  SAWGKANGVTGDDILFLSDPEAKFSKSIG---WADEEG---RTYRYVLVIDNGKIIYAAK 148

Query: 148 EEGFSDNCATDPYEISSPENVLK 170
           E       A +  E+S  ++VLK
Sbjct: 149 E------AAKNSLELSRADHVLK 165


>gi|255710461|ref|XP_002551514.1| KLTH0A01188p [Lachancea thermotolerans]
 gi|238932891|emb|CAR21072.1| KLTH0A01188p [Lachancea thermotolerans]
          Length = 187

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 72/133 (54%), Gaps = 8/133 (6%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI 98
           GK + +  +P AF+P CS   +PG+     DL+ +G+++V+   VNDAFV  AW + L+ 
Sbjct: 60  GKHI-IVGVPAAFSPACSASHVPGYIAHLSDLQAKGVQDVFVTCVNDAFVTKAWAESLKT 118

Query: 99  -KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCAT 157
            + V ++ D  GEF +    L   + V    R++RY  +++D  V S F E    D    
Sbjct: 119 PEQVHIVADTKGEFAKSGDTLFDSEEVFGNKRNYRYAVVVEDGKVVSTFEEP---DKTGV 175

Query: 158 DPYEISSPENVLK 170
           +   +SS ENVLK
Sbjct: 176 N---VSSAENVLK 185


>gi|213407120|ref|XP_002174331.1| thioredoxin peroxidase [Schizosaccharomyces japonicus yFS275]
 gi|212002378|gb|EEB08038.1| thioredoxin peroxidase [Schizosaccharomyces japonicus yFS275]
          Length = 155

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 77/142 (54%), Gaps = 10/142 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N +  F   ++ +  +PGAFTP CS  Q+PG+    +D   +G+  +Y ++VND FV NA
Sbjct: 19  NNKVEFPDGKIIIVGVPGAFTPPCSS-QVPGYVVAAEDFAAKGVVGIYIVAVNDVFVTNA 77

Query: 92  WGKKL---EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           W K L     +NV  + D +GEFT+ +G       +   +RS RY  + ++  V+  +VE
Sbjct: 78  WKKNLGFENYENVHFVSDWNGEFTKALGAEFDASGLLGPVRSKRYALVAENKKVQKIYVE 137

Query: 149 EGFSDNCATDPYEISSPENVLK 170
              +D       ++SS +NVL+
Sbjct: 138 GVVTD------VDVSSAQNVLE 153


>gi|327308890|ref|XP_003239136.1| hypothetical protein TERG_01118 [Trichophyton rubrum CBS 118892]
 gi|326459392|gb|EGD84845.1| hypothetical protein TERG_01118 [Trichophyton rubrum CBS 118892]
          Length = 183

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN     A  +  +   PGAFTP CS   +PGF    +  + +   +V+ +SVNDAFV  
Sbjct: 50  VNLASELASGKGVIVGTPGAFTPGCSLSHVPGF---LNHPKLKDAGKVFVVSVNDAFVTK 106

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG+ L+      V+ L D SGEF R+M +L     V    RS RY  +++D  V   FV
Sbjct: 107 AWGESLDPHKKSGVRFLADASGEFNRQMDLLFSSAKVFGNDRSKRYALVVEDGRVVKAFV 166

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN + D   +S  E VL
Sbjct: 167 EP---DNTSVD---VSRAEKVL 182


>gi|302661069|ref|XP_003022206.1| hypothetical protein TRV_03687 [Trichophyton verrucosum HKI 0517]
 gi|291186141|gb|EFE41588.1| hypothetical protein TRV_03687 [Trichophyton verrucosum HKI 0517]
          Length = 183

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN     A  +  +   PGAFTP CS   +PGF    +  + +   +V+ +SVNDAFV  
Sbjct: 50  VNLASELASGKGVIVGTPGAFTPGCSLSHVPGF---LNHPKLKDAGKVFVVSVNDAFVTK 106

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG+ L+      V+ L D SGEF R+M +L     V    RS RY  +++D  V   FV
Sbjct: 107 AWGESLDPHKKSGVRFLADASGEFNRQMDLLFSSAKVFGNDRSKRYALVVEDGKVVKAFV 166

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN + D   +S  E VL
Sbjct: 167 EP---DNTSVD---VSRAEKVL 182


>gi|226287613|gb|EEH43126.1| peroxisomal matrix protein [Paracoccidioides brasiliensis Pb18]
          Length = 166

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 63/108 (58%), Gaps = 9/108 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LF++PGAFTP+CS   LPG+ K+ +D +  G++ V  ++ ND FVM+AWGK  
Sbjct: 43  WANKKVVLFSVPGAFTPSCSISHLPGYIKLLNDFKANGVDIVAVIAYNDPFVMSAWGKAN 102

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVV 142
            IK  ++  L D    F++ +G  +       G R+ RY  +I    V
Sbjct: 103 NIKGDDILFLSDTDTAFSKSIGWTL-------GERTARYALIIDHGTV 143


>gi|225678115|gb|EEH16399.1| peroxisomal matrix protein [Paracoccidioides brasiliensis Pb03]
          Length = 166

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 63/108 (58%), Gaps = 9/108 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LF++PGAFTP+CS   LPG+ K+ +D +  G++ V  ++ ND FVM+AWGK  
Sbjct: 43  WANKKVVLFSVPGAFTPSCSISHLPGYIKLLNDFKANGVDIVAVIAYNDPFVMSAWGKAN 102

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVV 142
            IK  ++  L D    F++ +G  +       G R+ RY  +I    V
Sbjct: 103 NIKGDDILFLSDTDTAFSKSIGWTL-------GERTARYALIIDHGTV 143


>gi|154280557|ref|XP_001541091.1| hypothetical protein HCAG_03188 [Ajellomyces capsulatus NAm1]
 gi|150411270|gb|EDN06658.1| hypothetical protein HCAG_03188 [Ajellomyces capsulatus NAm1]
          Length = 166

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 62/103 (60%), Gaps = 9/103 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LFA+PGAFTP+CS   LPG+ K   +LR +G++ V  L+ NDAFVM+AWGK  
Sbjct: 43  WADKKVVLFAVPGAFTPSCSASHLPGYIKNLQNLRAKGVDVVAVLASNDAFVMSAWGKAN 102

Query: 97  EI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
            +   ++  L D    F++ +G  +       G R+ RY  +I
Sbjct: 103 MVTGNDILFLSDPDAGFSKSIGWTM-------GERTARYALII 138


>gi|115681541|ref|XP_796387.2| PREDICTED: similar to peroxiredoxin V protein [Strongylocentrotus
          purpuratus]
 gi|115931401|ref|XP_001183945.1| PREDICTED: similar to peroxiredoxin V protein [Strongylocentrotus
          purpuratus]
          Length = 101

 Score = 79.7 bits (195), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 45/67 (67%)

Query: 31 VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
          VN  +LF GK   LFA+PGAFTP CS   LPG+   +D L+ +G E + C++VND FVM 
Sbjct: 23 VNVAELFKGKTGVLFAVPGAFTPGCSKTHLPGYVGDFDKLKAKGAEVIACVAVNDPFVMA 82

Query: 91 AWGKKLE 97
          AWGK  E
Sbjct: 83 AWGKAHE 89


>gi|121704078|ref|XP_001270303.1| allergen Asp F3 [Aspergillus clavatus NRRL 1]
 gi|119398447|gb|EAW08877.1| allergen Asp F3 [Aspergillus clavatus NRRL 1]
          Length = 168

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 77/143 (53%), Gaps = 14/143 (9%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           + N    +A K+V LFALPGAFTP CS   +P + +   ++R +G++ V  L+ NDA+VM
Sbjct: 36  NYNASKEWADKKVILFALPGAFTPVCSARHVPEYIERLPEIRAKGVDVVAVLAYNDAYVM 95

Query: 90  NAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           +AWGK  ++   ++  L D    F++ +G   + D  G   R+ RY  +I    V    +
Sbjct: 96  SAWGKANQVTGDDILFLSDPEARFSKSIG---WADEEG---RTRRYAIVIDHGKVTYAAL 149

Query: 148 EEGFSDNCATDPYEISSPENVLK 170
           E       A +  E SS ENV+K
Sbjct: 150 EP------AKNHLEFSSAENVIK 166


>gi|254464692|ref|ZP_05078103.1| peroxiredoxin TPx2 [Rhodobacterales bacterium Y4I]
 gi|206685600|gb|EDZ46082.1| peroxiredoxin TPx2 [Rhodobacterales bacterium Y4I]
          Length = 162

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 55/103 (53%), Gaps = 2/103 (1%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI 98
           G++V +FA+PGAFT TC    +P F +  D    +G++E+ CL+ ND FVM+ WG     
Sbjct: 32  GRKVVIFAVPGAFTSTCHSAHVPSFIRTKDQFAAKGVDEIICLAGNDPFVMSIWGDNTGA 91

Query: 99  --KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
               + +L D    FT  +GM       G   RS RY  L++D
Sbjct: 92  TEAGITMLSDAECTFTESIGMRFDAPPAGLIGRSMRYAMLVED 134


>gi|254579551|ref|XP_002495761.1| ZYRO0C02442p [Zygosaccharomyces rouxii]
 gi|238938652|emb|CAR26828.1| ZYRO0C02442p [Zygosaccharomyces rouxii]
          Length = 179

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 74/138 (53%), Gaps = 8/138 (5%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +++  GK + +  +P AF+P CS   +PG+   + +L+ +G+++V+   VNDAF   AW 
Sbjct: 47  EEVAKGKSI-IVGVPAAFSPACSASHVPGYVNHFQELKNKGVQQVFVTPVNDAFTTKAWA 105

Query: 94  KKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           + L + + ++++ D  G F +    L   + V    RS R+ A+++D  V   F E    
Sbjct: 106 QSLNLPQGIRIIADSQGAFAKAGDHLFDSEKVFGNKRSIRFAAIVQDGKVVQEFAEP--- 162

Query: 153 DNCATDPYEISSPENVLK 170
           D    D   +SS ENVLK
Sbjct: 163 DKIGLD---VSSAENVLK 177


>gi|255951000|ref|XP_002566267.1| Pc22g23760 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211593284|emb|CAP99664.1| Pc22g23760 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 170

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 80/136 (58%), Gaps = 14/136 (10%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LFALPGAFTP CS + +P + +   +LR +G+++V  L+ NDA+VM+AWGK  
Sbjct: 45  WADKKVILFALPGAFTPVCSANHVPEYIQKLPELRAKGVDQVAVLAYNDAYVMSAWGKAN 104

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDN 154
            +   ++  L D   +F++ +G   + D  G   R++RY  +I D    ++  +E     
Sbjct: 105 GVTGDDILFLSDPDAKFSKSIG---WADEEG---RTYRY-VIIIDHGKVTYAAKE----- 152

Query: 155 CATDPYEISSPENVLK 170
            A +  E+SS + VLK
Sbjct: 153 AAKNTLELSSADAVLK 168


>gi|323455800|gb|EGB11668.1| selenoprotein [Aureococcus anophagefferens]
          Length = 201

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 87/191 (45%), Gaps = 23/191 (12%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGS--KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDH 58
           + R   P       V   +PD S    F  K+V+ +   AG++V L  LPGAFTPT S+ 
Sbjct: 9   LARLARPGGRAFAAVGDAIPDVSLDVEFPPKEVSLKQRLAGRKVILVGLPGAFTPTUSET 68

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN----------------VK 102
           Q+PG+    D L+ +GI+EV    VND+ VM  W     +++                V 
Sbjct: 69  QVPGYLGAADALKAKGIDEVIIFCVNDSAVMKFWAVDQGVEDNDKCYSMRYVNRSEQKVS 128

Query: 103 LLPDGSGEFTRKMGMLVYKDN----VGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATD 158
            + D SG  TR + + +  +N    +G G R  R+ A   D V+++  V E   D    D
Sbjct: 129 FMADTSGALTRALDLELTHENPVRDLGPG-RCKRFAAYYDDGVLKALEVSEAPGDPAGDD 187

Query: 159 PYEISSPENVL 169
               S  +N+L
Sbjct: 188 DPHASCVDNML 198


>gi|3914386|sp|P56577|MALF2_MALFU RecName: Full=Putative peroxiredoxin; AltName: Full=MF1; AltName:
           Full=Thioredoxin reductase; AltName: Allergen=Mal f 2
 gi|3445490|dbj|BAA32435.1| MF1 [Malassezia furfur]
          Length = 177

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 33  TQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW 92
           T+D + GK+V + ++PGA+TP C    +P   K  D+L+ +G++ VY ++ ND FVM AW
Sbjct: 42  TRDEWKGKKVVIVSIPGAYTPICHQQHIPPLVKRVDELKAKGVDAVYVIASNDPFVMAAW 101

Query: 93  GKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           G     K+ V    D    F++ +G  +      FG R+ RY  +I D  +  +  +EG
Sbjct: 102 GNFNNAKDKVVFATDIDLAFSKALGATIDLSAKHFGERTARYALIIDDNKIVDFASDEG 160


>gi|254452642|ref|ZP_05066079.1| peroxiredoxin TPx2 [Octadecabacter antarcticus 238]
 gi|198267048|gb|EDY91318.1| peroxiredoxin TPx2 [Octadecabacter antarcticus 238]
          Length = 158

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 64/123 (52%), Gaps = 2/123 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           + V+   L  G+ + +FA+ GA+T TC+   +P F +  D  +  G+EE+ C+SVND FV
Sbjct: 19  EGVSVSTLTEGRTMVIFAVTGAYTGTCTTAHVPSFIRTKDTFKERGVEEIICVSVNDPFV 78

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M AWG+        + ++ D    FT+ MGM       G   RS RY  L+ D  V+   
Sbjct: 79  MGAWGEMTGATEAGITMVGDPESAFTKAMGMEFSAPPAGLIDRSKRYAMLVIDGEVKVLN 138

Query: 147 VEE 149
            EE
Sbjct: 139 EEE 141


>gi|225558028|gb|EEH06313.1| allergen Asp F3 [Ajellomyces capsulatus G186AR]
          Length = 166

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 63/105 (60%), Gaps = 10/105 (9%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LFA+PGAFTP+CS   LPG+ K    LR +G++ V  L+ NDAFVM+AWGK  
Sbjct: 43  WADKKVVLFAVPGAFTPSCSASHLPGYIKNLQKLRAKGVDVVAVLASNDAFVMSAWGKAN 102

Query: 97  EI--KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
            +   ++  L D    F++ +G  +       G R+ RY ALI D
Sbjct: 103 MVTGNDILFLSDPDAAFSKSIGWTM-------GERTARY-ALILD 139


>gi|212526614|ref|XP_002143464.1| allergen Asp F3 [Penicillium marneffei ATCC 18224]
 gi|210072862|gb|EEA26949.1| allergen Asp F3 [Penicillium marneffei ATCC 18224]
          Length = 167

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 79/143 (55%), Gaps = 14/143 (9%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V +FALPGAFTP CS   +PG+ +    LR +G++ V  L+ NDA+VM+A
Sbjct: 37  NASKEWADKKVVVFALPGAFTPVCSAAHVPGYIENLSALRAKGVDVVAVLAYNDAYVMSA 96

Query: 92  WGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           WGK   +   ++  L D   +F++ +G   + D  G   R++RY  +I    V   F ++
Sbjct: 97  WGKANAVTGDDILFLSDPDAKFSKSIG---WADEEG---RTYRYAIVIDHGKV--IFAKK 148

Query: 150 GFSDNCATDPYEISSPENVLKVI 172
             S N      E++  E++LK +
Sbjct: 149 ERSKNV----LEVTDAESILKAL 167


>gi|296823636|ref|XP_002850476.1| peroxisomal matrix protein [Arthroderma otae CBS 113480]
 gi|238838030|gb|EEQ27692.1| peroxisomal matrix protein [Arthroderma otae CBS 113480]
          Length = 168

 Score = 79.0 bits (193), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 76/137 (55%), Gaps = 16/137 (11%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           L+A K+V L A+PGAFTPTC+ + LPGF     +L+ +G++ V  ++ ND FVM+AWGK 
Sbjct: 42  LWADKKVVLVAVPGAFTPTCTVNHLPGFIAKLSELKAKGVDIVAFIAYNDPFVMSAWGKA 101

Query: 96  LEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSD 153
             +   ++  L D   +F++ +G  V+ D      R+ RY  +I    V        +++
Sbjct: 102 NNVTGDDILFLSDSGSKFSKSLGWTVHDD------RTARYAIVIDHGKVT-------YAE 148

Query: 154 NCATDP-YEISSPENVL 169
             A+ P   +SS E VL
Sbjct: 149 KEASPPALSVSSAEAVL 165


>gi|50427407|ref|XP_462316.1| DEHA2G17864p [Debaryomyces hansenii CBS767]
 gi|49657986|emb|CAG90822.1| DEHA2G17864p [Debaryomyces hansenii]
          Length = 173

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 72/138 (52%), Gaps = 12/138 (8%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI 98
           GK++ L A PGAFTPTC++  +P + K  +  + +G++ V  ++ ND FV  AWGK L  
Sbjct: 40  GKKIVLTAAPGAFTPTCTEEHIPNYLKNLEKFKSKGVDRVVVVTANDPFVNAAWGKALGS 99

Query: 99  KN----VKLLPDGSGEFTRKMGMLVYKD--NVGFGLRSWRYGALIKDMVVESWFVEEGFS 152
           K+    V    D +   ++++G     D    G G+R+ RY ++I D  V     EEG  
Sbjct: 100 KDESNYVIFASDPNAALSKELGDNFVADLTKAGLGIRTARYTSIIDDGKVSFLESEEGLG 159

Query: 153 DNCATDPYEISSPENVLK 170
            +      EISS   VL+
Sbjct: 160 FS------EISSASTVLE 171


>gi|67903410|ref|XP_681961.1| PM20_ASPFU PROBABLE PEROXISOMAL MEMBRANE PROTEIN PMP20 (ALLERGEN
           ASP F 3) [Aspergillus nidulans FGSC A4]
 gi|74680531|sp|Q5ASN8|PMP20_EMENI RecName: Full=Putative peroxiredoxin pmp20; AltName:
           Full=Peroxisomal membrane protein pmp20; AltName:
           Full=Thioredoxin reductase
 gi|40741051|gb|EAA60241.1| PM20_ASPFU PROBABLE PEROXISOMAL MEMBRANE PROTEIN PMP20 (ALLERGEN
           ASP F 3) [Aspergillus nidulans FGSC A4]
          Length = 168

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 75/136 (55%), Gaps = 14/136 (10%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LFALPGAFTP CS   +P + +   ++R +G++ V  L+ NDAFVM+AWGK  
Sbjct: 43  WADKKVILFALPGAFTPVCSARHVPEYIERLPEIRAKGVDVVAVLAYNDAFVMSAWGKAN 102

Query: 97  EIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDN 154
            +KN  +  L D   +F++ +G   + D  G   R+ RY  ++    V    +E      
Sbjct: 103 GVKNDDILFLSDPEAKFSKSIG---WADEEG---RTKRYAIVLDHGKVTYAALEP----- 151

Query: 155 CATDPYEISSPENVLK 170
            A +  E SS E V+K
Sbjct: 152 -AKNHLEFSSAETVIK 166


>gi|323455880|gb|EGB11748.1| selenoprotein [Aureococcus anophagefferens]
          Length = 175

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 77/154 (50%), Gaps = 13/154 (8%)

Query: 16  ATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI 75
           + VL DG + F  K VN  D   GK+V +  LPGAFTP  S HQ+PG+    + L+ +GI
Sbjct: 11  SVVLCDGMQ-FPPKLVNVADEIKGKKVLIMGLPGAFTPCUSGHQVPGYLAAEEQLKAKGI 69

Query: 76  EEVYCLSVNDAFVMNAWGKKLEIKNVKLL---PDGSGEFTRKMGMLVYKDNVGFGL---R 129
           E++Y   VND  VM AW K   I    L+    D     T+ +GM +        L   R
Sbjct: 70  EKMYVFCVND--VMKAWAKDQSITGDGLITFWADNLSVLTKALGMAISHPGPSGDLGPAR 127

Query: 130 SWRYGALIKDMVVE----SWFVEEGFSDNCATDP 159
           S R+  L++D VV+    S   ++   DN A  P
Sbjct: 128 SKRFVLLVEDGVVKFVQLSEAPDDPAGDNDAASP 161


>gi|241948915|ref|XP_002417180.1| peroxiredoxin PRDX5, putative [Candida dubliniensis CD36]
 gi|223640518|emb|CAX44772.1| peroxiredoxin PRDX5, putative [Candida dubliniensis CD36]
          Length = 184

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 77/146 (52%), Gaps = 12/146 (8%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           DVN  +  A  +  L  +PGAF+P CS   +PG+ K       +G +  + ++VND FV 
Sbjct: 44  DVNLAEETATGKTILIGVPGAFSPACSSSHVPGYIKNIRAFNDKGYQRFFVVAVNDPFVT 103

Query: 90  NAWGKKL----EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFG-LRSWRYGALIKDMVVES 144
            AWG++L      + ++   D +G FT+++ +L +     FG  RS RY  +I+D  V  
Sbjct: 104 KAWGEQLLESVAGQQIRFFADSTGAFTKELDLL-FDARKAFGNERSKRYALIIEDGKVVK 162

Query: 145 WFVEEGFSDNCATDPYEISSPENVLK 170
            FVE    DN + D   +S+ + VL+
Sbjct: 163 SFVE---PDNTSVD---VSAAQKVLE 182


>gi|149062197|gb|EDM12620.1| peroxiredoxin 5, isoform CRA_b [Rattus norvegicus]
          Length = 179

 Score = 78.2 bits (191), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 53/87 (60%), Gaps = 1/87 (1%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K VN  +LF  K+  LF +PGAFTP CS   LPGF +    L+ +G + V CLSVND FV
Sbjct: 73  KKVNLAELFKDKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFV 132

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRK 114
              WG+  + +  V+LL D +G F ++
Sbjct: 133 TAEWGRAHQAEGKVQLLADPTGAFGKE 159


>gi|315053899|ref|XP_003176324.1| peroxiredoxin-5 [Arthroderma gypseum CBS 118893]
 gi|311338170|gb|EFQ97372.1| peroxiredoxin-5 [Arthroderma gypseum CBS 118893]
          Length = 186

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN     A  +  +   PGAFTP CS   +PGF    +  + +   +V+ +SVNDAFV  
Sbjct: 53  VNLASELASGKGVVVGTPGAFTPGCSLSHVPGF---LNHPKLKDAGKVFVVSVNDAFVTK 109

Query: 91  AWGKKLEIK---NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG+ L+ +    V+ L D SGEF R++ +L     V    R  RY  L++D  V   FV
Sbjct: 110 AWGESLDPQKKSGVRFLADASGEFNRQLDLLFSSAKVFGNDRCKRYALLVEDGKVVKAFV 169

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN + D   +S  E VL
Sbjct: 170 EP---DNTSVD---VSRAEKVL 185


>gi|68480197|ref|XP_715909.1| potential peroxiredoxin [Candida albicans SC5314]
 gi|46437554|gb|EAK96898.1| potential peroxiredoxin [Candida albicans SC5314]
          Length = 184

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (52%), Gaps = 12/146 (8%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           D+N  +  A  +  L  +PGAF+P CS   +PG+ K       +G +  + ++VND FV 
Sbjct: 44  DINLAEETASGKTILIGVPGAFSPACSASHVPGYIKNIRAFNDKGYQRFFVVAVNDPFVT 103

Query: 90  NAWGKKL----EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFG-LRSWRYGALIKDMVVES 144
            AWG++L      + ++   D +G FT+++ +L +     FG  RS RY  +I+D  V  
Sbjct: 104 KAWGEQLLESVAGQQIRFFADSTGAFTKELDLL-FDARKAFGNERSKRYALIIEDGKVVK 162

Query: 145 WFVEEGFSDNCATDPYEISSPENVLK 170
            FVE    DN + D   +S+ + VL+
Sbjct: 163 SFVE---PDNTSVD---VSAAQKVLE 182


>gi|68480311|ref|XP_715859.1| potential peroxiredoxin [Candida albicans SC5314]
 gi|46437502|gb|EAK96847.1| potential peroxiredoxin [Candida albicans SC5314]
          Length = 184

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (52%), Gaps = 12/146 (8%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           D+N  +  A  +  L  +PGAF+P CS   +PG+ K       +G +  + ++VND FV 
Sbjct: 44  DINLAEETASGKTILIGVPGAFSPACSASHVPGYIKNIRAFNDKGYQRFFVVAVNDPFVT 103

Query: 90  NAWGKKL----EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFG-LRSWRYGALIKDMVVES 144
            AWG++L      + ++   D +G FT+++ +L +     FG  RS RY  +I+D  V  
Sbjct: 104 KAWGEQLLESVAGQQIRFFADSTGAFTKELDLL-FDARKAFGNERSKRYALIIEDGKVVK 162

Query: 145 WFVEEGFSDNCATDPYEISSPENVLK 170
            FVE    DN + D   +S+ + VL+
Sbjct: 163 SFVE---PDNTSVD---VSAAQKVLE 182


>gi|238879003|gb|EEQ42641.1| hypothetical protein CAWG_00860 [Candida albicans WO-1]
          Length = 184

 Score = 77.8 bits (190), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (52%), Gaps = 12/146 (8%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           D+N  +  A  +  L  +PGAF+P CS   +PG+ K       +G +  + ++VND FV 
Sbjct: 44  DINLAEETASGKTILIGVPGAFSPACSASHVPGYIKNIRAFNDKGYQRFFVVAVNDPFVT 103

Query: 90  NAWGKKL----EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFG-LRSWRYGALIKDMVVES 144
            AWG++L      + ++   D +G FT+++ +L +     FG  RS RY  +I+D  V  
Sbjct: 104 KAWGEQLLESVAGQQIRFFADSTGAFTKELDLL-FDARKAFGNERSKRYALIIEDGKVVK 162

Query: 145 WFVEEGFSDNCATDPYEISSPENVLK 170
            FVE    DN + D   +S+ + VL+
Sbjct: 163 SFVE---PDNTSVD---VSAAQKVLE 182


>gi|145247318|ref|XP_001395908.1| peroxiredoxin pmp20 [Aspergillus niger CBS 513.88]
 gi|134080642|emb|CAK41307.1| unnamed protein product [Aspergillus niger]
          Length = 168

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 74/136 (54%), Gaps = 14/136 (10%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LFALPGAFTP CS   +P + +   ++R +G++ V  L+ NDA+VM+AWGK  
Sbjct: 43  WADKKVILFALPGAFTPVCSARHVPEYLEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKAN 102

Query: 97  EIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDN 154
           ++ N  +  L D   +F++ +G   + D  G   R+ RY  +I    V     E      
Sbjct: 103 QVTNDDILFLSDPEAKFSKSIG---WADEEG---RTGRYAIIIDHGKVTYAKREP----- 151

Query: 155 CATDPYEISSPENVLK 170
            A +  E SS E VLK
Sbjct: 152 -AKNHLEFSSAETVLK 166


>gi|115386734|ref|XP_001209908.1| hypothetical protein ATEG_07222 [Aspergillus terreus NIH2624]
 gi|114190906|gb|EAU32606.1| hypothetical protein ATEG_07222 [Aspergillus terreus NIH2624]
          Length = 168

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 8/108 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LFALPGAFTP CS   +P + +   ++R +G++ V  L+ NDA+VM+A
Sbjct: 38  NASKEWADKKVILFALPGAFTPVCSARHVPEYIERLPEIRAKGVDVVAVLAYNDAYVMSA 97

Query: 92  WGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           WGK  ++ N  +  L D   +F++ +G   + D  G   R+ RY  +I
Sbjct: 98  WGKANQVTNDDILFLSDPDAKFSKSIG---WADEEG---RTGRYAIII 139


>gi|294654389|ref|XP_456439.2| DEHA2A02310p [Debaryomyces hansenii CBS767]
 gi|199428844|emb|CAG84391.2| DEHA2A02310p [Debaryomyces hansenii]
          Length = 185

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 72/149 (48%), Gaps = 12/149 (8%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
            +VN  +  +  +  +  +PGAF+P CS   +PGF     D   +G ++ + +SVNDAFV
Sbjct: 44  NNVNLAEETSNGKSVIIGVPGAFSPACSSSHVPGFLSKLRDFNNKGYQKFFIVSVNDAFV 103

Query: 89  MNAWGKKL----EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFG-LRSWRYGALIKDMVVE 143
           M AWG  L    +   +  L D   EF   +  L +     FG  RS RY  L++D  V 
Sbjct: 104 MKAWGSSLLGNIDGDQISFLADPQAEFVSALD-LKFDATKAFGNERSKRYALLVEDGKVT 162

Query: 144 SWFVEEGFSDNCATDPYEISSPENVLKVI 172
             FVE    DN + D   +S  E VL  I
Sbjct: 163 ETFVEP---DNISVD---VSDAEKVLSQI 185


>gi|70984685|ref|XP_747849.1| allergen Asp F3 [Aspergillus fumigatus Af293]
 gi|3914384|sp|O43099|PMP20_ASPFU RecName: Full=Putative peroxiredoxin pmp20; AltName:
           Full=Peroxisomal membrane protein pmp20; AltName:
           Full=Thioredoxin reductase; AltName: Allergen=Asp f 3
 gi|2769700|gb|AAB95638.1| peroxisomal-like protein [Aspergillus fumigatus]
 gi|66845476|gb|EAL85811.1| allergen Asp F3 [Aspergillus fumigatus Af293]
 gi|159122632|gb|EDP47753.1| allergen Asp F3 [Aspergillus fumigatus A1163]
          Length = 168

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 75/141 (53%), Gaps = 14/141 (9%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LFALPGAFTP CS   +P + +   ++R +G++ V  L+ NDA+VM+A
Sbjct: 38  NASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSA 97

Query: 92  WGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           WGK  ++   ++  L D    F++ +G   + D  G   R+ RY  +I    +    +E 
Sbjct: 98  WGKANQVTGDDILFLSDPDARFSKSIG---WADEEG---RTKRYALVIDHGKITYAALEP 151

Query: 150 GFSDNCATDPYEISSPENVLK 170
                 A +  E SS E VLK
Sbjct: 152 ------AKNHLEFSSAETVLK 166


>gi|254567145|ref|XP_002490683.1| peroxiredoxin [Pichia pastoris GS115]
 gi|227908535|dbj|BAH57501.1| peroxisomal membrane associated protein 20 [Pichia pastoris]
 gi|238030479|emb|CAY68403.1| peroxiredoxin [Pichia pastoris GS115]
          Length = 170

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N ++   GKR  + A PGAFT TC +  LP + K       +GI+ +  ++ NDAFV+N+
Sbjct: 34  NLRETVQGKRFIVVAAPGAFTSTCHEEHLPPYIKNLPTFLKKGIDFILVITANDAFVLNS 93

Query: 92  WGKKLEIKNVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI-KDMVVESWFVE 148
           W K L   + K++   D + E   K+G+ +     G G R+ R+  ++ KD VV++ F E
Sbjct: 94  WKKALGADSDKIIFASDTNLELANKLGLTLDLSVAGLGQRTGRFALIVGKDGVVQNVFAE 153

Query: 149 EG 150
           +G
Sbjct: 154 KG 155


>gi|226530856|ref|NP_001141729.1| hypothetical protein LOC100273860 [Zea mays]
 gi|194705718|gb|ACF86943.1| unknown [Zea mays]
          Length = 141

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 48/68 (70%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           +D+F GK+V +F LPGA+T  CS   +P ++K  D L+ +GI+ V C++VND +V++ W 
Sbjct: 60  KDIFYGKKVVIFGLPGAYTGVCSQAHVPSYKKNIDKLKAKGIDSVICVAVNDPYVLDGWA 119

Query: 94  KKLEIKNV 101
           KKL+ K+ 
Sbjct: 120 KKLDAKDT 127


>gi|156843417|ref|XP_001644776.1| hypothetical protein Kpol_1020p26 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115426|gb|EDO16918.1| hypothetical protein Kpol_1020p26 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 178

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 82/172 (47%), Gaps = 11/172 (6%)

Query: 3   RFQIPQVVFHMRVATVLPDGSKAFQWKDV-NTQDL---FAGKRVFLFALPGAFTPTCSDH 58
           + Q  + +   ++   +P G    Q     NT D+    +  +  +  LP AF+P CS  
Sbjct: 10  KLQPLRFIRGFKIGDRIPKGVAGIQENSPGNTIDIGEEVSNGKNIIIGLPAAFSPACSSS 69

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGM 117
            +PGF K   +   +G  ++   +VND+FV  AW + L   K ++++ D  G F +K G 
Sbjct: 70  HVPGFIKHLKEFENKGFSKILVTTVNDSFVTKAWSESLNCPKEIRIIADTQGNFAKKGGY 129

Query: 118 LVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
           L    NV    RS RY  +++D +V   F+E    D       ++SS ENV+
Sbjct: 130 LFDAKNVLGNERSMRYVLIVEDGIVVKEFLE---PDKIG---LKVSSAENVI 175


>gi|119467218|ref|XP_001257415.1| allergen Asp F3 [Neosartorya fischeri NRRL 181]
 gi|119405567|gb|EAW15518.1| allergen Asp F3 [Neosartorya fischeri NRRL 181]
          Length = 168

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 14/143 (9%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           + N    +A K+V LFALPGAFTP CS   +P + +   ++R +G++ V  L+ NDA+VM
Sbjct: 36  NYNASKEWADKKVILFALPGAFTPVCSARHVPEYLEKLPEIRAKGVDVVAVLAYNDAYVM 95

Query: 90  NAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           +AWGK  ++   ++  L D    F++ +G   + D  G   R+ RY  +I    V    +
Sbjct: 96  SAWGKANQVTGDDILFLSDPEARFSKSIG---WADEEG---RTKRYAIVIDHGKVTYAAL 149

Query: 148 EEGFSDNCATDPYEISSPENVLK 170
           E       + +  E SS E VLK
Sbjct: 150 EP------SKNHLEFSSAETVLK 166


>gi|50302773|ref|XP_451323.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49640454|emb|CAH02911.1| KLLA0A07271p [Kluyveromyces lactis]
          Length = 181

 Score = 77.0 bits (188), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 78/157 (49%), Gaps = 11/157 (7%)

Query: 19  LPDGSKAFQWKDV-NTQDL---FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           +P G K        N+ DL    A  +  +  LP AF+P CS   +PG+     +L+ +G
Sbjct: 29  IPTGLKGLHESSPGNSVDLGKEVAHGKYIIVGLPAAFSPACSASHVPGYIAHLKELKEKG 88

Query: 75  IEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133
           +++V+  +VND+FV  AW + L +  +++++ D  GEF +    L     +    RS RY
Sbjct: 89  VKQVFVTAVNDSFVTQAWAEDLGVPSDIRIIADTLGEFAKAGDHLFDSKQIFGNDRSIRY 148

Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170
             +++D  V   F E    D    D   +SS ENVLK
Sbjct: 149 AVIVQDGKVVKEFAE---PDKIGVD---VSSAENVLK 179


>gi|307104518|gb|EFN52771.1| hypothetical protein CHLNCDRAFT_36706 [Chlorella variabilis]
          Length = 183

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 12/137 (8%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K V+ + LF+ K+  LF +PGAFTP CS   LPG+    + LR  G E V C+SVND FV
Sbjct: 39  KQVSLKQLFSNKKGILFGVPGAFTPGCSKTHLPGYVADREKLREAGAEVVVCVSVNDPFV 98

Query: 89  MNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGL--------RSWRYGALIKD 139
           + AWG+       + +L D      R +G     D V +          R   + A+++D
Sbjct: 99  VGAWGEAHNAGGKIVMLAD---TRVRGLGASGMNDVVAWRSCLPTRSHGRCAAFSAVVED 155

Query: 140 MVVESWFVEEGFSDNCA 156
            V++S  +EEG    C+
Sbjct: 156 GVIKSLNLEEGGGMTCS 172


>gi|121719390|ref|XP_001276394.1| allergen, putative [Aspergillus clavatus NRRL 1]
 gi|119404592|gb|EAW14968.1| allergen, putative [Aspergillus clavatus NRRL 1]
          Length = 166

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 9/110 (8%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           + N    +A K+V LF++PGAFTPTCS + +PG+ K    LR +G++ V  ++ ND +VM
Sbjct: 35  NYNASKEWADKKVVLFSVPGAFTPTCSVNHMPGYIKSLPQLRAKGVQVVAVVASNDPYVM 94

Query: 90  NAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           +AWGK  ++K  ++  L D   +F+  +G      N G   R+ RY  +I
Sbjct: 95  SAWGKANQVKGEDILFLSDPEAKFSSSIGWA----NNG---RTGRYAIII 137


>gi|328351069|emb|CCA37469.1| Peroxiredoxin-2 [Pichia pastoris CBS 7435]
          Length = 229

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N ++   GKR  + A PGAFT TC +  LP + K       +GI+ +  ++ NDAFV+N+
Sbjct: 34  NLRETVQGKRFIVVAAPGAFTSTCHEEHLPPYIKNLPTFLKKGIDFILVITANDAFVLNS 93

Query: 92  WGKKLEIKNVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI-KDMVVESWFVE 148
           W K L   + K++   D + E   K+G+ +     G G R+ R+  ++ KD VV++ F E
Sbjct: 94  WKKALGADSDKIIFASDTNLELANKLGLTLDLSVAGLGQRTGRFALIVGKDGVVQNVFAE 153

Query: 149 EG 150
           +G
Sbjct: 154 KG 155


>gi|218516373|ref|ZP_03513213.1| putative thioredoxin protein [Rhizobium etli 8C-3]
          Length = 165

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 49/65 (75%)

Query: 30 DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
          +++T+ LFAGKRV LFA+PGAFTPTCS + LPG+ +  D +  +G++++  L+VND  VM
Sbjct: 24 EISTEQLFAGKRVVLFAVPGAFTPTCSLNHLPGYLENRDTILGKGVDDIAVLAVNDWHVM 83

Query: 90 NAWGK 94
           AW +
Sbjct: 84 GAWAQ 88


>gi|303318549|ref|XP_003069274.1| peroxisomal membrane protein, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|240108960|gb|EER27129.1| peroxisomal membrane protein, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|320036139|gb|EFW18078.1| hypothetical protein CPSG_04764 [Coccidioides posadasii str.
           Silveira]
          Length = 166

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 68/124 (54%), Gaps = 9/124 (7%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           ++     L+A K+V LF+LPGAFTPTCS   LPG+ +    L+ +G++ V  L+ NDA+V
Sbjct: 35  QNYEASKLWADKKVVLFSLPGAFTPTCSASHLPGYIQKLPQLKEKGVDVVAVLAFNDAWV 94

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M+AWGK   +   ++  L D   +F++ +G          G R+ RY  +I    V    
Sbjct: 95  MSAWGKANGVTGDDILFLSDPEAKFSKSIGW-------NAGERTGRYAMIIDHGQVTYAE 147

Query: 147 VEEG 150
           +E G
Sbjct: 148 IEPG 151


>gi|78364922|gb|ABB42829.1| peroxisomal matrix protein [Coccidioides posadasii]
          Length = 166

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 68/124 (54%), Gaps = 9/124 (7%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           ++     L+A K+V LF+LPGAFTPTCS   LPG+ +    L+ +G++ V  L+ NDA+V
Sbjct: 35  QNYEASKLWADKKVVLFSLPGAFTPTCSASHLPGYIQKLPQLKEKGVDVVAVLAFNDAWV 94

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M+AWGK   +   ++  L D   +F++ +G          G R+ RY  +I    V    
Sbjct: 95  MSAWGKANGVTGDDILFLSDPEAKFSKSIGW-------NAGERTGRYAMIIDHGQVTYAE 147

Query: 147 VEEG 150
           +E G
Sbjct: 148 IEPG 151


>gi|119181446|ref|XP_001241932.1| hypothetical protein CIMG_05828 [Coccidioides immitis RS]
          Length = 166

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 68/124 (54%), Gaps = 9/124 (7%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           ++     L+A K+V LF+LPGAFTPTCS   LPG+ +    L+ +G++ V  L+ NDA+V
Sbjct: 35  QNYEASKLWADKKVVLFSLPGAFTPTCSASHLPGYIQKLPQLKEKGVDVVAVLAFNDAWV 94

Query: 89  MNAWGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           M+AWGK   +   ++  L D   +F++ +G          G R+ RY  +I    V    
Sbjct: 95  MSAWGKANGVTGDDILFLSDPEAKFSKSIGW-------NAGERTGRYAIIIDHGKVTYAE 147

Query: 147 VEEG 150
           +E G
Sbjct: 148 IEPG 151


>gi|169778813|ref|XP_001823871.1| peroxiredoxin pmp20 [Aspergillus oryzae RIB40]
 gi|238499383|ref|XP_002380926.1| allergen Asp F3 [Aspergillus flavus NRRL3357]
 gi|83772610|dbj|BAE62738.1| unnamed protein product [Aspergillus oryzae]
 gi|220692679|gb|EED49025.1| allergen Asp F3 [Aspergillus flavus NRRL3357]
          Length = 168

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 76/141 (53%), Gaps = 14/141 (9%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LFALPGAFTP CS + +P +++   ++R +G++ V  L+ NDA+VM+A
Sbjct: 38  NASKEWADKKVILFALPGAFTPVCSANHVPEYKEKLPEIREKGVDVVAVLAYNDAYVMSA 97

Query: 92  WGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
           W K   +KN  +  L D   +F++ +G   + D  G   R+ RY  +I    V    +E 
Sbjct: 98  WAKANGVKNDDILFLSDPDAKFSKSLG---WADEEG---RTKRYAIVIDHGKVTYAALEP 151

Query: 150 GFSDNCATDPYEISSPENVLK 170
                 A +  E S  E V+K
Sbjct: 152 ------AKNHLEFSRAETVIK 166


>gi|255730617|ref|XP_002550233.1| hypothetical protein CTRG_04531 [Candida tropicalis MYA-3404]
 gi|255730641|ref|XP_002550245.1| hypothetical protein CTRG_04543 [Candida tropicalis MYA-3404]
 gi|240132190|gb|EER31748.1| hypothetical protein CTRG_04531 [Candida tropicalis MYA-3404]
 gi|240132202|gb|EER31760.1| hypothetical protein CTRG_04543 [Candida tropicalis MYA-3404]
          Length = 185

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 85/179 (47%), Gaps = 18/179 (10%)

Query: 3   RFQIPQVVFHMRVATVLPDGSK-----AFQWKDVNTQDL---FAGKRVFLFALPGAFTPT 54
           R Q+   VF   + T +  G K      ++    N  DL    A  +  +  +PGAF+P 
Sbjct: 10  RVQLTANVFRNSLRTYVAVGDKIPHTTVYEGSPGNEVDLAEETASGKSIVIGVPGAFSPG 69

Query: 55  CSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL----EIKNVKLLPDGSGE 110
           CS   +PGF K       +G ++ + ++VNDAFV  AWG +L      + ++ + D SG 
Sbjct: 70  CSKSHVPGFIKNVRAFNDKGYQKFFVVAVNDAFVTKAWGDQLLESIAGQQIRFIADPSGA 129

Query: 111 FTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
           FT+ + +L          RS RY  +++D  V+  FVE    DN +    E+SS   VL
Sbjct: 130 FTKDLDLLFDASKFFGNERSKRYALIVEDGEVKKTFVE---PDNTSV---EVSSAAKVL 182


>gi|242781351|ref|XP_002479783.1| allergen Asp F3 [Talaromyces stipitatus ATCC 10500]
 gi|218719930|gb|EED19349.1| allergen Asp F3 [Talaromyces stipitatus ATCC 10500]
          Length = 168

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 65/108 (60%), Gaps = 8/108 (7%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V +FALPGAFTP CS   +PG+ +    L+ +G++ V  L+ NDA+VM+A
Sbjct: 38  NASKEWADKKVVVFALPGAFTPVCSAAHVPGYIENLPKLKEKGVDVVAVLAYNDAYVMSA 97

Query: 92  WGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           WGK   +K  ++  L D   +F++ +G   + D  G   R++RY  +I
Sbjct: 98  WGKANGVKGDDILFLSDPEAKFSKSIG---WADEEG---RTYRYAIVI 139


>gi|242783345|ref|XP_002480169.1| allergen, putative [Talaromyces stipitatus ATCC 10500]
 gi|218720316|gb|EED19735.1| allergen, putative [Talaromyces stipitatus ATCC 10500]
          Length = 169

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 55/87 (63%), Gaps = 2/87 (2%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF++PGAFTPTCS   LPG+ K    L+ +G++ V  L+ ND FVM+A
Sbjct: 38  NASKEWADKKVVLFSVPGAFTPTCSVSHLPGYIKNLPQLKAKGVDVVAVLAFNDPFVMSA 97

Query: 92  WGK--KLEIKNVKLLPDGSGEFTRKMG 116
           WGK  K+   ++  L D   +F++ +G
Sbjct: 98  WGKANKITDDSILFLSDPDAKFSKSIG 124


>gi|126274152|ref|XP_001387857.1| putative thioredoxin peroxidase [Scheffersomyces stipitis CBS 6054]
 gi|126213727|gb|EAZ63834.1| putative thioredoxin peroxidase [Pichia stipitis CBS 6054]
          Length = 166

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +  A  +  +  +PGAF+P CS   +PGF K       +G ++ + ++VNDAFV  
Sbjct: 26  VNLAEEVAEGKSIIIGVPGAFSPACSSSHVPGFIKRLRGFNEKGFQKFFVVAVNDAFVTK 85

Query: 91  AWGKKL-----EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESW 145
           AWG  L         +K L D SG FT+ + +L          RS RY  +++D  V   
Sbjct: 86  AWGDALLGSTVAGAQIKFLADPSGAFTKDLDLLFDATKFFGNERSRRYALIVEDGTVTKT 145

Query: 146 FVEEGFSDNCATDPYEISSPENVLK 170
           FVE    DN +     +S   NVL+
Sbjct: 146 FVEP---DNTSV---VVSDSANVLE 164


>gi|190360995|gb|ACE76884.1| peroxiredoxin V [Laternula elliptica]
          Length = 159

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 78/157 (49%), Gaps = 7/157 (4%)

Query: 13  MRVATVLPDGSKAFQWK---DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           ++V   LPD +  F+ K    V T +LF   +  L  + GAFT TC +   P F    D 
Sbjct: 3   IKVGDKLPDVT-LFENKPDESVKTSELFGKDKHVLVGIVGAFTGTCQNDHFPTFVDNIDK 61

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGL 128
           ++ +G+E V C+SVND FV  A+G  +     +++L D  G FT K+  L +     FG 
Sbjct: 62  IKAKGVEIVACVSVNDPFVTAAFGTAMNADGKIRMLADTCGTFTEKID-LEWDVAAAFGT 120

Query: 129 -RSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISS 164
            RS RY  +I D VV    VEE  S    T   +I S
Sbjct: 121 KRSQRYVMVINDGVVTGLNVEEDSSKVKCTSGTDILS 157


>gi|310794108|gb|EFQ29569.1| redoxin [Glomerella graminicola M1.001]
          Length = 167

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 9/107 (8%)

Query: 33  TQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW 92
           T   F  K+  + ++PGAFTPTCS   LPG+ +  D+L+ +G+++V  L+ ND FVM+ W
Sbjct: 39  TSKEFKDKKAVIVSIPGAFTPTCSASHLPGYIEHKDELKAKGVDQVIFLAYNDPFVMSGW 98

Query: 93  GKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           GK   IK+  +    D + EF+  +G          G R+ RY  +I
Sbjct: 99  GKANNIKDDFIIFASDPNAEFSTSIGW-------NHGERTARYAVVI 138


>gi|154302296|ref|XP_001551558.1| hypothetical protein BC1G_09932 [Botryotinia fuckeliana B05.10]
 gi|150855420|gb|EDN30612.1| hypothetical protein BC1G_09932 [Botryotinia fuckeliana B05.10]
          Length = 169

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 62/110 (56%), Gaps = 9/110 (8%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF+LPGAFTPTCS   LPG+      LR +G++ V  ++ ND FVM+A
Sbjct: 40  NASKEWANKKVVLFSLPGAFTPTCSASHLPGYIANLPALREKGVDVVATIAYNDPFVMSA 99

Query: 92  WGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           WGK   I N  +  L D    F++ +G   + D    G R+ RY  +I +
Sbjct: 100 WGKANGIHNEDILFLSDNQCAFSKLLG---WTD----GERTGRYALIIDN 142


>gi|212527298|ref|XP_002143806.1| peroxiredoxin-5, putative [Penicillium marneffei ATCC 18224]
 gi|210073204|gb|EEA27291.1| peroxiredoxin-5, putative [Penicillium marneffei ATCC 18224]
          Length = 169

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 65/108 (60%), Gaps = 7/108 (6%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF++PGAFTPTCS   LPG+ +    L+ +G++ V  L+ NDA+VM+A
Sbjct: 38  NASKEWADKKVVLFSVPGAFTPTCSLSHLPGYIQNLPQLKAKGVDIVAVLAFNDAWVMSA 97

Query: 92  WGK--KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           WGK  K+  K+   L D   +F++ +G   + D V    R+ RY  +I
Sbjct: 98  WGKANKVTDKDFLFLSDPDAKFSKSIG---WADPVSG--RTGRYAMVI 140


>gi|295662713|ref|XP_002791910.1| peroxisomal matrix protein [Paracoccidioides brasiliensis Pb01]
 gi|34980256|gb|AAQ84041.1| peroxisomal-like protein [Paracoccidioides brasiliensis]
 gi|226279562|gb|EEH35128.1| peroxisomal matrix protein [Paracoccidioides brasiliensis Pb01]
          Length = 166

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 62/108 (57%), Gaps = 9/108 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LF++PGAFTP+CS   LPG+ K  ++ +  G++ V  ++ ND FVM+AWGK  
Sbjct: 43  WADKKVVLFSVPGAFTPSCSISHLPGYIKHLNNFKANGVDIVAVIAYNDPFVMSAWGKAN 102

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVV 142
            +K  ++  L D    F++ +G  +       G R+ RY  +I    V
Sbjct: 103 NVKGDDILFLSDTDTAFSKSIGWTM-------GERTARYAIIIDHGTV 143


>gi|323456760|gb|EGB12626.1| hypothetical protein AURANDRAFT_15639 [Aureococcus anophagefferens]
          Length = 145

 Score = 75.1 bits (183), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (51%), Gaps = 12/131 (9%)

Query: 24  KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSV 83
           K F +  ++     AGK+  +  LPGA        Q+PG+    D+L+ +GI+E+    V
Sbjct: 20  KEFPFDTIDVPARLAGKKTIVLGLPGAR----GRSQVPGYMSKEDELKAKGIDEILVYCV 75

Query: 84  NDAFVMNAWGKKLEIKN---VKLLPDGSGEFTRKMGMLVYKDNV----GFGLRSWRYGAL 136
           NDA VM AW  K+ +K    V +L D   +FT  MG+ +  D V    G+ +RS RY A+
Sbjct: 76  NDAAVMEAWSDKMNVKPKSLVTMLADPGCKFTEAMGLAMPADEVPPQLGY-VRSKRYAAV 134

Query: 137 IKDMVVESWFV 147
             D  +E  +V
Sbjct: 135 FNDGTLEQLYV 145


>gi|558080|gb|AAB41351.1| putative peroxisomal protein; alternate GTG start codon [Lipomyces
           spencermartinsiae]
 gi|1091044|prf||2020307A peroxisomal protein
          Length = 166

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 61/109 (55%), Gaps = 3/109 (2%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           F  K V + A+PGAFTPTC+ + +P F + +  L+  G++ V  LS ND FV +A+GK L
Sbjct: 38  FRDKTVVIVAIPGAFTPTCTANHIPPFVEKFTALKSAGVDAVIVLSANDPFVQSAFGKAL 97

Query: 97  EIKNVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVE 143
            + +   +   D   EF++  G L       FG R+ RY  ++ + VV+
Sbjct: 98  GVTDEAFIFASDPGAEFSKSAG-LSLDLPPAFGTRTARYAIIVSNGVVK 145


>gi|50403763|sp|Q01116|PMP20_LIPKO RecName: Full=Putative peroxisomal peroxiredoxin; AltName:
           Full=Thioredoxin reductase
          Length = 166

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 61/109 (55%), Gaps = 3/109 (2%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           F  K V + A+PGAFTPTC+ + +P F + +  L+  G++ V  LS ND FV +A+GK L
Sbjct: 38  FRDKTVVIVAIPGAFTPTCTANHIPPFVEKFTALKSAGVDAVIVLSANDPFVQSAFGKAL 97

Query: 97  EIKNVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVE 143
            + +   +   D   EF++  G L       FG R+ RY  ++ + VV+
Sbjct: 98  GVTDEAFIFASDPGAEFSKSAG-LSLDLPPAFGTRTARYAIIVSNGVVK 145


>gi|119499261|ref|XP_001266388.1| allergen, putative [Neosartorya fischeri NRRL 181]
 gi|119414552|gb|EAW24491.1| allergen, putative [Neosartorya fischeri NRRL 181]
          Length = 166

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 62/108 (57%), Gaps = 9/108 (8%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF++PGAFTPTCS + LPG+ K    L+ +G++ V  L+ ND +VM+A
Sbjct: 37  NASKEWADKKVVLFSVPGAFTPTCSANHLPGYIKSLPQLKEKGVQIVAVLASNDPYVMSA 96

Query: 92  WGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           WGK  ++   ++  L D    F+  +G      N G   R+ RY  +I
Sbjct: 97  WGKANQVTGDDILFLSDPQARFSDSIGWA----NAG---RTGRYAIII 137


>gi|297788208|ref|XP_002862250.1| hypothetical protein ARALYDRAFT_359737 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297307560|gb|EFH38508.1| hypothetical protein ARALYDRAFT_359737 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 136

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 1/108 (0%)

Query: 47  LPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLP 105
           LPGA+T  CS   +P ++   D  + +GI+ V C+SVND + +N W +KL  K+ ++   
Sbjct: 16  LPGAYTGVCSQQHVPSYKSHIDKFKAKGIDSVVCVSVNDPYAINGWAEKLGAKDAIEFYG 75

Query: 106 DGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSD 153
           D  G+F + +G+         G RS R+ A ++D  V++  VEE  SD
Sbjct: 76  DFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAVNVEEAPSD 123


>gi|259480837|tpe|CBF73841.1| TPA: allergen, putative (AFU_orthologue; AFUA_5G01440) [Aspergillus
           nidulans FGSC A4]
          Length = 167

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 62/103 (60%), Gaps = 9/103 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LF++PGAFTPTCS + LPG+ K   +L+ +GI+ V  ++ ND FVM+AWGK  
Sbjct: 43  WADKKVVLFSVPGAFTPTCSVNHLPGYIKNLPELKKKGIQIVAVVASNDPFVMSAWGKAN 102

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           ++   ++  L D   +F+  +G          G R+ RY  +I
Sbjct: 103 QVTGDDILFLSDPDAKFSDSIGW-------ASGGRTGRYAIII 138


>gi|254566355|ref|XP_002490288.1| hypothetical protein [Pichia pastoris GS115]
 gi|238030084|emb|CAY68007.1| hypothetical protein PAS_chr1-4_0659 [Pichia pastoris GS115]
 gi|328350682|emb|CCA37082.1| Peroxiredoxin type-2 [Pichia pastoris CBS 7435]
          Length = 170

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 63/111 (56%), Gaps = 1/111 (0%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI 98
           G+ V + + PGAFTPTC+ + +P F +  D+ + +G+++V  ++ +  F   AWGK L  
Sbjct: 43  GRTVVIVSAPGAFTPTCTANHIPVFIEKIDEFKKKGVDDVVVITTDTPFANAAWGKALGA 102

Query: 99  KN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           K+ +    D     ++++G L  +    FG+R  RY  ++KD VV  + VE
Sbjct: 103 KDEIIFANDPLAALSKELGYLKSEVPASFGIRGARYAVVVKDGVVSYFGVE 153


>gi|159125880|gb|EDP50996.1| allergen, putative [Aspergillus fumigatus A1163]
          Length = 202

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 13/110 (11%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF++PGAFTPTCS + LPG+ K    L+ +G++ V  L+ ND +VM+A
Sbjct: 73  NASKEWADKKVVLFSVPGAFTPTCSANHLPGYIKSLPQLKEKGVQIVAVLASNDPYVMSA 132

Query: 92  WGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGL--RSWRYGALI 137
           WGK  ++   ++  L D    F+         D++G+    R+ RY  +I
Sbjct: 133 WGKANQVTGDDILFLSDPQARFS---------DSIGWATAGRTGRYAIII 173


>gi|70985384|ref|XP_748198.1| allergen [Aspergillus fumigatus Af293]
 gi|66845826|gb|EAL86160.1| allergen, putative [Aspergillus fumigatus Af293]
          Length = 202

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 63/110 (57%), Gaps = 13/110 (11%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF++PGAFTPTCS + LPG+ K    L+ +G++ V  L+ ND +VM+A
Sbjct: 73  NASKEWADKKVVLFSVPGAFTPTCSANHLPGYIKSLPQLKEKGVQIVAVLASNDPYVMSA 132

Query: 92  WGKKLEIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGL--RSWRYGALI 137
           WGK  ++   ++  L D    F+         D++G+    R+ RY  +I
Sbjct: 133 WGKANQVTGDDILFLSDPQARFS---------DSIGWATAGRTGRYAIII 173


>gi|296814822|ref|XP_002847748.1| AhpC/TSA family protein [Arthroderma otae CBS 113480]
 gi|238840773|gb|EEQ30435.1| AhpC/TSA family protein [Arthroderma otae CBS 113480]
          Length = 187

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN     A  R  +   PGAFTP CS   +PGF   + +L+  G  +V+ +SVNDAFV  
Sbjct: 46  VNLAAELAAGRGLIVGTPGAFTPGCSLSHVPGFIN-HPNLKDAG--KVFVVSVNDAFVTK 102

Query: 91  AWGKKLEIK---NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AW   L+ +    ++ L D SG F + + +L     V    RS RY  +++D  V+  FV
Sbjct: 103 AWSDSLDPQKKSGIRFLADASGAFNKALDLLFSSSPVFGNDRSKRYALVVEDGKVKKAFV 162

Query: 148 EEGFSDNCATD 158
           E    DN + D
Sbjct: 163 EP---DNTSVD 170


>gi|239608088|gb|EEQ85075.1| AhpC/TSA family protein [Ajellomyces dermatitidis ER-3]
          Length = 183

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 89/185 (48%), Gaps = 34/185 (18%)

Query: 3   RFQIPQVVFH------MRVATVLPD---------GSKAFQWKDVNTQDLFAGKRVFLFAL 47
           R   P  +FH      ++V   +PD         G+K    K++  + L  G        
Sbjct: 14  RASTPVALFHSTRPTFVKVGDAVPDLEVLTENSPGNKVNLAKELQGKGLIIGT------- 66

Query: 48  PGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN---VKLL 104
           PGAF+P CS   +PGF   + +L+  G  +V+ +SVNDAFV  AW K ++ +    ++ L
Sbjct: 67  PGAFSPACSAAHVPGFAN-HPNLKDAG--KVFVVSVNDAFVTGAWSKMVDPEQKSGIRFL 123

Query: 105 PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISS 164
            D  GEFT+ + +      +   LRS RY  +I+D  V+  F+E    DN   +   +S 
Sbjct: 124 GDPKGEFTKALDLDFDASAIFGNLRSKRYVLVIEDGKVKKTFIEP---DNTGLN---VSK 177

Query: 165 PENVL 169
            ENVL
Sbjct: 178 AENVL 182


>gi|156056134|ref|XP_001593991.1| peroxiredoxin [Sclerotinia sclerotiorum 1980]
 gi|154703203|gb|EDO02942.1| peroxiredoxin [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 168

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 59/110 (53%), Gaps = 9/110 (8%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V +F+LPGAFTPTCS   LPG+       R +G++ V  ++ ND FVM+A
Sbjct: 40  NASKEWANKKVVVFSLPGAFTPTCSASHLPGYISNLPAFREKGVDVVATIAYNDPFVMSA 99

Query: 92  WGKKLEIKN--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           WGK   I N  +  L D    F++ +G          G R+ RY  +I +
Sbjct: 100 WGKANGIHNEDILFLSDADCAFSKLLGWTA-------GERTGRYALVIDN 142


>gi|330924510|ref|XP_003300670.1| hypothetical protein PTT_11978 [Pyrenophora teres f. teres 0-1]
 gi|311325090|gb|EFQ91239.1| hypothetical protein PTT_11978 [Pyrenophora teres f. teres 0-1]
          Length = 167

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 71/143 (49%), Gaps = 22/143 (15%)

Query: 13  MRVATVLPDGSKAFQWKDVNTQD--------------LFAGKRVFLFALPGAFTPTCSDH 58
           ++V   LP+G K F+W  +   D               +A K+V LF++PGAFTP C  H
Sbjct: 4   LKVGDTLPEGVK-FEWAPITDSDPTACGLPQTYDASSAWANKKVVLFSVPGAFTPGCQAH 62

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN--VKLLPDGSGEFTRKMG 116
            LP +     + + +G++ +  ++ NDA+VMNAWGK   +K   V  L D    F++  G
Sbjct: 63  HLPPYIAKAAEFKAKGVDIIATIASNDAWVMNAWGKVNGVKGDEVLFLSDTKTFFSKNYG 122

Query: 117 MLVYKDNVGFGLRSWRYGALIKD 139
                   G G R+ R+  + ++
Sbjct: 123 W-----QAGMGDRNGRWAMVFEN 140


>gi|320591442|gb|EFX03881.1| tsa family protein [Grosmannia clavigera kw1407]
          Length = 197

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  + F      +  +PGAF+  CS+  +P +  ++  L+  G  +V+ +SVNDAFVM 
Sbjct: 56  VNLAEEFQKGDGLIIGVPGAFSGACSEKHVPSY-ILHPKLKEAG--QVFVVSVNDAFVMK 112

Query: 91  AWGKKL---EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG  L   E   ++ L D +GEFT+ + +      +    RS RY  +I+D  VES  V
Sbjct: 113 AWGASLDPTEQTGIRFLGDPAGEFTKALDLDFDATPIFGNPRSKRYALVIRDGKVESAHV 172

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN  T+   +S  +NVL
Sbjct: 173 E---PDNTGTN---VSLADNVL 188


>gi|302918336|ref|XP_003052636.1| hypothetical protein NECHADRAFT_67423 [Nectria haematococca mpVI
           77-13-4]
 gi|256733576|gb|EEU46923.1| hypothetical protein NECHADRAFT_67423 [Nectria haematococca mpVI
           77-13-4]
          Length = 167

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 9/108 (8%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    F  K+V L ++PGAFTPTCS   +P + +  D ++ +G+++V  ++ NDAFVMN 
Sbjct: 38  NASQEFKDKKVVLVSIPGAFTPTCSGSHIPSYTEHIDKIKAKGVDQVIVVAFNDAFVMNG 97

Query: 92  WGKKLEIKNVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           W K   + +  +L   D   +F+R +G         F  R+ R+  +I
Sbjct: 98  WAKANGVTDDSILFMSDKDAKFSRSIGW-------NFDERTGRFAIII 138


>gi|255951170|ref|XP_002566352.1| Pc22g24640 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211593369|emb|CAP99752.1| Pc22g24640 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 169

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 2/87 (2%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF++PGAFTPTCS + +PG+ +    LR +G++ V  ++ ND FVM+A
Sbjct: 38  NASQEWANKKVVLFSVPGAFTPTCSVNHVPGYIQNLPKLREKGVDIVAVVAFNDPFVMSA 97

Query: 92  WGKKLEIK--NVKLLPDGSGEFTRKMG 116
           WGK   ++  ++  L D   +F++ +G
Sbjct: 98  WGKANAVRGDDILFLSDPDAKFSKSIG 124


>gi|169763502|ref|XP_001727651.1| peroxiredoxin pmp20 [Aspergillus oryzae RIB40]
 gi|83770679|dbj|BAE60812.1| unnamed protein product [Aspergillus oryzae]
          Length = 166

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 64/108 (59%), Gaps = 9/108 (8%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF++PGAFTPTCS + +PG+ +    L+ +G++ V  ++ ND FVM+A
Sbjct: 37  NASKEWADKKVVLFSVPGAFTPTCSVNHVPGYIQNLPQLKEKGVQVVAVVASNDPFVMSA 96

Query: 92  WGK--KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           WGK  K+E  ++  L D   +F+  +G      N G   R+ RY  +I
Sbjct: 97  WGKANKVENNDILFLSDPDAKFSDSIGWA----NNG---RTGRYAIVI 137


>gi|171679391|ref|XP_001904642.1| hypothetical protein [Podospora anserina S mat+]
 gi|170939321|emb|CAP64549.1| unnamed protein product [Podospora anserina S mat+]
          Length = 188

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 69/132 (52%), Gaps = 12/132 (9%)

Query: 41  RVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI-- 98
           ++ L  +P AF+P CS   +PGF       + E  ++V  +SVND FVM AWG  L    
Sbjct: 63  KMILIGVPAAFSPACSATHVPGF---LAHPKAEEYDQVAVVSVNDVFVMKAWGDVLNPEG 119

Query: 99  -KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCAT 157
            +NV+ L D SGEFT+ + ML     +    RS R+  +++   V+S  VE    DN  T
Sbjct: 120 KENVRFLADPSGEFTKALDMLWDGKAIFGNERSKRFTIIVEGGKVKSVAVE---PDNTGT 176

Query: 158 DPYEISSPENVL 169
               +S  ENVL
Sbjct: 177 ---SVSLAENVL 185


>gi|261203765|ref|XP_002629096.1| AhpC/TSA family protein [Ajellomyces dermatitidis SLH14081]
 gi|239586881|gb|EEQ69524.1| AhpC/TSA family protein [Ajellomyces dermatitidis SLH14081]
          Length = 183

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 89/185 (48%), Gaps = 34/185 (18%)

Query: 3   RFQIPQVVFH------MRVATVLPD---------GSKAFQWKDVNTQDLFAGKRVFLFAL 47
           R   P  +FH      ++V   +PD         G+K    K++  + L  G        
Sbjct: 14  RASPPVALFHSTRPAFVKVGDAVPDLEVLTENSPGNKVNLAKELQGKGLIIGT------- 66

Query: 48  PGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN---VKLL 104
           PGAF+P CS   +PGF   + +L+  G  +V+ +SVNDAFV  AW K ++ +    ++ L
Sbjct: 67  PGAFSPACSAAHVPGFAN-HPNLKDAG--KVFVVSVNDAFVTGAWSKMVDPEQKSGIRFL 123

Query: 105 PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISS 164
            D  GEFT+ + +      +   LRS RY  +I+D  V+  F+E    DN   +   +S 
Sbjct: 124 GDPKGEFTKALDLDFDASAIFGNLRSKRYVLVIEDGKVKKTFIEP---DNTGLN---VSK 177

Query: 165 PENVL 169
            ENVL
Sbjct: 178 AENVL 182


>gi|46128599|ref|XP_388853.1| hypothetical protein FG08677.1 [Gibberella zeae PH-1]
          Length = 166

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 62/110 (56%), Gaps = 9/110 (8%)

Query: 30  DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89
           + N    F  K+V L ++PGAFTPTCS   +P + +  + ++ +G+++V  ++VNDAFVM
Sbjct: 36  NYNASQEFKSKKVVLISVPGAFTPTCSASHVPSYVENIEQIKAKGVDQVIVVAVNDAFVM 95

Query: 90  NAWGKKLEIKNVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           + W K   I + K+L   D + +F+  +G          G R+ R+  +I
Sbjct: 96  HGWAKANGITDDKILFMSDHNAKFSTSIGW-------NLGERTGRFAVVI 138


>gi|150863887|ref|XP_001382517.2| hypothetical protein PICST_65232 [Scheffersomyces stipitis CBS
           6054]
 gi|149385143|gb|ABN64488.2| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 194

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 68/125 (54%), Gaps = 20/125 (16%)

Query: 41  RVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE-GIEEVYCLSVNDAFVMNAWGKKL--- 96
            V + A+PGAFTPTC+++ +P + +   DL+ E  I  V  ++ NDAFV+NAWGK L   
Sbjct: 55  NVLIVAVPGAFTPTCTENHIPPYLEHLSDLKAEKHIGAVIIIATNDAFVLNAWGKLLIKD 114

Query: 97  EIKNVKLL-----------PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI--KDMVVE 143
            IKNV  +            D +G F++   +   K   G G+R+ RY  +I  KD  V+
Sbjct: 115 AIKNVASIKEANGPSVYFASDVNGSFSKSFDLASDK---GTGIRTSRYATVIDSKDKTVK 171

Query: 144 SWFVE 148
            + VE
Sbjct: 172 YFGVE 176


>gi|50413656|ref|XP_457296.1| DEHA2B07744p [Debaryomyces hansenii CBS767]
 gi|49652961|emb|CAG85297.1| DEHA2B07744p [Debaryomyces hansenii]
          Length = 178

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 68/125 (54%), Gaps = 6/125 (4%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N +    GK++ L +  GAFTP C++  LP +     + + +G++++  L+ ND FV +A
Sbjct: 37  NLEKELPGKKIVLTSAIGAFTPPCTEDHLPTYLNNIKNFKSKGVDKIIVLTDNDPFVNSA 96

Query: 92  WGKKLEIKN----VKLLPDGSGEFTRKMGMLVYKD--NVGFGLRSWRYGALIKDMVVESW 145
           WGK L  K+    V    D +   ++ +G     D  + GFG+R+ RY A+I + V++  
Sbjct: 97  WGKALGYKDEENYVIFATDPNAALSKNLGKKFIADMTDDGFGVRTSRYAAIIDNGVIKYL 156

Query: 146 FVEEG 150
             E+G
Sbjct: 157 ESEDG 161


>gi|45187719|ref|NP_983942.1| ADL154Cp [Ashbya gossypii ATCC 10895]
 gi|44982480|gb|AAS51766.1| ADL154Cp [Ashbya gossypii ATCC 10895]
          Length = 197

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 68/134 (50%), Gaps = 7/134 (5%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE 97
           A  +  +  +P AF+P CS   +PG+ +  D+L+ +G ++V    VND+FV  AW + L+
Sbjct: 68  ASGKHLIVGVPAAFSPACSSSHVPGYIQHLDELKSKGFKQVLVTCVNDSFVTKAWAESLK 127

Query: 98  I-KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA 156
              +V+++ D  G F    G L          RS RY  +++D  V   FVE   +    
Sbjct: 128 CPSDVRVIADTQGAFASAGGFLFDGKQTFGNDRSVRYALVVEDGKVVRDFVEPDKTG--- 184

Query: 157 TDPYEISSPENVLK 170
               ++S+ ENVLK
Sbjct: 185 ---LKVSAAENVLK 195


>gi|115443134|ref|XP_001218374.1| hypothetical protein ATEG_09752 [Aspergillus terreus NIH2624]
 gi|114188243|gb|EAU29943.1| hypothetical protein ATEG_09752 [Aspergillus terreus NIH2624]
          Length = 165

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 14/134 (10%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LF++PGAFTPTCS + +PG+ K    L+ +G++ V  ++ ND FVM+AW K  
Sbjct: 42  WADKKVVLFSVPGAFTPTCSVNHMPGYIKNLPQLKEKGVQVVAVVASNDPFVMSAWAKAN 101

Query: 97  EIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNC 155
            +K+ +  L D    F+  +G          G R+ RY  +I    V    +E       
Sbjct: 102 GVKDEILFLSDPEARFSSSLGW-------ANGGRTGRYAVVIDHGKVTYAQIE------T 148

Query: 156 ATDPYEISSPENVL 169
                E+SS E VL
Sbjct: 149 KKGAVEVSSAETVL 162


>gi|321459886|gb|EFX70934.1| hypothetical protein DAPPUDRAFT_112201 [Daphnia pulex]
          Length = 132

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 41  RVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN 100
           +V +  + GAFTP CS   LPG+   ++  + +GI+E+ C++VND +VM+AWGK L    
Sbjct: 43  KVIIVGVSGAFTPCCSKTHLPGYVSDFEKFKSKGIDEIVCVAVNDPYVMDAWGKDLNTNG 102

Query: 101 -VKLLPDGSGEFTRKMGM 117
            V++L D +G F +   +
Sbjct: 103 KVRMLADTNGAFAKAANL 120


>gi|145251784|ref|XP_001397405.1| peroxiredoxin pmp20 [Aspergillus niger CBS 513.88]
 gi|134082942|emb|CAK46778.1| unnamed protein product [Aspergillus niger]
          Length = 166

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 2/87 (2%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF++PGAFTPTCS + +PG+ +    L+ +G++ V  ++ ND FVM+A
Sbjct: 37  NASKEWADKKVVLFSVPGAFTPTCSINHVPGYIQNLPQLKEKGVQVVAVIASNDPFVMSA 96

Query: 92  WGKKLEIK--NVKLLPDGSGEFTRKMG 116
           WGK   +K  ++  L D    F+  +G
Sbjct: 97  WGKANNVKGDDILFLTDPDARFSNNLG 123


>gi|328862093|gb|EGG11195.1| hypothetical protein MELLADRAFT_92335 [Melampsora larici-populina
           98AG31]
          Length = 158

 Score = 71.6 bits (174), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 69/129 (53%), Gaps = 9/129 (6%)

Query: 29  KDVNTQDLF---AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVND 85
           K  N  DLF   A ++V +F LP      CS   LPGF     +++ +G+ E+YCL+ ND
Sbjct: 22  KLTNLGDLFLIPADRKVVVFGLPA-----CSISHLPGFISKASEIKSKGVSEIYCLATND 76

Query: 86  AFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVES 144
           A+VM+ WG+  +  + V+++ D   ++    G+ +   + G G R+ R+  +I D+ V  
Sbjct: 77  AYVMSGWGRFTKSGDQVQMISDTDLKWLEPAGLTIDLSDHGLGTRANRFALIIDDLKVTY 136

Query: 145 WFVEEGFSD 153
             VE+   D
Sbjct: 137 VGVEKSAGD 145


>gi|164655491|ref|XP_001728875.1| hypothetical protein MGL_4042 [Malassezia globosa CBS 7966]
 gi|159102761|gb|EDP41661.1| hypothetical protein MGL_4042 [Malassezia globosa CBS 7966]
          Length = 184

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 33  TQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW 92
           T   + GK++ + ++PGA+TP C    +P   K  D+++ +G++ +Y ++ ND +VM+AW
Sbjct: 49  THKEWKGKKIVVVSIPGAYTPICHQQHIPPLVKRADEVKAKGVDAIYVIASNDPYVMSAW 108

Query: 93  GKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
           G     K+ V    D +  F++ +G  +       G R+ RY  +I D+ V  +  +EG
Sbjct: 109 GIFNNAKDKVVFASDLNIAFSKALGATIDLSFKDMGERTARYALIIDDLKVVDFGSDEG 167


>gi|226293413|gb|EEH48833.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18]
          Length = 183

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 80/163 (49%), Gaps = 16/163 (9%)

Query: 13  MRVATVLPDGSKAFQ---WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           +RV   +PD    F+      +N      GK + +   PGAF+P CS   +PGF K +  
Sbjct: 30  VRVGDEVPDHMVLFENLPSNKINLAKELTGKGLII-GTPGAFSPACSASHVPGFIK-HQK 87

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKL---EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           LR  G   V+ +SVND FV  AW + +   +   ++ L D  G+FT+ + +      +  
Sbjct: 88  LRDAG--RVFVVSVNDPFVTGAWSRMIDPQQTSGIRFLADPMGKFTKALDLGFDAKAIFG 145

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            +RS RY  +I+D  V+  F+E    DN       +S+ ENVL
Sbjct: 146 NIRSKRYVLVIEDGKVKKTFIEP---DNTG---LSVSTAENVL 182


>gi|189198634|ref|XP_001935654.1| peroxiredoxin-2D [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187982753|gb|EDU48241.1| peroxiredoxin-2D [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 167

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 68/137 (49%), Gaps = 22/137 (16%)

Query: 13  MRVATVLPDGSKAFQWKDVNTQDL--------------FAGKRVFLFALPGAFTPTCSDH 58
           ++V   LP+G K F+W  +   D               +A K+V +F++PGAFTP C  H
Sbjct: 4   LKVGDTLPEGVK-FEWAPITDSDPTACGLPQTYDASKEWANKKVVVFSVPGAFTPGCQAH 62

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN--VKLLPDGSGEFTRKMG 116
            LP +     + + +G++ +  ++ NDA+VMNAWGK   +K   V  L D    F++  G
Sbjct: 63  HLPPYIAKAAEFKAKGVDIIATIASNDAWVMNAWGKVNGVKGDEVLFLSDTKTMFSQNYG 122

Query: 117 MLVYKDNVGFGLRSWRY 133
                   G G R+ R+
Sbjct: 123 W-----QAGMGDRNGRW 134


>gi|225684023|gb|EEH22307.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 183

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 80/163 (49%), Gaps = 16/163 (9%)

Query: 13  MRVATVLPDGSKAFQ---WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           +RV   +PD    F+      +N      GK + +   PGAF+P CS   +PGF K +  
Sbjct: 30  VRVGDEVPDHMVLFENLPSNKINLAKELTGKGLII-GTPGAFSPACSASHVPGFIK-HQK 87

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKL---EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           LR  G   V+ +SVND FV  AW + +   +   ++ L D  G+FT+ + +      +  
Sbjct: 88  LRDAG--RVFVVSVNDPFVTGAWSRMIDPQQTSGIRFLADPMGKFTKALDLGFDAKAIFG 145

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
            +RS RY  +I+D  V+  F+E    DN       +S+ ENVL
Sbjct: 146 NIRSKRYVLVIEDGKVKKTFIEP---DNTG---LSVSTAENVL 182


>gi|62865700|gb|AAY17044.1| p-166-2_1 [Pinus resinosa]
          Length = 106

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 63/106 (59%), Gaps = 8/106 (7%)

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKK-LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           ++L+ +GI+E+ C+SVND FVM  W K     K+VK L DGS ++T  +G+ +     G 
Sbjct: 6   EELKGKGIDEIICISVNDPFVMKEWAKTYTNNKHVKFLADGSAKYTYALGLEMDLSEKGL 65

Query: 127 GLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
           G+RS R+  ++ ++ V+   +EEG         +E+SS E +LK +
Sbjct: 66  GIRSRRFALVVDNLEVKVANIEEG-------PTFEVSSAEEILKSV 104


>gi|116193143|ref|XP_001222384.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88182202|gb|EAQ89670.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 166

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           F   +V L A+PGAFTPTC +  +  +     +L+ +G+++V  ++ NDAFVM+AWGK  
Sbjct: 42  FQTHKVVLVAVPGAFTPTCQEQHIVSYLSHLAELKAKGVDKVIFIASNDAFVMSAWGKAN 101

Query: 97  EIKNVKLL--PDGSGEFTRKMG 116
            IK+  +L   DG   F+R +G
Sbjct: 102 GIKDESILFMSDGGAAFSRSIG 123


>gi|130360|sp|P14292|PMPA_CANBO RecName: Full=Putative peroxiredoxin-A; AltName: Full=PMP20;
           AltName: Full=Peroxisomal membrane protein A; AltName:
           Full=Thioredoxin reductase; AltName: Allergen=Cand b 2
 gi|170899|gb|AAA34357.1| peroxisomal membrane protein (PMP20A) [Candida boidinii]
          Length = 167

 Score = 71.2 bits (173), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL--- 96
           K+  + ++PGAFTP C++  LPG+ K    +  +G++ V  +S ND FV+  W K+L   
Sbjct: 38  KKFVVVSVPGAFTPPCTEQHLPGYIKNLPRILSKGVDFVLVISQNDPFVLKGWKKELGAA 97

Query: 97  EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI-KDMVVESWFVEEGFSDNC 155
           + K +  + D + + T+K+G  +    +G G RS R   ++ +  +VE   +E G   + 
Sbjct: 98  DAKKLVFVSDPNLKLTKKLGSTIDLSAIGLGTRSGRLALIVNRSGIVEYAAIENGGEVDV 157

Query: 156 AT 157
           +T
Sbjct: 158 ST 159


>gi|238595833|ref|XP_002393883.1| hypothetical protein MPER_06313 [Moniliophthora perniciosa FA553]
 gi|215462022|gb|EEB94813.1| hypothetical protein MPER_06313 [Moniliophthora perniciosa FA553]
          Length = 179

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 66/122 (54%), Gaps = 2/122 (1%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +  K+V +F +PGAFTPTC  + LPG+ +   D +  G++ +  L+ +DAFV + 
Sbjct: 30  NVHKEWKRKKVVVFLVPGAFTPTCHINHLPGYVEKVADFKARGVDIIAVLAASDAFVTSR 89

Query: 92  WGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVG-FGLRSWRYGALIKDMVVESWFVEE 149
           WG+    K+ +  L D +  ++R +G+     N    G+ + RY  +I D+V++   V  
Sbjct: 90  WGRLHGTKDKILTLSDSNANWSRCLGLARPDSNDKVLGMCTARYARIIDDLVIKYVGVST 149

Query: 150 GF 151
           G 
Sbjct: 150 GI 151


>gi|130361|sp|P14293|PMPB_CANBO RecName: Full=Putative peroxiredoxin-B; AltName: Full=PMP20;
           AltName: Full=Peroxisomal membrane protein B; AltName:
           Full=Thioredoxin reductase; AltName: Allergen=Cand b 2
 gi|170901|gb|AAA34358.1| peroxisomal membrane protein (PMP20B) [Candida boidinii]
          Length = 167

 Score = 70.9 bits (172), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK 99
           K+  + ++PGAFTP C++  LPG+ K    +  +G++ V  ++ ND FV+  W K+L   
Sbjct: 38  KKFVVVSVPGAFTPPCTEQHLPGYIKNLPRILSKGVDFVLVITQNDPFVLKGWKKELGAA 97

Query: 100 NVKLL---PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI-KDMVVESWFVEEGFSDNC 155
           + K L    D + + T+K+G  +   ++G G RS R   ++ +  +VE   +E G   + 
Sbjct: 98  DAKKLIFVSDPNLKLTKKLGSTIDLSSIGLGTRSGRLALIVNRSGIVEYAAIENGGEVDV 157

Query: 156 AT 157
           +T
Sbjct: 158 ST 159


>gi|45504708|gb|AAS66898.1| probable peroxisomal membrane protein [Chaetomium globosum]
 gi|46406044|gb|AAS93687.1| probable peroxisomal membrane protein [Chaetomium globosum]
          Length = 166

 Score = 70.9 bits (172), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           F  K+V L A+PGAFTPTC +  +  +     +L+ +G+++V  ++ NDAFVM+AWGK  
Sbjct: 42  FQTKKVVLVAVPGAFTPTCQEQHIVSYLSHLAELKAKGVDKVIFIASNDAFVMSAWGKAN 101

Query: 97  EIKNVKLL--PDGSGEFTRKMG 116
            IK+  +L   D    F+R +G
Sbjct: 102 GIKDESILFMSDAGAAFSRSIG 123


>gi|327357514|gb|EGE86371.1| AhpC/TSA family protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 233

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 80/164 (48%), Gaps = 28/164 (17%)

Query: 3   RFQIPQVVFH------MRVATVLPD---------GSKAFQWKDVNTQDLFAGKRVFLFAL 47
           R   P  +FH      ++V   +PD         G+K    K++  + L  G        
Sbjct: 15  RASTPVALFHSTRPTFVKVGDAVPDLEVLTENSPGNKVNLAKELQGKGLIIG-------T 67

Query: 48  PGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN---VKLL 104
           PGAF+P CS   +PGF   + +L+  G  +V+ +SVNDAFV  AW K ++ +    ++ L
Sbjct: 68  PGAFSPACSAAHVPGFAN-HPNLKDAG--KVFVVSVNDAFVTGAWSKMVDPEQKSGIRFL 124

Query: 105 PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            D  GEFT+ + +      +   LRS RY  +I+D  V+  F+E
Sbjct: 125 GDPKGEFTKALDLDFDASAIFGNLRSKRYVLVIEDGKVKKTFIE 168


>gi|238489421|ref|XP_002375948.1| peroxiredoxin, putative [Aspergillus flavus NRRL3357]
 gi|220698336|gb|EED54676.1| peroxiredoxin, putative [Aspergillus flavus NRRL3357]
          Length = 155

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 63/113 (55%), Gaps = 6/113 (5%)

Query: 32  NTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNA 91
           N    +A K+V LF++PGAFTPTCS + +PG+ +    L+ +G++ V  ++ ND FVM+A
Sbjct: 37  NASKEWADKKVVLFSVPGAFTPTCSVNHVPGYIQNLPQLKEKGVQVVAVVASNDPFVMSA 96

Query: 92  WGKKLEIKN-----VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           WGK  +++N     V L P        ++G      ++    RSW+ G L  D
Sbjct: 97  WGKANKVENNDIVSVPLRPRRQVLGQHRLGQQRSHRSLCHCHRSWQ-GDLCSD 148


>gi|254581440|ref|XP_002496705.1| ZYRO0D06248p [Zygosaccharomyces rouxii]
 gi|238939597|emb|CAR27772.1| ZYRO0D06248p [Zygosaccharomyces rouxii]
          Length = 172

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 74/148 (50%), Gaps = 9/148 (6%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAG--KRVFLFALPGAFTPTCSDH 58
           +I  ++P   F  +   + P    A +     +   F    K V L   P AF+PTCS +
Sbjct: 3   LINQKVPTENFQFQYIPISPSDGDACKLPQAESWSKFLSEHKNVILTGAPAAFSPTCSIN 62

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK---NVKLLPDGSGEFTRKM 115
            +P + K   DL+ +G+++V  ++V++ F   AW K L +    ++K   D  G F +++
Sbjct: 63  HIPEYIKGIKDLQAKGVDQVVVITVDNPFANAAWAKSLGVNDTTHIKFASDAGGHFVKRL 122

Query: 116 GMLVYKDNVGFGLR-SWRYGALIKDMVV 142
           G   +   VG G+  S R+ A++KD V+
Sbjct: 123 G---FDLPVGEGVSWSTRWAAVVKDGVI 147


>gi|302814210|ref|XP_002988789.1| hypothetical protein SELMODRAFT_128676 [Selaginella moellendorffii]
 gi|300143360|gb|EFJ10051.1| hypothetical protein SELMODRAFT_128676 [Selaginella moellendorffii]
          Length = 90

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 59/96 (61%), Gaps = 10/96 (10%)

Query: 80  CLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLV-YKDNV-GFGLRSWRYGAL 136
           C+SVNDAFVM +WG+ L +   + +L DG+G+FTR +G+ V   D V G G+RS RY  L
Sbjct: 2   CVSVNDAFVMKSWGEALGVNGKILMLSDGNGKFTRDLGVTVDLSDKVEGLGVRSRRYSLL 61

Query: 137 IKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172
            +D +V+   +EEG         Y +SS + +LK +
Sbjct: 62  AEDGIVKVLNLEEG-------GAYTVSSADEILKAL 90


>gi|323451062|gb|EGB06940.1| hypothetical protein AURANDRAFT_28494 [Aureococcus anophagefferens]
          Length = 186

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           V   DLFAGKRV +F +P  FT TC++  +PG+  +  D   +G+ +V C SV   + M 
Sbjct: 54  VALGDLFAGKRVAVFGVPAPFTGTCTEQHVPGYAALAGDFEAKGV-DVVCFSVACPYAMR 112

Query: 91  AWGKKLEIKNVKL--LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
            W + + +    +  L D  G  T   G+         G RS R+  L+ D  V+++ +
Sbjct: 113 GWQQAMGVDETAMTFLADDLGAVTAAWGVAKDYSGTSLGPRSERFSMLVDDGTVKAFTI 171


>gi|13872871|dbj|BAB43979.1| peroxisomal membrane protein 20 [Candida boidinii]
          Length = 167

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK 99
           K+  + ++PGAFTP C++  LPG+ K    +  +G++ V  ++ ND FV+  W K+L   
Sbjct: 38  KKFVVVSVPGAFTPPCTEQHLPGYIKNLPRILSKGVDFVLVITQNDPFVLKGWKKELGAA 97

Query: 100 NVKLL---PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI-KDMVVESWFVEEGFSDNC 155
           + + L    D + + T+K+G  +   ++G G RS R   ++ +  +VE   +E G   + 
Sbjct: 98  DARKLIFVSDPNLKLTKKLGSTIDLSSIGLGTRSGRLALIVNRSGIVEYAAIENGGEVDV 157

Query: 156 AT 157
           +T
Sbjct: 158 ST 159


>gi|156052168|ref|XP_001592045.1| hypothetical protein SS1G_07492 [Sclerotinia sclerotiorum 1980]
 gi|154705269|gb|EDO05008.1| hypothetical protein SS1G_07492 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 183

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 59/105 (56%), Gaps = 6/105 (5%)

Query: 47  LPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI---KNVKL 103
           +P AF+PTCSD  +PGF  ++  L   G  +V+ +SVNDAFVMNAWGK L+      ++ 
Sbjct: 38  VPAAFSPTCSDSHVPGF-IMHPKLESAG--KVFVVSVNDAFVMNAWGKSLDADKKSGIRF 94

Query: 104 LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           L D  G FTR   +      +    RS RY  +I+   V+S  +E
Sbjct: 95  LADQDGSFTRSWDLEFEAAPLLGTNRSKRYAIVIEGGKVKSVNIE 139


>gi|164427260|ref|XP_964200.2| hypothetical protein NCU03151 [Neurospora crassa OR74A]
 gi|38567255|emb|CAE76545.1| probable peroxisomal membrane protein [Neurospora crassa]
 gi|157071672|gb|EAA34964.2| hypothetical protein NCU03151 [Neurospora crassa OR74A]
          Length = 166

 Score = 69.7 bits (169), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 59/103 (57%), Gaps = 9/103 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           FA K+V L A+PGAFTPTC    +P +    ++ + +G++++  ++ NDA+VM AWGK  
Sbjct: 42  FANKKVVLVAVPGAFTPTCQQQHVPSYLAKLEEFKSKGVDQIIFIASNDAWVMAAWGKAN 101

Query: 97  EIKNVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
            +K+  +L   D   +F++ +G          G R+ RY  +I
Sbjct: 102 GVKDESILFMSDADCKFSKSIGWTQ-------GDRTKRYAIVI 137


>gi|171683881|ref|XP_001906882.1| hypothetical protein [Podospora anserina S mat+]
 gi|170941901|emb|CAP67553.1| unnamed protein product [Podospora anserina S mat+]
          Length = 166

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           FA K+V L A+PGAFTPTC    +  +    DDL+ +G+++V  ++ ND +VM AWGK  
Sbjct: 42  FASKKVVLVAVPGAFTPTCQVSHVTSYLAKLDDLKAKGVDQVIFIASNDHWVMAAWGKAN 101

Query: 97  EIKNVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
            +K+  +L   D   EF++ +G          G R+ RY  ++
Sbjct: 102 GVKDDSILFMSDAGLEFSKSIGWTQ-------GDRTLRYAIVV 137


>gi|154312864|ref|XP_001555759.1| hypothetical protein BC1G_05133 [Botryotinia fuckeliana B05.10]
 gi|150849835|gb|EDN25028.1| hypothetical protein BC1G_05133 [Botryotinia fuckeliana B05.10]
          Length = 156

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 59/105 (56%), Gaps = 6/105 (5%)

Query: 47  LPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEI---KNVKL 103
           +P AF+PTCSD  +PG+  ++  L   G  +V+ +SVNDAFVMNAWGK L+      ++ 
Sbjct: 38  VPAAFSPTCSDSHVPGY-ILHPKLESAG--KVFVVSVNDAFVMNAWGKSLDADKKSGIRF 94

Query: 104 LPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
           L D  G FTR   +      V    RS RY  +I+   V+S  VE
Sbjct: 95  LGDQDGSFTRAWDLEFPAAPVLGTNRSKRYAIVIEGGKVKSVNVE 139


>gi|50422983|ref|XP_460069.1| DEHA2E17688p [Debaryomyces hansenii CBS767]
 gi|49655737|emb|CAG88329.1| DEHA2E17688p [Debaryomyces hansenii]
          Length = 185

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (54%), Gaps = 9/108 (8%)

Query: 41  RVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE-GIEEVYCLSVNDAFVMNAWGKKL--E 97
              + ++PGAFTPTC+ + +P F      L+ E  I  +  +S NDAFV+NAWGK L   
Sbjct: 49  NTLIVSVPGAFTPTCTANHIPPFLTNLSKLKKEKNIGSIIVISANDAFVLNAWGKLLLST 108

Query: 98  IKNVKLLP------DGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
           +K  +  P      DG+  F+++  + V     G G+R+ RY  +++D
Sbjct: 109 VKVTEPAPKIFFASDGNAAFSKEYDLSVDASANGMGIRTARYAIVVED 156


>gi|312213103|emb|CBX93185.1| similar to AhpC/TSA family protein [Leptosphaeria maculans]
          Length = 167

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 70/141 (49%), Gaps = 22/141 (15%)

Query: 13  MRVATVLPDGSKAFQWKDVNTQDL--------------FAGKRVFLFALPGAFTPTCSDH 58
           ++V    P+G K F+W  +   D               +A K+V LF++PGAFTP C   
Sbjct: 4   LKVGDSFPEGVK-FEWAPITDSDPTACGRPQEYDASKEWANKKVVLFSVPGAFTPGCQAF 62

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN--VKLLPDGSGEFTRKMG 116
            LP + +   + R +G++ +  ++ NDA+VMNAWGK   +K   V  L D    F+++ G
Sbjct: 63  HLPPYIQKAGEFRQKGVDIIATIASNDAWVMNAWGKVNGVKGDEVLFLSDTKTFFSKEHG 122

Query: 117 MLVYKDNVGFGLRSWRYGALI 137
                   G G R+ R+  +I
Sbjct: 123 W-----QAGMGDRNGRWAMVI 138


>gi|67902186|ref|XP_681349.1| hypothetical protein AN8080.2 [Aspergillus nidulans FGSC A4]
 gi|40740512|gb|EAA59702.1| hypothetical protein AN8080.2 [Aspergillus nidulans FGSC A4]
          Length = 114

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 46/62 (74%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V LF++PGAFTPTCS + LPG+ K   +L+ +GI+ V  ++ ND FVM+AWGK  
Sbjct: 43  WADKKVVLFSVPGAFTPTCSVNHLPGYIKNLPELKKKGIQIVAVVASNDPFVMSAWGKAN 102

Query: 97  EI 98
           ++
Sbjct: 103 QV 104


>gi|289617933|emb|CBI55510.1| unnamed protein product [Sordaria macrospora]
          Length = 166

 Score = 68.9 bits (167), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           FA K+V L A+PGAFTPTC    +P +    ++ +  G++++  ++ NDA+VM AWGK  
Sbjct: 42  FANKKVVLVAVPGAFTPTCQQQHVPSYLGKLEEFKANGVDQIIFIASNDAWVMAAWGKAN 101

Query: 97  EIKNVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
            +K+  +L   D   +F++ +G          G R+ RY  +I
Sbjct: 102 GVKDESILFMSDADCKFSKSIGWTQ-------GDRTKRYAIVI 137


>gi|118721272|emb|CAL69875.1| peroxiredoxin II F [Pisum sativum]
          Length = 135

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 44/67 (65%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
            D+F  K+V +F LPGA+T  CS   +P ++   D  + +G++ V C+++ND + +NAW 
Sbjct: 66  NDIFKDKKVVIFGLPGAYTGVCSSKHVPPYKHNIDKFKAKGVDSVICVAINDPYTVNAWA 125

Query: 94  KKLEIKN 100
           +K++ K+
Sbjct: 126 EKIQAKD 132


>gi|159487753|ref|XP_001701887.1| peroxiredoxin type II [Chlamydomonas reinhardtii]
 gi|158281106|gb|EDP06862.1| peroxiredoxin type II [Chlamydomonas reinhardtii]
          Length = 226

 Score = 68.6 bits (166), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 67/132 (50%), Gaps = 4/132 (3%)

Query: 29  KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88
           K ++  D+F GK+V L   PG   P C +  +PG+    D L   G+++V C++V+    
Sbjct: 80  KKLSLTDVFKGKKVILVGFPGG--PVCVEKHIPGYIAQADKLATMGVDKVLCVTVDAPAA 137

Query: 89  MNAWGKK--LEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
           +     +  L+ K V+LL D +G   R +G+ +     G G +  RY A+++D V+    
Sbjct: 138 VAELAARPTLQHKRVELLADKNGGLVRLLGLEIGAPEAGQGPKCQRYAAVVEDGVLLKLR 197

Query: 147 VEEGFSDNCATD 158
           VE   +D   TD
Sbjct: 198 VESAPADLKVTD 209


>gi|320583567|gb|EFW97780.1| putative peroxiredoxin [Pichia angusta DL-1]
          Length = 187

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 66/136 (48%), Gaps = 10/136 (7%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW----GK 94
           GK+  +  +PGAF+  CS+  +PG+     D   +G  ++  +SVND FV++AW    G 
Sbjct: 52  GKQALIVGVPGAFSGPCSEVHIPGYLNKLPDFISKGYRDLVVISVNDPFVVSAWRSSFGL 111

Query: 95  KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDN 154
           K E  NV    D   EF + +G+      V   +RS R+   + D  V + FVE      
Sbjct: 112 KPESPNVSFFADSKAEFVKALGLDFDATEVFGNVRSKRFCLAVDDNKVVAEFVEP----- 166

Query: 155 CATDPYEISSPENVLK 170
               P ++++ + V K
Sbjct: 167 -ENTPVDVTAADKVFK 181


>gi|2598045|emb|CAA05528.1| PMP20 [Schizosaccharomyces pombe]
          Length = 156

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 10/132 (7%)

Query: 41  RVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL---E 97
           +  +  +PGAFTP CS  Q+PG+         +GI  +Y ++VND FV  AW K     E
Sbjct: 29  KFIIVGVPGAFTPPCS-SQVPGYIANEKQFAAKGISGIYVVAVNDVFVTKAWKKSFDGGE 87

Query: 98  IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCAT 157
              V  + D +GEFT+          +   LRS RY A++++  V   F+E   +D    
Sbjct: 88  QSGVHFVADWNGEFTKAFDAGFDASGLLGPLRSKRYAAVVENGKVVKVFIENEVTD---- 143

Query: 158 DPYEISSPENVL 169
              +ISS + VL
Sbjct: 144 --VDISSADKVL 153


>gi|19075206|ref|NP_587706.1| thioredoxin peroxidase [Schizosaccharomyces pombe 972h-]
 gi|13432214|sp|O14313|PMP20_SCHPO RecName: Full=Putative peroxiredoxin pmp20; AltName:
           Full=Peroxisomal membrane protein pmp20; AltName:
           Full=Thioredoxin reductase
 gi|3646447|emb|CAA20911.1| thioredoxin peroxidase [Schizosaccharomyces pombe]
          Length = 156

 Score = 68.2 bits (165), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 10/132 (7%)

Query: 41  RVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL---E 97
           +  +  +PGAFTP CS  Q+PG+         +GI  +Y ++VND FV  AW K     E
Sbjct: 29  KFIIVGVPGAFTPPCS-SQVPGYIANEKQFAAKGISGIYVVAVNDVFVTKAWKKSFDGGE 87

Query: 98  IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCAT 157
              V  + D +GEFT+          +   LRS RY A++++  V   F+E   +D    
Sbjct: 88  QSGVHFVADWNGEFTKAFDAGFDASGLLGPLRSKRYAAVVENGKVVKVFIENEVTD---- 143

Query: 158 DPYEISSPENVL 169
              +ISS + VL
Sbjct: 144 --VDISSADKVL 153


>gi|218459816|ref|ZP_03499907.1| putative hydroperoxide reductase protein [Rhizobium etli Kim 5]
          Length = 64

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 37/59 (62%)

Query: 5  QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGF 63
          Q+P V F  RV      G   ++W+D  T D F+GKRV LF+LPGAFTP CS  QLP F
Sbjct: 6  QVPIVTFRTRVRDESISGPNPYRWEDKTTDDYFSGKRVILFSLPGAFTPICSTFQLPDF 64


>gi|295664747|ref|XP_002792925.1| AhpC/TSA family protein [Paracoccidioides brasiliensis Pb01]
 gi|226278446|gb|EEH34012.1| AhpC/TSA family protein [Paracoccidioides brasiliensis Pb01]
          Length = 182

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 72/142 (50%), Gaps = 10/142 (7%)

Query: 13  MRVATVLPDGSKAFQ---WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           +RV   +PD    F+      +N      GK + +   PGAF+P CS   +PGF K +  
Sbjct: 30  VRVGDEVPDLMVLFENLPSNKINLAKELTGKGLII-GTPGAFSPACSAAHVPGFIK-HQK 87

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKL---EIKNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
           LR  G  +V+ +SVND FV  AW + +   +   ++ L D  GEFT+ + +      +  
Sbjct: 88  LRDAG--KVFVVSVNDPFVTGAWSRMIDPEQTSGIRFLADPKGEFTKALDLDFDAKAIFG 145

Query: 127 GLRSWRYGALIKDMVVESWFVE 148
            +RS RY  +I+D  V+  F+E
Sbjct: 146 NIRSKRYVLVIEDGKVKKAFIE 167


>gi|322708108|gb|EFY99685.1| peroxiredoxin 5, prdx5, putative [Metarhizium anisopliae ARSEF 23]
          Length = 184

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 75/157 (47%), Gaps = 15/157 (9%)

Query: 19  LPDGSKAFQ---WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGI 75
           LPD    F+      VN  + F     ++  +PGAFT TCS   +P +    +  R +  
Sbjct: 36  LPDFDGLFENSPGNKVNLSEEFKSSNGYIVGVPGAFTGTCSSLHVPSY---INHPRLKEA 92

Query: 76  EEVYCLSVNDAFVMNAWGKKLEIK---NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWR 132
            +V+ +SVND FVM AW ++L+      ++ + D S EFT+ + +      +  G+RS R
Sbjct: 93  GQVFVVSVNDPFVMKAWAEQLDPAGETGIRFIADPSAEFTKALDIGFDGSAIFGGVRSKR 152

Query: 133 YGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169
           Y   I++  V   F+E    D    D   +S  E VL
Sbjct: 153 YALKIENGKVSKTFIEP---DGTGAD---VSMAEKVL 183


>gi|154277968|ref|XP_001539813.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150413398|gb|EDN08781.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 191

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 60/109 (55%), Gaps = 6/109 (5%)

Query: 43  FLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-- 100
            +   PGAF+P CS   +PGF    +  +  G  +V+ +SVNDAFV  AW K ++ +   
Sbjct: 63  LIIGSPGAFSPACSAAYVPGFA---NHPKLTGAGKVFVVSVNDAFVTGAWSKVIDPEQKS 119

Query: 101 -VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            ++ L D +GEFT+ + +     ++    RS RY  +I+D  V+  F+E
Sbjct: 120 GIRFLGDANGEFTKALDLDFDASSIFGNHRSKRYVLVIEDGKVQKTFIE 168


>gi|325089136|gb|EGC42446.1| AhpC/TSA family protein [Ajellomyces capsulatus H88]
          Length = 191

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 60/109 (55%), Gaps = 6/109 (5%)

Query: 43  FLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-- 100
            +   PGAF+P CS   +PGF    +  +  G  +V+ +SVNDAFV  AW K ++ +   
Sbjct: 63  LIIGSPGAFSPACSAAYVPGFA---NHPKLTGAGKVFVVSVNDAFVTGAWSKVIDPEQKS 119

Query: 101 -VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            ++ L D +GEFT+ + +     ++    RS RY  +I+D  V+  F+E
Sbjct: 120 GIRFLGDANGEFTKALDLDFDASSIFGNHRSKRYVLVIEDGKVQKTFIE 168


>gi|257167985|gb|ACV49766.1| putative peroxiredoxin [Pichia angusta]
          Length = 187

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 65/136 (47%), Gaps = 10/136 (7%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW----GK 94
           GK+  +  +PGAF+  CS+  +PG+     D   +G   +  +SVND FV++AW    G 
Sbjct: 52  GKQALIVGVPGAFSGPCSEVHIPGYLNKLPDFISKGYRNLVVISVNDPFVVSAWRNSFGL 111

Query: 95  KLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDN 154
           K E  NV    D   EF + +G+      +   +RS R+   + D  V + FVE      
Sbjct: 112 KPESPNVSFFADSKAEFVKALGLDFDATEIFGNVRSKRFCLAVDDNKVVAEFVEP----- 166

Query: 155 CATDPYEISSPENVLK 170
               P ++++ + V K
Sbjct: 167 -QNTPVDVTAADKVFK 181


>gi|225560848|gb|EEH09129.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
          Length = 191

 Score = 67.4 bits (163), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 60/109 (55%), Gaps = 6/109 (5%)

Query: 43  FLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-- 100
            +   PGAF+P CS   +PGF    +  +  G  +V+ +SVNDAFV  AW K ++ +   
Sbjct: 63  LIIGSPGAFSPACSAAYVPGFA---NHPKLTGAGKVFVVSVNDAFVTGAWSKVIDPEQKS 119

Query: 101 -VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            ++ L D +GEFT+ + +     ++    RS RY  +I+D  V+  F+E
Sbjct: 120 GIRFLGDANGEFTKALDLDFDASSIFGNHRSKRYVLVIEDGKVQKTFIE 168


>gi|238504400|ref|XP_002383431.1| peroxiredoxin 5, prdx5, putative [Aspergillus flavus NRRL3357]
 gi|220690902|gb|EED47251.1| peroxiredoxin 5, prdx5, putative [Aspergillus flavus NRRL3357]
          Length = 226

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 13/142 (9%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +   GK V +  +P AF+P CS   +PG+   +  L+  G  +V+ +SVND FVM 
Sbjct: 94  VNLANELKGKGV-IVGVPAAFSPACSSSHVPGYIN-HPKLKEAG--QVFVVSVNDPFVMK 149

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AW   L+      ++ L D +G+F+  + +     ++    RS RY  L+++  V+  FV
Sbjct: 150 AWATSLDPSGKSGIRFLGDPTGKFSEALDVTFDSSSIFGNHRSKRYALLVENGKVKEAFV 209

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN   D   +S+ E VL
Sbjct: 210 EP---DNTGLD---VSAAEKVL 225


>gi|330927040|ref|XP_003301714.1| hypothetical protein PTT_13288 [Pyrenophora teres f. teres 0-1]
 gi|311323348|gb|EFQ90198.1| hypothetical protein PTT_13288 [Pyrenophora teres f. teres 0-1]
          Length = 178

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 79/159 (49%), Gaps = 15/159 (9%)

Query: 1   MIRFQIPQVVFH------MRVATVLPDGS--KAFQWKDVNTQDLFAGKRVFLFALPGAFT 52
           ++R  + + +FH      ++V   LPD    +      VN      GK   +  +P AF+
Sbjct: 9   LVRPTVTRRLFHASPTAFVKVGDKLPDVDLVEGSPGNKVNLAKELTGKG-LIIGVPAAFS 67

Query: 53  PTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE---IKNVKLLPDGSG 109
           P+CS+  +PG+    +  + +    V+ +SVND FVM AWGK L+      ++ L D S 
Sbjct: 68  PSCSESHVPGY---INSPKLKDAGNVFVVSVNDPFVMKAWGKMLDPAASSGIRFLGDPSL 124

Query: 110 EFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            FT+ + +     ++  G RS RY  +I++  V++  VE
Sbjct: 125 SFTKALDLSFDGASIFGGDRSKRYALVIENGAVKAAHVE 163


>gi|225458263|ref|XP_002281359.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 239

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 68/125 (54%), Gaps = 15/125 (12%)

Query: 15  VATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74
           ++++ P+G    + ++V+   L  GK++ L  +  AF+P C+      F K  + ++ + 
Sbjct: 95  LSSLGPNG----RVQNVDISSLAKGKKLLLVGVSAAFSPNCTR-----FVKRIEAMKGKS 145

Query: 75  IEEVYCLSVNDAFVMNAWGKKLEI-KNVKLLPDGSGEFTRKMGMLVYKDN-----VGFGL 128
            + + C+++ND FVM AWG+ L + + V +L DG GE    +G+  +  N      G G+
Sbjct: 146 ADLIACVAINDEFVMRAWGQHLGVGEKVMMLSDGRGELATALGLSTHIQNDVSAGSGLGV 205

Query: 129 RSWRY 133
           RS R+
Sbjct: 206 RSRRF 210


>gi|146413901|ref|XP_001482921.1| hypothetical protein PGUG_04876 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146392620|gb|EDK40778.1| hypothetical protein PGUG_04876 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 188

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (53%), Gaps = 12/113 (10%)

Query: 42  VFLFALPGAFTPTCSDHQLPGF-EKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN 100
           V L A+PGAFTPTC+++ +P + E +        +  +  +S NDAFV+NAW K L +++
Sbjct: 55  VLLVAVPGAFTPTCTENHIPPYLENLVKLKEKNNVALIIIVSTNDAFVLNAWAKLL-LRD 113

Query: 101 VK---------LLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYG-ALIKDMVVE 143
           VK            DG  +F++K  + V     G G+R+ RY  A  KD  V+
Sbjct: 114 VKPTGKEPQLVFASDGGAQFSQKFDLSVDATARGMGIRTARYAIAFSKDRRVK 166


>gi|169599749|ref|XP_001793297.1| hypothetical protein SNOG_02698 [Phaeosphaeria nodorum SN15]
 gi|160705313|gb|EAT89429.2| hypothetical protein SNOG_02698 [Phaeosphaeria nodorum SN15]
          Length = 204

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 77/143 (53%), Gaps = 14/143 (9%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV-M 89
           VN     +GK V +  +P AF+P+CS++ +PG+    +  + +   +V+ +SVND FV M
Sbjct: 72  VNLAKELSGKGVII-GVPAAFSPSCSENHIPGY---VNSPKLKDAGKVFVVSVNDPFVSM 127

Query: 90  NAWGKKLE---IKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWF 146
            AWGK L+      ++ L D S EFT+ + +     ++  G RS RY  +I++  V+   
Sbjct: 128 KAWGKTLDPSGSSGIRFLGDPSVEFTKALDLSFDGASIFGGDRSKRYALVIENGAVKEAH 187

Query: 147 VEEGFSDNCATDPYEISSPENVL 169
           VE    DN   +   +S+ E VL
Sbjct: 188 VEP---DNTGLN---VSAAEKVL 204


>gi|259481772|tpe|CBF75606.1| TPA: thioredoxin peroxidase/alkyl hydroperoxide reductase
           (Eurofung) [Aspergillus nidulans FGSC A4]
          Length = 184

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 72/142 (50%), Gaps = 13/142 (9%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN      GK V +  +P AF+P CS   +PG+   +  L+  G  +V+ ++VND FV  
Sbjct: 52  VNLAKELKGKGVII-GVPAAFSPACSSTHVPGYIS-HPKLKEAG--QVFVVAVNDPFVTK 107

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG  L+      ++ L D +G+F+  + +      +    RS RY  L++D  ++  FV
Sbjct: 108 AWGTTLDPTGKSGIRFLGDPTGKFSEALDVTFDSTTIFGNQRSKRYALLVEDGKIKEAFV 167

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN      ++S+ ENVL
Sbjct: 168 EP---DNTGV---KVSTAENVL 183


>gi|255947428|ref|XP_002564481.1| Pc22g04430 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591498|emb|CAP97731.1| Pc22g04430 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 181

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (51%), Gaps = 14/133 (10%)

Query: 41  RVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN 100
           +  +   P AF+P CS   +PGF   +  L+  G  + + +SVND FV  AW   L+   
Sbjct: 58  KAVIIGTPAAFSPACSSTHVPGFIN-HPKLKEAG--QAFVISVNDPFVTKAWADSLDPSG 114

Query: 101 ---VKLLPDGSGEFTRKMGMLVYKDNVGFGL-RSWRYGALIKDMVVESWFVEEGFSDNCA 156
              ++ L D SGEFT+ +  L ++ +  FG  RS RY  L++D  V+  FVE    DN  
Sbjct: 115 KSGIRFLGDPSGEFTKALD-LSFESSAIFGNDRSKRYVLLVEDGKVKEAFVEP---DNTG 170

Query: 157 TDPYEISSPENVL 169
            D   +S+ E VL
Sbjct: 171 LD---VSAAEKVL 180


>gi|189191644|ref|XP_001932161.1| AhpC/TSA family protein [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187973767|gb|EDU41266.1| AhpC/TSA family protein [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 180

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 79/159 (49%), Gaps = 15/159 (9%)

Query: 1   MIRFQIPQVVFH------MRVATVLPDGS--KAFQWKDVNTQDLFAGKRVFLFALPGAFT 52
           ++R    + +FH      ++V   LPD    +      VN      GK + +  +P AF+
Sbjct: 9   LVRPTATRRLFHASAPAFVKVGDKLPDVDLVEGSPGNKVNLAKELTGKGLII-GVPAAFS 67

Query: 53  PTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE---IKNVKLLPDGSG 109
           P+CS+  +PG+    +  + +    V+ +SVND FVM AWGK L+      ++ L D S 
Sbjct: 68  PSCSESHVPGY---INSPKLKDAGNVFVVSVNDPFVMKAWGKILDPSGSSGIRFLGDPSL 124

Query: 110 EFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVE 148
            FTR + +     ++  G RS RY  +I++  V++  VE
Sbjct: 125 SFTRALDLSFDGASIFGGDRSKRYALVIENGAVKAAHVE 163


>gi|315055851|ref|XP_003177300.1| hypothetical protein MGYG_01381 [Arthroderma gypseum CBS 118893]
 gi|311339146|gb|EFQ98348.1| hypothetical protein MGYG_01381 [Arthroderma gypseum CBS 118893]
          Length = 168

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 8/103 (7%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           +A K+V L ++PGAFTPTCS   LP +     +L+ +G++ V  ++ ND FVM+AWGK  
Sbjct: 43  WANKKVVLVSVPGAFTPTCSATHLPDYVSKLGELKNKGVDNVVVIAFNDPFVMSAWGKAN 102

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
            +   ++  L D   +F+       ++   G      RY  +I
Sbjct: 103 GVTGDDILFLSDAGSQFSSAFAWTAHEGRTG------RYAMVI 139


>gi|119472653|ref|XP_001258393.1| AhpC/TSA family protein [Neosartorya fischeri NRRL 181]
 gi|119406545|gb|EAW16496.1| AhpC/TSA family protein [Neosartorya fischeri NRRL 181]
          Length = 182

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 74/142 (52%), Gaps = 13/142 (9%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN      GK V +  +P AF+P CS   +PG+   +  L+  G  +V+ +SVND FVM 
Sbjct: 50  VNLAKELKGKGVII-GVPAAFSPACSSSHVPGYIN-HPKLKEAG--QVFVVSVNDPFVMK 105

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG  L+      ++ + D +G+F+  + ++    ++    RS RY  +++D  V+  ++
Sbjct: 106 AWGVSLDATGKSGIRFMGDPTGKFSEALDVIFDSSSIFGNQRSKRYALVVEDGKVKEAYI 165

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN   +   +S+ E VL
Sbjct: 166 EP---DNTGVN---VSAAEKVL 181


>gi|164523498|gb|ABY60796.1| peroxisomal membrane associated protein 20 [Pichia angusta]
          Length = 165

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 67/121 (55%), Gaps = 3/121 (2%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK 99
           K+  + ++PGAFTP C++  LP + +   +   +G++ +  ++ ND FV+ AW +KL   
Sbjct: 37  KKFVVVSVPGAFTPPCTNQHLPEYIQKVQNFASKGVDFILVVTQNDPFVLRAWREKLGAT 96

Query: 100 NVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI-KDMVVESWFVEEGFSDNCA 156
           + K+L   D   + ++K+G  +   ++G G RS R   ++ +  +VE    EEG   N +
Sbjct: 97  SNKILFVSDPYLDLSKKLGSPIDLGDLGLGTRSSRLAVIVNRSGIVEFVADEEGGEVNVS 156

Query: 157 T 157
           T
Sbjct: 157 T 157


>gi|169764367|ref|XP_001816655.1| thioredoxin peroxidase/alkyl hydroperoxide reductase [Aspergillus
           oryzae RIB40]
 gi|83764509|dbj|BAE54653.1| unnamed protein product [Aspergillus oryzae]
          Length = 182

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 72/142 (50%), Gaps = 13/142 (9%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN      GK V +  +P AF+P CS   +PG+   +  L+  G  +V+ +SVND FVM 
Sbjct: 50  VNLASELKGKGV-IVGVPAAFSPACSSSHVPGYIN-HPKLKEAG--QVFVVSVNDPFVMK 105

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AW   L+      ++ L D +G+F+  + +     ++    RS RY  L+++  V+  FV
Sbjct: 106 AWATSLDPSGKSGIRFLGDPTGKFSEALDVTFDSSSIFGNHRSKRYALLVENGKVKEAFV 165

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN   D   +S+ E VL
Sbjct: 166 EP---DNTGLD---VSAAEKVL 181


>gi|254568606|ref|XP_002491413.1| Thiol-specific peroxiredoxin, reduces hydroperoxides to protect
           against oxidative damage [Pichia pastoris GS115]
 gi|238031210|emb|CAY69133.1| Thiol-specific peroxiredoxin, reduces hydroperoxides to protect
           against oxidative damage [Pichia pastoris GS115]
          Length = 176

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 68/140 (48%), Gaps = 19/140 (13%)

Query: 44  LFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL------- 96
           +  +P AF+PTCSD  +PG+     DL+ + I  +Y +SVND FV NAW K L       
Sbjct: 45  IVTVPAAFSPTCSDTHVPGYLTRLKDLKSKNINHLYVVSVNDPFVTNAWKKTLLKSFSID 104

Query: 97  --EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI--KDMVVESWFVEEGFS 152
             E+  V  L D  G+F   +  L +     FG    +  ALI   D  V   FVE    
Sbjct: 105 KTEVP-VTFLADPKGDFIHGLD-LDFDSAAVFGNNRSKRSALIIGSDGKVAKDFVEP--- 159

Query: 153 DNCATDPYEISSPENVLKVI 172
           DN      ++S+ ++VLK +
Sbjct: 160 DNTG---LKVSAVDSVLKAL 176


>gi|154294333|ref|XP_001547608.1| hypothetical protein BC1G_13939 [Botryotinia fuckeliana B05.10]
 gi|150844778|gb|EDN19971.1| hypothetical protein BC1G_13939 [Botryotinia fuckeliana B05.10]
          Length = 192

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 10/131 (7%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +L  GK   +  +P AF+P+CS+  +PG+   +  L+  G  +V+ ++VND FV  
Sbjct: 48  VNLSELTTGK-ALIIGVPAAFSPSCSNSHIPGYIN-HPKLKEAG--DVFVVAVNDPFVTK 103

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG  L+      ++ L D +  FT  + +      +  G RS RY   I+D  V++  V
Sbjct: 104 AWGSTLDPTGKSGIRFLGDPTASFTSALDLTFDGTAIFGGPRSKRYALQIEDGKVKALHV 163

Query: 148 EEGFSDNCATD 158
           E    DN   D
Sbjct: 164 EP---DNTGLD 171


>gi|328352077|emb|CCA38476.1| hypothetical protein PP7435_Chr2-0792 [Pichia pastoris CBS 7435]
          Length = 164

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 68/140 (48%), Gaps = 19/140 (13%)

Query: 44  LFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL------- 96
           +  +P AF+PTCSD  +PG+     DL+ + I  +Y +SVND FV NAW K L       
Sbjct: 33  IVTVPAAFSPTCSDTHVPGYLTRLKDLKSKNINHLYVVSVNDPFVTNAWKKTLLKSFSID 92

Query: 97  --EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI--KDMVVESWFVEEGFS 152
             E+  V  L D  G+F   +  L +     FG    +  ALI   D  V   FVE    
Sbjct: 93  KTEVP-VTFLADPKGDFIHGLD-LDFDSAAVFGNNRSKRSALIIGSDGKVAKDFVEP--- 147

Query: 153 DNCATDPYEISSPENVLKVI 172
           DN      ++S+ ++VLK +
Sbjct: 148 DNTG---LKVSAVDSVLKAL 164


>gi|156039413|ref|XP_001586814.1| hypothetical protein SS1G_11843 [Sclerotinia sclerotiorum 1980]
 gi|154697580|gb|EDN97318.1| hypothetical protein SS1G_11843 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 180

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 72/142 (50%), Gaps = 13/142 (9%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  +L  GK   +  +P AF+P+CS+  +PG+   +  L+  G  +V+ ++VND FV  
Sbjct: 48  VNLGELTTGK-ALIIGVPAAFSPSCSNSHIPGYIN-HPKLKEAG--DVFVVAVNDPFVTK 103

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG  L+      ++ L D +  FT  + +     ++  G RS RY   I+D  V++  V
Sbjct: 104 AWGSTLDPTGESGIRFLGDPTASFTSALDLTFDGTSIFGGPRSKRYAMEIEDGKVKALHV 163

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN       +S+ E VL
Sbjct: 164 EP---DNTG---LNVSAAEKVL 179


>gi|255731594|ref|XP_002550721.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240131730|gb|EER31289.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 186

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 61/107 (57%), Gaps = 11/107 (10%)

Query: 38  AGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK--- 94
           + K VF+ ++PGAFTPTC++  +PG  +  D L+ + +  +  L+VNDAFV+NAWGK   
Sbjct: 54  SSKLVFV-SVPGAFTPTCTESHVPGILENLDKLKSKNVGAIVVLAVNDAFVVNAWGKILI 112

Query: 95  KLEIKNVKLLPD----GSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           K  +K    +P+      G F+ K  +   +  V    R+ RY A++
Sbjct: 113 KEYVKQSNNIPEIYFASDGGFSGKYDLAADRGGV---FRNKRYAAIV 156


>gi|149237260|ref|XP_001524507.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452042|gb|EDK46298.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 179

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 71/142 (50%), Gaps = 16/142 (11%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           F    V + A+PG+FT  CS   +P + +     + +G++ +   +VND FV  ++GK L
Sbjct: 41  FKDSTVIVTAIPGSFTKVCSTKHIPAYIEHIKQFKEKGVKNIIVFAVNDPFVQASFGKAL 100

Query: 97  EIKN----VKLLPDGSGEFTRKMGMLVYKD--NVGFGLRSWRYGALIKDMVVESWFVEE- 149
             K+    +    D  G+ ++++G     D    G GLR  RY A++ D  ++    E+ 
Sbjct: 101 GYKDPENFIIFATDPDGKISQELGEDYVLDLSKAGMGLRLERYAAIVVDGYIKYLASEQE 160

Query: 150 -GFSDNCATDPYEISSPENVLK 170
             F+D        +SSPEN+LK
Sbjct: 161 GNFTD--------VSSPENLLK 174


>gi|70992559|ref|XP_751128.1| AhpC/TSA family protein [Aspergillus fumigatus Af293]
 gi|66848761|gb|EAL89090.1| AhpC/TSA family protein [Aspergillus fumigatus Af293]
 gi|159124700|gb|EDP49818.1| AhpC/TSA family protein [Aspergillus fumigatus A1163]
          Length = 220

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 73/142 (51%), Gaps = 13/142 (9%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN      GK + +  +P AF+P CS   +PG+   +  L+  G  +V+ +SVND FVM 
Sbjct: 88  VNLAKELKGKGIII-GVPAAFSPACSSSHVPGYIN-HPKLKEAG--QVFVVSVNDPFVMK 143

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG  L+      ++ L D +G+F+  + +     ++    RS RY  +++D  V+  ++
Sbjct: 144 AWGVSLDATGKSGIRFLGDPTGKFSEALDVTFDSSSIFGNQRSKRYALVVEDGKVKEAYI 203

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN   +   +S+ E VL
Sbjct: 204 EP---DNTGVN---VSAAEKVL 219


>gi|322694694|gb|EFY86517.1| peroxiredoxin 5, prdx5, putative [Metarhizium acridum CQMa 102]
          Length = 273

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 69/142 (48%), Gaps = 9/142 (6%)

Query: 13  MRVATVLPDGSKAFQ---WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDD 69
           ++V   LPD    F+      VN  + F     ++  +PGAFT TCS   +P +    + 
Sbjct: 119 VKVGDELPDFDGLFENSPGNKVNLSEEFKSSNGYIVGVPGAFTGTCSSLHIPSY---INH 175

Query: 70  LRCEGIEEVYCLSVNDAFVMNAWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGF 126
            R +   +V+ +SVND FVM AW ++L+      ++ + D S  FT  + +      +  
Sbjct: 176 PRLKEAGQVFVVSVNDPFVMKAWAEQLDPAGETGIRFIADPSAGFTTALDIGFDGSAIFG 235

Query: 127 GLRSWRYGALIKDMVVESWFVE 148
           G+RS RY   I++  V   F+E
Sbjct: 236 GVRSKRYALKIENGKVSKTFIE 257


>gi|260946645|ref|XP_002617620.1| hypothetical protein CLUG_03064 [Clavispora lusitaniae ATCC 42720]
 gi|238849474|gb|EEQ38938.1| hypothetical protein CLUG_03064 [Clavispora lusitaniae ATCC 42720]
          Length = 203

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 62/125 (49%), Gaps = 10/125 (8%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLR-CEGIEEVYCLSVNDAFVMNAWGKKL- 96
           G  V   ++PGAFTPTC+ + +P +     +L+  + I  V  LS ND FV NAWGK L 
Sbjct: 65  GGNVLFVSVPGAFTPTCTANHIPPYLSHLKELKSSKKITTVVVLSANDPFVNNAWGKLLL 124

Query: 97  -------EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVE-SWFVE 148
                  ++  V    D + +F+   G+ +     G G+R+ RY  ++     E S+F  
Sbjct: 125 QKADLSGDLPKVVFASDPNAKFSSDNGISLDLTEKGLGVRTARYAFVVNADTKEVSYFGS 184

Query: 149 EGFSD 153
           E  SD
Sbjct: 185 EPGSD 189


>gi|83859284|ref|ZP_00952805.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/
           Malallergen [Oceanicaulis alexandrii HTCC2633]
 gi|83852731|gb|EAP90584.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/
           Malallergen [Oceanicaulis alexandrii HTCC2633]
          Length = 166

 Score = 64.7 bits (156), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 65/124 (52%), Gaps = 2/124 (1%)

Query: 43  FLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-V 101
            +  +PGAFTP C+   LP F +    L+  G +++ C+  ND F ++ W ++++ +  +
Sbjct: 38  IVIGVPGAFTPICTKRHLPRFIEKAPALKQSGFDQISCIVSNDPFAVDQWRRQIDPEGRL 97

Query: 102 KLLPDGSGEFTRKMGML-VYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPY 160
           +   DG   F+R  G+     D++  G RS RY  ++++ VV+   +E    +   T P 
Sbjct: 98  QFYADGPMAFSRWFGLTETLPDHLHMGERSKRYLLIVRNGVVQRVNIERTVIEFTCTGPE 157

Query: 161 EISS 164
           ++ +
Sbjct: 158 DLDA 161


>gi|326474405|gb|EGD98414.1| hypothetical protein TESG_05793 [Trichophyton tonsurans CBS 112818]
          Length = 168

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 57/105 (54%), Gaps = 8/105 (7%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           ++ KRV L ++PGAFTPTCS   LP +     +L+ +G++ V  ++ ND FVM+AWGK  
Sbjct: 43  WSNKRVVLVSVPGAFTPTCSATHLPDYIAKLRELKNKGVDVVAFVAYNDPFVMSAWGKAN 102

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
            +   ++  L D   +F+   G   ++   G      RY  +I +
Sbjct: 103 GVTGDDILFLSDMESKFSSSFGWTAHEGRTG------RYAMVIDN 141


>gi|307109294|gb|EFN57532.1| hypothetical protein CHLNCDRAFT_143139 [Chlorella variabilis]
          Length = 224

 Score = 64.7 bits (156), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 78/142 (54%), Gaps = 11/142 (7%)

Query: 35  DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94
           +L  G++  +F +P      CS+  +P F +  D+LR  GI ++ C++V D    ++W +
Sbjct: 88  ELLKGEKAVVFGVPDCGK-VCSEQHVPSFLQRGDELRRLGISKILCVAVGDPAAADSWAQ 146

Query: 95  KLEIKN---VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
           KL + +   ++++ D +G FTR +G+ +   +   G RS RY A++ D V+    V++  
Sbjct: 147 KLSLSDGSKIQVVADTNGAFTRFLGVELAAPDAP-GARSQRYAAVVDDGVLLKVRVDKSP 205

Query: 152 SDNCATDPYEISSPENVLKVIR 173
           ++  A      SS  ++++VI+
Sbjct: 206 AEAKA------SSAGSIVEVIK 221


>gi|326482441|gb|EGE06451.1| peroxisomal matrix protein [Trichophyton equinum CBS 127.97]
          Length = 168

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 57/105 (54%), Gaps = 8/105 (7%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           ++ KRV L ++PGAFTPTCS   LP +     +L+ +G++ V  ++ ND FVM+AWGK  
Sbjct: 43  WSNKRVVLVSVPGAFTPTCSATHLPDYIAKLRELKNKGVDVVAFVAYNDPFVMSAWGKAN 102

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
            +   ++  L D   +F+   G   ++   G      RY  +I +
Sbjct: 103 GVTGDDILFLSDMESKFSSSFGWTAHEGRTG------RYAMVIDN 141


>gi|121700080|ref|XP_001268305.1| AhpC/TSA family protein [Aspergillus clavatus NRRL 1]
 gi|119396447|gb|EAW06879.1| AhpC/TSA family protein [Aspergillus clavatus NRRL 1]
          Length = 181

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 71/142 (50%), Gaps = 13/142 (9%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN      GK + L  +P AF+P CS   +PG+   +  L+  G  +V+ +SVND FV  
Sbjct: 49  VNLAKELKGKGIIL-GVPAAFSPACSSSHVPGYIN-HPKLKEAG--QVFVVSVNDPFVTK 104

Query: 91  AWGKKLEIK---NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG  L+      ++ L D +G+F+  + +     ++    R  RY  +++D  V+  F+
Sbjct: 105 AWGVSLDPNGKSGIRFLGDPTGKFSEALDVTFDSTSIFGNHRGKRYALVVEDGKVKEAFI 164

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN   D   +S+ E VL
Sbjct: 165 EP---DNTGVD---VSAAEKVL 180


>gi|47184473|emb|CAG14626.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 78

 Score = 64.3 bits (155), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 48/67 (71%), Gaps = 1/67 (1%)

Query: 59  QLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGM 117
            LPGF +  +DL+ +G++E+ C+SVNDAFVM+AWGK+   +  V++L D +G FT+ + +
Sbjct: 2   HLPGFVQQAEDLKAKGVQELACISVNDAFVMSAWGKEHGAEGKVRMLADPTGAFTKAVDL 61

Query: 118 LVYKDNV 124
           L+  + +
Sbjct: 62  LLDSEQI 68


>gi|145236679|ref|XP_001390987.1| thioredoxin peroxidase/alkyl hydroperoxide reductase [Aspergillus
           niger CBS 513.88]
 gi|134075448|emb|CAK48009.1| unnamed protein product [Aspergillus niger]
          Length = 182

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 72/142 (50%), Gaps = 13/142 (9%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN      GK V +  +P AF+P CS   +PGF   +  L+  G  +V+ ++VND FV  
Sbjct: 50  VNLAKELKGKGVII-GVPAAFSPACSSTHVPGFIN-HPKLKEAG--QVFVVAVNDPFVTK 105

Query: 91  AWGKKLEIK---NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AW   L+ +    ++ L D SG+F+  + +     ++    RS RY  L+++  V+  FV
Sbjct: 106 AWATSLDPEGKSGIRFLGDPSGKFSEALDVTFDSASIFGNNRSKRYALLVENGKVKEAFV 165

Query: 148 EEGFSDNCATDPYEISSPENVL 169
           E    DN   D   +S+ E VL
Sbjct: 166 EP---DNIGLD---VSAAEKVL 181


>gi|289615264|emb|CBI58031.1| putative oxidoreductase [Sordaria macrospora]
          Length = 186

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 73/153 (47%), Gaps = 15/153 (9%)

Query: 13  MRVATVLPDGSKAFQWKDVNTQDLF----AGKRVFLFALPGAFTPTCSDHQLPGFEKIYD 68
           +++  +LP+G    +    N  DL     + + + +  +P AF+P CS   +P +     
Sbjct: 31  VKIGELLPEGELLQEGSPGNKVDLRKEAESARNMLIIGVPAAFSPACSASHIPSY---IQ 87

Query: 69  DLRCEGIEEVYCLSVNDAFVMNAWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVG 125
             + +  +    +SVNDAFVM AW + L+      ++ L D SGEFT+ +  L +     
Sbjct: 88  HPKTQEFDVKAVVSVNDAFVMKAWKENLDPAGESGIRFLADPSGEFTKALD-LTFDSKAI 146

Query: 126 FGL-RSWRYGALIKDMVVESWFVEEGFSDNCAT 157
           FG  RS RY  +++D  V    VE    DN  T
Sbjct: 147 FGNDRSKRYAIIVEDGKVTKIAVE---PDNTGT 176


>gi|169867256|ref|XP_001840209.1| hypothetical protein CC1G_02672 [Coprinopsis cinerea okayama7#130]
 gi|116498761|gb|EAU81656.1| hypothetical protein CC1G_02672 [Coprinopsis cinerea okayama7#130]
          Length = 170

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 57/115 (49%), Gaps = 4/115 (3%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
             GK + +  LPGAFT  C+ H +P +   YD  + +G+E +Y ++VNDA+V  AW + L
Sbjct: 41  LTGKNIII-GLPGAFTTPCNGH-VPAYISNYDKFKAKGVENIYVIAVNDAYVTKAWKEAL 98

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEE 149
                ++  + D +G     +G L        G RS R+  +     + S  VEE
Sbjct: 99  APNGTDIHFIADDTGNVISSLGFLFDASGGLGGPRSKRFVLVTDGHKITSVSVEE 153


>gi|320580139|gb|EFW94362.1| Redoxin multi-domain protein [Pichia angusta DL-1]
          Length = 316

 Score = 63.9 bits (154), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 66/121 (54%), Gaps = 3/121 (2%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK 99
           K+  + ++PGAFTP C++  LP + +   +   +G++ +  ++ ND FV+ AW +KL   
Sbjct: 188 KKFVVVSVPGAFTPPCTNQHLPEYIQKVQNFASKGVDFILVVTQNDPFVLRAWKEKLGAT 247

Query: 100 NVKLL--PDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI-KDMVVESWFVEEGFSDNCA 156
           + K+L   D   + ++K+G  +    +G G RS R   ++ +  +VE    E+G   N +
Sbjct: 248 SNKILFVSDPYLDLSKKLGSPIDLGGLGLGTRSSRLALIVNRSGIVEFVADEKGGDVNVS 307

Query: 157 T 157
           T
Sbjct: 308 T 308


>gi|242783349|ref|XP_002480170.1| allergen, putative [Talaromyces stipitatus ATCC 10500]
 gi|218720317|gb|EED19736.1| allergen, putative [Talaromyces stipitatus ATCC 10500]
          Length = 179

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 42  VFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK--KLEIK 99
           +F   L GAFTPTCS   LPG+ K    L+ +G++ V  L+ ND FVM+AWGK  K+   
Sbjct: 58  LFFPNLLGAFTPTCSVSHLPGYIKNLPQLKAKGVDVVAVLAFNDPFVMSAWGKANKITDD 117

Query: 100 NVKLLPDGSGEFTRKMG 116
           ++  L D   +F++ +G
Sbjct: 118 SILFLSDPDAKFSKSIG 134


>gi|50294878|ref|XP_449850.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49529164|emb|CAG62830.1| unnamed protein product [Candida glabrata]
          Length = 175

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 71/139 (51%), Gaps = 12/139 (8%)

Query: 36  LFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKK 95
           L   K V +   P AF+PTCS   +PG+     DL  +G+++V  ++V++ F   AW K 
Sbjct: 43  LAKNKTVVITGAPAAFSPTCSISHIPGYISKLSDLEAKGVDQVVVVTVDNPFANEAWAKN 102

Query: 96  LEIKN---VKLLPDGSGEFTRKMGMLVYKDNVGFGLR-SWRYGALIKDMVVESWFVEEGF 151
           L ++N   +K   D   E  R +G   Y+  VG G+  S R+  ++KD VV    V  G 
Sbjct: 103 LGVQNTKHIKFATDAGAELVRHLG---YELKVGEGVYWSGRWTVIVKDGVV----VYAGN 155

Query: 152 SDNCATDPYEISSPENVLK 170
             N A+D   +SS E  LK
Sbjct: 156 ESNPASD-VTVSSVEEALK 173


>gi|39970487|ref|XP_366634.1| hypothetical protein MGG_02710 [Magnaporthe oryzae 70-15]
 gi|149209947|ref|XP_001522348.1| hypothetical protein MGCH7_ch7g455 [Magnaporthe oryzae 70-15]
 gi|86196410|gb|EAQ71048.1| hypothetical protein MGCH7_ch7g455 [Magnaporthe oryzae 70-15]
 gi|145017484|gb|EDK01847.1| hypothetical protein MGG_02710 [Magnaporthe oryzae 70-15]
 gi|291195735|gb|ADD84584.1| peroxisomal membrane PMP20 [Magnaporthe oryzae]
          Length = 168

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 59/100 (59%), Gaps = 7/100 (7%)

Query: 40  KRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK 99
           K++ + ++PGAFTPTC +  L  + +  D+L+ +G+++V  ++ ND +VM+AWGK  +I 
Sbjct: 46  KKIVIVSVPGAFTPTCQEQHLKSYVEKKDELKAKGVDKVVFIAYNDHWVMSAWGKANDIY 105

Query: 100 N--VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137
           +  +    D    F++ +G      N+G   R+ RY  ++
Sbjct: 106 DDFIIFASDDGISFSKSIGW-----NLGDSGRTARYAIVV 140


>gi|46105450|ref|XP_380529.1| hypothetical protein FG00353.1 [Gibberella zeae PH-1]
          Length = 188

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 6/121 (4%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN  + F     ++  +P AF+ TCS   +P +   +  L+  G  +V+ +SVND FVM 
Sbjct: 55  VNLAEEFKTSNGYIVGVPAAFSGTCSSKHIPSYIN-HPKLKQAG--QVFVVSVNDPFVMK 111

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AW  +L+      ++ L D +GEFT+ + +      V  G+R  RY   ++D  V   +V
Sbjct: 112 AWSDQLDPAKQTGIRFLGDPTGEFTKALDLGFEAYAVFGGMRGKRYALKVEDGKVSKAYV 171

Query: 148 E 148
           E
Sbjct: 172 E 172


>gi|212534358|ref|XP_002147335.1| AhpC/TSA family protein [Penicillium marneffei ATCC 18224]
 gi|210069734|gb|EEA23824.1| AhpC/TSA family protein [Penicillium marneffei ATCC 18224]
          Length = 182

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 71/143 (49%), Gaps = 15/143 (10%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN      G  V +  +P AF+P CS   +PG+   +  L+  G  +V+ +SVND FVM 
Sbjct: 50  VNLSKELTGNGVII-GVPAAFSPACSSTHVPGYIN-HPALKNAG--KVFVVSVNDPFVMK 105

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFG-LRSWRYGALIKDMVVESWF 146
           AWG  L+      V+ L D +G FT  +  L +     FG  RS RY  +I+D  V+   
Sbjct: 106 AWGAALDPSGKSGVRFLADPAGSFTDAL-ELGFDSAAIFGNQRSKRYALVIEDGKVKEAH 164

Query: 147 VEEGFSDNCATDPYEISSPENVL 169
           VE    DN   +   +S+ E VL
Sbjct: 165 VEP---DNTGVN---VSAAEKVL 181


>gi|58270100|ref|XP_572206.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57228464|gb|AAW44899.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 224

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 68/139 (48%), Gaps = 15/139 (10%)

Query: 39  GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL-- 96
           GK V +  +PGAF+  CS +Q+P +   + D + +GI  VY ++VND FV+NAW  K+  
Sbjct: 92  GKNVVVL-VPGAFSGVCS-NQVPPYITSFSDFKAKGINNVYVVAVNDIFVVNAWKDKMIG 149

Query: 97  -----EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGF 151
                E + VK   D +      +G+      V  G R  R   ++ D VVE   VE+  
Sbjct: 150 EFSSKEGEGVKFAADDTAALASALGLTFDAQPVFGGPRLKRGVLVVNDGVVEYVGVEDSP 209

Query: 152 SDNCATDPYEISSPENVLK 170
            D        IS+ + V+K
Sbjct: 210 GD------ITISAADKVIK 222


>gi|296416852|ref|XP_002838084.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633988|emb|CAZ82275.1| unnamed protein product [Tuber melanosporum]
          Length = 189

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 67/143 (46%), Gaps = 15/143 (10%)

Query: 34  QDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWG 93
           ++L   K+  +  +PGAF+P CS   +  + +   D+        Y +++ND FV  AW 
Sbjct: 59  EELKGKKKALILGVPGAFSPACSAAHIAKYIEAKFDV------PTYVVAINDPFVTKAWK 112

Query: 94  KKLEIK---NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEG 150
             L  +   N + L D S EFT  +GM      +  G RS RY  +++D  V   F E  
Sbjct: 113 DSLTSRDDENFRFLADPSSEFTDAVGMKFDATPIFGGPRSKRYALIVEDGKVSKVFAEP- 171

Query: 151 FSDNCATDPYEISSPENVLKVIR 173
             DN       ++S +N+L  ++
Sbjct: 172 --DNTGV---SVTSADNILPELK 189


>gi|302499547|ref|XP_003011769.1| allergen Asp F3 [Arthroderma benhamiae CBS 112371]
 gi|291175322|gb|EFE31129.1| allergen Asp F3 [Arthroderma benhamiae CBS 112371]
          Length = 172

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 8/105 (7%)

Query: 37  FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96
           ++ K+V L ++PGAFTPTCS   LP +     +L+ +G++ V  ++ ND FVM+AWGK  
Sbjct: 43  WSNKKVVLVSVPGAFTPTCSATHLPDYIAKLRELKTKGVDIVAFVAYNDPFVMSAWGKAN 102

Query: 97  EIK--NVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKD 139
            +   ++  L D   +F+   G   ++   G      RY  +I +
Sbjct: 103 GVTGDDILFLSDIESKFSSSYGWTAHEGRTG------RYAMIIDN 141


>gi|67526459|ref|XP_661291.1| hypothetical protein AN3687.2 [Aspergillus nidulans FGSC A4]
 gi|40740705|gb|EAA59895.1| hypothetical protein AN3687.2 [Aspergillus nidulans FGSC A4]
          Length = 188

 Score = 63.2 bits (152), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 69/141 (48%), Gaps = 11/141 (7%)

Query: 31  VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMN 90
           VN      GK V +  +P AF+P CS   +PG+   +  L+  G  +V+ ++VND FV  
Sbjct: 52  VNLAKELKGKGVII-GVPAAFSPACSSTHVPGYIS-HPKLKEAG--QVFVVAVNDPFVTK 107

Query: 91  AWGKKLEI---KNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFV 147
           AWG  L+      ++ L D +G+F+  + +      +    RS RY  L++D  ++  FV
Sbjct: 108 AWGTTLDPTGKSGIRFLGDPTGKFSEALDVTFDSTTIFGNQRSKRYALLVEDGKIKEAFV 167

Query: 148 EEGFSDNCATDPYEISSPENV 168
           E    DN       ISSP  +
Sbjct: 168 EP---DNTGVKGI-ISSPAAI 184


>gi|302656609|ref|XP_003020056.1| allergen Asp F3 [Trichophyton verrucosum HKI 0517]
 gi|291183837|gb|