RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780311|ref|YP_003064724.1| hypothetical protein CLIBASIA_00980 [Candidatus Liberibacter asiaticus str. psy62] (177 letters) >gnl|CDD|31022 COG0678, AHP1, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]. Length = 165 Score = 198 bits (506), Expect = 5e-52 Identities = 82/166 (49%), Positives = 112/166 (67%), Gaps = 12/166 (7%) Query: 6 IPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEK 65 +P V F RV DG W DV T DLF GK+V LF+LPGAFTPTCS LPG+ + Sbjct: 9 LPAVTFKTRVGDETADG-----WVDVTTDDLFKGKKVVLFSLPGAFTPTCSSSHLPGYLE 63 Query: 66 IYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIK-NVKLLPDGSGEFTRKMGMLVYKDNV 124 + D+ + +G++E+YC+SVNDAFVMNAW K + N+K +PDG+GEFT+ MGMLV K ++ Sbjct: 64 LADEFKAKGVDEIYCVSVNDAFVMNAWAKSQGGEGNIKFIPDGNGEFTKAMGMLVDKSDL 123 Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170 GFG+RSWRY ++++ VVE F+E DP+ +SS + +L Sbjct: 124 GFGVRSWRYSMVVENGVVEKLFIEP------PGDPFTVSSADTMLA 163 >gnl|CDD|48562 cd03013, PRX5_like, Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol. The cellular location of PRX5 suggests that it may have an important antioxidant role in organelles that are major sources of reactive oxygen species (ROS), as well as a role in the control of signal transduction. PRX5 has been shown to reduce hydrogen peroxide, alkyl hydroperoxides and peroxynitrite. As with all other PRXs, the N-terminal peroxidatic cysteine of PRX5 is oxidized into a sulfenic acid intermediate upon reaction with peroxides. Human PRX5 is able to resolve this intermediate by forming an intramolecular disulfide bond with its C-terminal cysteine (the resolving cysteine), which can then be reduced by TRX, just like an atypical 2-cys PRX. This resolving cysteine, however, is not conserved in other members of the subfamily. In such cases, it is assumed that the oxidized cysteine is directly resolved by an external small-molecule or protein reductant, typical of a 1-cys PRX. In the case of the H. influenza PRX5 hybrid, the resolving glutaredoxin domain is on the same protein chain as PRX. PRX5 homodimers show an A-type interface, similar to atypical 2-cys PRXs.. Length = 155 Score = 171 bits (434), Expect = 1e-43 Identities = 70/157 (44%), Positives = 97/157 (61%), Gaps = 11/157 (7%) Query: 19 LPDGSKAFQ----WKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEG 74 LP+ + VN +LF GK+V +F +PGAFTPTCS LPG+ + D+L+ +G Sbjct: 5 LPNVTLFEYVPGPPNPVNLSELFKGKKVVIFGVPGAFTPTCSAQHLPGYVENADELKAKG 64 Query: 75 IEEVYCLSVNDAFVMNAWGKKLEIKN-VKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRY 133 ++EV C+SVND FVM AWGK L K+ ++ L DG+GEFT+ +G+ + G G+RS RY Sbjct: 65 VDEVICVSVNDPFVMKAWGKALGAKDKIRFLADGNGEFTKALGLTLDLSAAGGGIRSKRY 124 Query: 134 GALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLK 170 ++ D V+ FVEE D E+SS ENVLK Sbjct: 125 ALIVDDGKVKYLFVEEDPGD------VEVSSAENVLK 155 >gnl|CDD|35761 KOG0541, KOG0541, KOG0541, Alkyl hydroperoxide reductase/peroxiredoxin [Posttranslational modification, protein turnover, chaperones]. Length = 171 Score = 130 bits (327), Expect = 3e-31 Identities = 62/157 (39%), Positives = 96/157 (61%), Gaps = 7/157 (4%) Query: 17 TVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIE 76 ++ D + Q VN LF GK+V LF +PGAFTPTCS +PG+ + D+L+ +G++ Sbjct: 21 SLFEDEPEQLQGNTVNVSSLFKGKKVILFGVPGAFTPTCSSSHVPGYIEKADELKSKGVD 80 Query: 77 EVYCLSVNDAFVMNAWGKKL-EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGA 135 E+ C+SVND FVM AW K L +VK + D +GEFT+ +G+ + + G+RS RY Sbjct: 81 EIICVSVNDPFVMKAWAKSLGANDHVKFVADPAGEFTKSLGLELDLSDKLLGVRSRRYAL 140 Query: 136 LIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVI 172 ++++ V VEEG +D + +SS E++LK + Sbjct: 141 VVENGKVTVVNVEEGGTD------FTVSSAEDILKQL 171 >gnl|CDD|48520 cd02971, PRX_family, Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified. PRXs are thiol-specific antioxidant (TSA) proteins also known as TRX peroxidases and alkyl hydroperoxide reductase C22 (AhpC) proteins. They confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either TRX, glutathione, trypanothione and AhpF. They are distinct from other peroxidases in that they have no cofactors such as metals or prosthetic groups. The first step of catalysis, common to all PRXs, is the nucleophilic attack by the catalytic cysteine (also known as the peroxidatic cysteine) on the peroxide leading to cleavage of the oxygen-oxygen bond and the formation of a cysteine sulfenic acid intermediate. The second step of the reaction, the resolution of the intermediate, distinguishes the different types of PRXs. The presence or absence of a second cysteine (the resolving cysteine) classifies PRXs as either belonging to the 2-cys or 1-cys type. The resolving cysteine of 2-cys PRXs is either on the same chain (atypical) or on the second chain (typical) of a functional homodimer. Structural and motif analysis of this growing family supports the need for a new classification system. The peroxidase activity of PRXs is regulated in vivo by irreversible cysteine over-oxidation into a sulfinic acid, phosphorylation and limited proteolysis.. Length = 140 Score = 94.1 bits (234), Expect = 2e-20 Identities = 39/135 (28%), Positives = 57/135 (42%), Gaps = 8/135 (5%) Query: 19 LPDGS-KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEE 77 PD + A +V+ D F GK V LF P FTP C+ +L F + ++ +G E Sbjct: 2 APDFTLPATDGGEVSLSD-FKGKWVVLFFYPKDFTPVCT-TELCAFRDLAEEFA-KGGAE 58 Query: 78 VYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALI 137 V +SV+ F AW +K N LL D GEF + G+L + G + R +I Sbjct: 59 VLGVSVDSPFSHKAWAEKEGGLNFPLLSDPDGEFAKAYGVL--IEKSAGGGLAARATFII 116 Query: 138 KDM--VVESWFVEEG 150 + Sbjct: 117 DPDGKIRYVEVEPLP 131 >gnl|CDD|144244 pfam00578, AhpC-TSA, AhpC/TSA family. This family contains proteins related to alkyl hydroperoxide reductase (AhpC) and thiol specific antioxidant (TSA). Length = 124 Score = 60.7 bits (148), Expect = 2e-10 Identities = 34/107 (31%), Positives = 51/107 (47%), Gaps = 6/107 (5%) Query: 24 KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSV 83 K+V+ D + GK V LF P FTP C+ +LP +Y++ + G+ EV +SV Sbjct: 11 PDLDGKEVSLSD-YKGKWVVLFFYPKDFTPVCT-TELPALADLYEEFKKLGV-EVLGVSV 67 Query: 84 NDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRS 130 + + +KL + LL D GE R G V + G LR+ Sbjct: 68 DSPESHKKFAEKLGL-PFPLLSDPDGEVARAYG--VLNEEAGGALRT 111 >gnl|CDD|30799 COG0450, AhpC, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]. Length = 194 Score = 52.1 bits (125), Expect = 7e-08 Identities = 27/88 (30%), Positives = 40/88 (45%), Gaps = 8/88 (9%) Query: 37 FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW---- 92 + GK V LF P FT C + F K Y++ + G+ EV +S + F AW Sbjct: 31 YYGKWVVLFFYPADFTFVCPTE-IIAFAKRYEEFQKRGV-EVIGVSTDSVFSHKAWKATI 88 Query: 93 GKKLEIKNVK--LLPDGSGEFTRKMGML 118 + I +K ++ D GE R G+L Sbjct: 89 REAGGIGKIKFPMIADPKGEIARAYGVL 116 >gnl|CDD|48567 cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE. AhpE is described as a 1-cys PRX because of the absence of a resolving cysteine. The structure and sequence of AhpE, however, show greater similarity to 2-cys PRXs than 1-cys PRXs. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. The first step of catalysis is the nucleophilic attack by the peroxidatic cysteine on the peroxide leading to the formation of a cysteine sulfenic acid intermediate. The absence of a resolving cysteine suggests that functional AhpE is regenerated by an external reductant. The solution behavior and crystal structure of AhpE show that it forms dimers and octamers.. Length = 149 Score = 47.9 bits (114), Expect = 2e-06 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 7/104 (6%) Query: 29 KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88 ++V + K V L P AFTP C+ +L + G EV +SV+ F Sbjct: 18 QEVRLSEFRGRKPVVLVFFPLAFTPVCTK-ELCALRDSLELFEAAGA-EVLGISVDSPFS 75 Query: 89 MNAWGKKLEIKNVKLLPD--GSGEFTRKMGMLVYKDNVGFGLRS 130 + AW ++ + LL D GE + G V+ +++G R+ Sbjct: 76 LRAWAEENGL-TFPLLSDFWPHGEVAKAYG--VFDEDLGVAERA 116 >gnl|CDD|48564 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides. The functional unit of typical 2-cys PRX is a homodimer. A unique intermolecular redox-active disulfide center is utilized for its activity. Upon reaction with peroxides, its peroxidatic cysteine is oxidized into a sulfenic acid intermediate which is resolved by bonding with the resolving cysteine from the other subunit of the homodimer. This intermolecular disulfide bond is then reduced by thioredoxin, tryparedoxin or AhpF. Typical 2-cys PRXs, like 1-cys PRXs, form decamers which are stabilized by reduction of the active site cysteine. Typical 2-cys PRX interacts through beta strands at one edge of the monomer (B-type interface) to form the functional homodimer, and uses an A-type interface (similar to the dimeric interface in atypical 2-cys PRX and PRX5) at the opposite end of the monomer to form the stable decameric (pentamer of dimers) structure.. Length = 173 Score = 43.9 bits (104), Expect = 2e-05 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 15/120 (12%) Query: 17 TVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIE 76 V+P+G ++K+++ D + GK V LF P FT C ++ F Y++ + E Sbjct: 12 AVVPNG----EFKEISLSD-YKGKWVVLFFYPLDFTFVCPT-EIIAFSDRYEEFKKLNAE 65 Query: 77 EVYCLSVNDAFVMNAWG----KKLEIKNVK--LLPDGSGEFTRKMGMLVYKDNVGFGLRS 130 V +S + F AW K+ + + LL D + +R G V + G LR Sbjct: 66 -VLGVSTDSHFSHLAWRNTPRKEGGLGKINFPLLADPKKKISRDYG--VLDEEEGVALRG 122 >gnl|CDD|48563 cd03014, PRX_Atyp2cys, Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx). Tpx is a bacterial periplasmic peroxidase which differs from other PRXs in that it shows substrate specificity toward alkyl hydroperoxides over hydrogen peroxide. As with all other PRXs, the peroxidatic cysteine (N-terminal) of Tpx is oxidized into a sulfenic acid intermediate upon reaction with peroxides. Tpx is able to resolve this intermediate by forming an intramolecular disulfide bond with a conserved C-terminal cysteine (the resolving cysteine), which can then be reduced by thioredoxin. This differs from the typical 2-cys PRX which resolves the oxidized cysteine by forming an intermolecular disulfide bond with the resolving cysteine from the other subunit of the homodimer. Atypical 2-cys PRX homodimers have a loop-based interface (A-type for alternate), in contrast with the B-type interface of typical 2-cys and 1-cys PRXs.. Length = 143 Score = 42.8 bits (101), Expect = 4e-05 Identities = 27/103 (26%), Positives = 40/103 (38%), Gaps = 8/103 (7%) Query: 29 KDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFV 88 +V+ D FAGK + P TP C Q F K L + V +S + F Sbjct: 17 SEVSLAD-FAGKVKVISVFPSIDTPVC-ATQTKRFNKEAAKL--DNTV-VLTISADLPFA 71 Query: 89 MNAWGKKLEIKNVKLLPD-GSGEFTRKMGMLVYKDNVGFGLRS 130 W + NV L D F + G+L+ ++G R+ Sbjct: 72 QKRWCGAEGVDNVTTLSDFRDHSFGKAYGVLI--KDLGLLARA 112 >gnl|CDD|31418 COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]. Length = 157 Score = 42.5 bits (100), Expect = 7e-05 Identities = 22/89 (24%), Positives = 34/89 (38%), Gaps = 3/89 (3%) Query: 37 FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96 GK V L+ P FTP C+ + F + ++ G V +S + + +K Sbjct: 28 LRGKPVVLYFYPKDFTPGCTT-EACDFRDLLEEFEKLGA-VVLGISPDSPKSHKKFAEKH 85 Query: 97 EIKNVKLLPDGSGEFTRKMGMLVYKDNVG 125 + LL D GE G+ K G Sbjct: 86 GL-TFPLLSDEDGEVAEAYGVWGEKKMYG 113 >gnl|CDD|48566 cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides. The protein was named BCP based on its electrophoretic mobility before its function was known. BCP shows substrate selectivity toward fatty acid hydroperoxides rather than hydrogen peroxide or alkyl hydroperoxides. BCP contains the peroxidatic cysteine but appears not to possess a resolving cysteine (some sequences, not all, contain a second cysteine but its role is still unknown). Unlike other PRXs, BCP exists as a monomer. The plant homolog of BCP is PRX Q, which is expressed only in leaves and is cellularly localized in the chloroplasts and the guard cells of stomata. Also included in this subfamily is the fungal nuclear protein, Dot5p (for disrupter of telomere silencing protein 5), which functions as an alkyl-hydroperoxide reductase during post-diauxic growth.. Length = 140 Score = 40.9 bits (96), Expect = 2e-04 Identities = 21/93 (22%), Positives = 37/93 (39%), Gaps = 3/93 (3%) Query: 37 FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96 GK V L+ P TP C+ + F +Y++ + G V +S + + +K Sbjct: 21 LRGKPVVLYFYPKDDTPGCT-KEACDFRDLYEEFKALGA-VVIGVSPDSVESHAKFAEKY 78 Query: 97 EIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLR 129 + LL D G+ + G+ K G+ Sbjct: 79 GL-PFPLLSDPDGKLAKAYGVWGEKKKKYMGIE 110 >gnl|CDD|48565 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine. They are homodimeric thiol-specific antioxidant (TSA) proteins that confer a protective role in cells by reducing and detoxifying hydrogen peroxide, peroxynitrite, and organic hydroperoxides. As with all other PRXs, a cysteine sulfenic acid intermediate is formed upon reaction of 1-cys PRX with its substrates. Having no resolving cysteine, the oxidized enzyme is resolved by an external small-molecule or protein reductant such as thioredoxin or glutaredoxin. Similar to typical 2-cys PRX, 1-cys PRX forms a functional dimeric unit with a B-type interface, as well as a decameric structure which is stabilized in the reduced form of the enzyme. Other oligomeric forms, tetramers and hexamers, have also been reported. Mammalian 1-cys PRX is localized cellularly in the cytosol and is expressed at high levels in brain, eye, testes and lung. The seed-specific plant 1-cys PRXs protect tissues from reactive oxygen species during desiccation and are also called rehydrins.. Length = 203 Score = 40.1 bits (94), Expect = 3e-04 Identities = 22/101 (21%), Positives = 40/101 (39%), Gaps = 7/101 (6%) Query: 35 DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94 D LF+ P FTP C+ +L F K+ + + + ++ LSV+ W + Sbjct: 21 DYLGDSWGILFSHPADFTPVCTT-ELGAFAKLAPEFKKRNV-KLIGLSVDSVESHIKWIE 78 Query: 95 KLEIKNVKLLP-----DGSGEFTRKMGMLVYKDNVGFGLRS 130 +E +P D E + +GM+ +R+ Sbjct: 79 DIEEYTGVEIPFPIIADPDREVAKLLGMIDPDAGSTLTVRA 119 >gnl|CDD|36070 KOG0852, KOG0852, KOG0852, Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes [Posttranslational modification, protein turnover, chaperones]. Length = 196 Score = 36.1 bits (83), Expect = 0.005 Identities = 38/136 (27%), Positives = 54/136 (39%), Gaps = 18/136 (13%) Query: 1 MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60 M P F T + DG ++K++ D GK V LF P FT C + Sbjct: 3 MEVVFKPAPDFK---GTAVVDG----EFKEIKLSDYK-GKYVVLFFYPLDFTFVCPTE-I 53 Query: 61 PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAW---GKK---LEIKNVKLLPDGSGEFTRK 114 F + R E + S + F AW +K L N+ LL D + E +R Sbjct: 54 IAFSDRAPEFRKLNTEVLGI-STDSVFSHLAWINTPRKQGGLGPLNIPLLSDLNHEISRD 112 Query: 115 MGMLVYKDNVGFGLRS 130 G+L K++ G LR Sbjct: 113 YGVL--KEDEGIALRG 126 >gnl|CDD|32260 COG2077, Tpx, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]. Length = 158 Score = 32.9 bits (75), Expect = 0.048 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 5/84 (5%) Query: 37 FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96 FAGK+ + P TP C Q+ F + L G V C+S++ F + Sbjct: 42 FAGKKKVISVFPSIDTPVC-ATQVRKFNEEAAKL---GNTVVLCISMDLPFAQKRFCGAE 97 Query: 97 EIKNVKLLPD-GSGEFTRKMGMLV 119 I+NV L D F G+L+ Sbjct: 98 GIENVITLSDFRDRAFGENYGVLI 121 >gnl|CDD|30871 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 877 Score = 27.5 bits (61), Expect = 1.9 Identities = 19/82 (23%), Positives = 34/82 (41%), Gaps = 29/82 (35%) Query: 92 WGKK--LEIKNV-----KLLPDGSGEFT---------------RKMGMLV----YKDNVG 125 GK+ L + N+ ++ + +GEF + G+LV +K +VG Sbjct: 282 VGKRHNLPLINIIDEDGRINEEAAGEFAGLDRFEARKKIVEDLEEQGLLVKIEPHKHSVG 341 Query: 126 FGLRSWRYGALIKDMVVESWFV 147 R G I+ ++ + WFV Sbjct: 342 H---CERCGTPIEPLLSKQWFV 360 >gnl|CDD|35196 COG5637, COG5637, Predicted integral membrane protein [Function unknown]. Length = 217 Score = 25.8 bits (56), Expect = 6.4 Identities = 14/59 (23%), Positives = 24/59 (40%), Gaps = 11/59 (18%) Query: 5 QIPQVVFHMRVATVLPD----------GSKAFQWKDVNTQDLFAGKRVFLFALPGAFTP 53 +P + H+ VL D +W+ T+D+ G+R+ +LPGA Sbjct: 94 NLPLWMKHLDSVKVLDDKRSRWKANAPLGLEVEWEAEITKDI-PGERIQWESLPGARVE 151 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.323 0.140 0.436 Gapped Lambda K H 0.267 0.0805 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,285,286 Number of extensions: 118856 Number of successful extensions: 239 Number of sequences better than 10.0: 1 Number of HSP's gapped: 228 Number of HSP's successfully gapped: 19 Length of query: 177 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 89 Effective length of database: 4,362,145 Effective search space: 388230905 Effective search space used: 388230905 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.4 bits)