RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780311|ref|YP_003064724.1| hypothetical protein CLIBASIA_00980 [Candidatus Liberibacter asiaticus str. psy62] (177 letters) >gnl|CDD|149549 pfam08534, Redoxin, Redoxin. This family of redoxins includes peroxiredoxin, thioredoxin and glutaredoxin proteins. Length = 142 Score = 85.9 bits (213), Expect = 5e-18 Identities = 53/158 (33%), Positives = 70/158 (44%), Gaps = 19/158 (12%) Query: 15 VATVLPDGSKAFQWKDVNTQDL--FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC 72 PD + D T L F GK+V L PGAF PTCS + P EK+ + Sbjct: 1 AGDKAPDFTLPDVALDGKTVSLSDFKGKKVVLNFWPGAFCPTCS-AEHPYLEKLSKLYKA 59 Query: 73 EGIEEVYCLSVNDAF-VMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSW 131 +G++ V + ND F VMN W K E +L DG G FT+ G+ GLR+ Sbjct: 60 KGVDVVAVNASNDPFFVMNFWAK--EGLKYPVLADGDGAFTKAYGLT-----EDAGLRTP 112 Query: 132 RYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVL 169 RY + +D V V DP ++S E VL Sbjct: 113 RYFLIDEDGKVVYLEVGP--------DPGDVSDAEAVL 142 >gnl|CDD|183884 PRK13189, PRK13189, peroxiredoxin; Provisional. Length = 222 Score = 41.1 bits (97), Expect = 2e-04 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 7/94 (7%) Query: 30 DVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVM 89 + D + GK LF+ P FTP C+ + F+K YD+ R E + LS++ F Sbjct: 26 PIKLPDDYKGKWFVLFSHPADFTPVCTT-EFVAFQKRYDEFRELNTELI-GLSIDQVFSH 83 Query: 90 NAWGKKLEIK-NVK----LLPDGSGEFTRKMGML 118 W + ++ K V+ ++ D GE +K+GM+ Sbjct: 84 IKWVEWIKEKLGVEIEFPIIADDRGEIAKKLGMI 117 >gnl|CDD|106159 PRK13190, PRK13190, putative peroxiredoxin; Provisional. Length = 202 Score = 37.9 bits (88), Expect = 0.001 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Query: 39 GKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLE 97 GK V LF+ P FTP C+ + F + Y+D + G+E V LSV+ + AW + +E Sbjct: 27 GKWVLLFSHPADFTPVCTT-EFIAFSRRYEDFKKLGVELV-GLSVDSIYSHIAWLRDIE 83 >gnl|CDD|163149 TIGR03137, AhpC, peroxiredoxin. This gene contains two invariant cysteine residues, one near the N-terminus and one near the C-terminus, each followed immediately by a proline residue. Length = 187 Score = 37.8 bits (88), Expect = 0.002 Identities = 34/119 (28%), Positives = 54/119 (45%), Gaps = 11/119 (9%) Query: 17 TVLPDGSKAF---QWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCE 73 + P + A+ ++ +V +D+ VF F P FT C +L Y +L+ Sbjct: 7 EIKPFKATAYHNGEFVEVTDEDVKGKWSVFFF-YPADFTFVCPT-ELEDLADKYAELKKL 64 Query: 74 GIEEVYCLSVNDAFVMNAWGKKLE-IKNVK--LLPDGSGEFTRKMGMLVYKDNVGFGLR 129 G+E VY +S + FV AW E I + +L D +G TR G+L+ + G R Sbjct: 65 GVE-VYSVSTDTHFVHKAWHDTSEAIGKITYPMLGDPTGVLTRNFGVLI--EEAGLADR 120 >gnl|CDD|183885 PRK13191, PRK13191, putative peroxiredoxin; Provisional. Length = 215 Score = 36.7 bits (85), Expect = 0.003 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 9/90 (10%) Query: 35 DLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGK 94 D + G+ LF+ PG FTP C+ + F K Y++ + E + LSV+ W Sbjct: 29 DDYKGRWFVLFSHPGDFTPVCTT-EFYSFAKKYEEFKKLNTELI-GLSVDSNISHIEWVM 86 Query: 95 KLEIKNVK------LLPDGSGEFTRKMGML 118 +E KN+K ++ D G +++GM+ Sbjct: 87 WIE-KNLKVEVPFPIIADPMGNVAKRLGMI 115 >gnl|CDD|162355 TIGR01429, AMP_deaminase, AMP deaminase. This model describes AMP deaminase, a large, well-conserved eukaryotic protein involved in energy metabolism. Most members of the family have an additional, poorly alignable region of 150 amino acids or more N-terminal to the region included in the model. Length = 611 Score = 28.7 bits (64), Expect = 0.94 Identities = 9/28 (32%), Positives = 10/28 (35%) Query: 52 TPTCSDHQLPGFEKIYDDLRCEGIEEVY 79 P C D P E Y G+ VY Sbjct: 63 DPYCLDDDAPPIELGYLVRMHGGVLFVY 90 >gnl|CDD|161872 TIGR00422, valS, valyl-tRNA synthetase. The valyl-tRNA synthetase (ValS) is a class I amino acyl-tRNA ligase and is particularly closely related to the isoleucyl tRNA synthetase. Length = 861 Score = 28.5 bits (64), Expect = 0.95 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 7/42 (16%) Query: 110 EFTRKMGMLV----YKDNVGFGLRSWRYGALIKDMVVESWFV 147 E ++ G+LV + NVG WR G +++ ++ + WFV Sbjct: 322 EDLKEEGLLVKIEPHTHNVGTC---WRSGTVVEPLLSKQWFV 360 >gnl|CDD|106544 PRK13599, PRK13599, putative peroxiredoxin; Provisional. Length = 215 Score = 27.4 bits (60), Expect = 2.2 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 7/87 (8%) Query: 37 FAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKL 96 +AGK LF+ P FTP C+ + F + +D + E E+ LSV+ F W + + Sbjct: 26 YAGKWFVLFSHPADFTPVCTT-EFVEFARKANDFK-ELNTELIGLSVDQVFSHIKWVEWI 83 Query: 97 EIKNVKLLP-----DGSGEFTRKMGML 118 + +P D G+ + ++GM+ Sbjct: 84 KDNTNIAIPFPVIADDLGKVSNQLGMI 110 >gnl|CDD|181857 PRK09437, bcp, thioredoxin-dependent thiol peroxidase; Reviewed. Length = 154 Score = 26.8 bits (60), Expect = 3.1 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 31 VNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIE 76 V+ D F G+RV ++ P A TP C+ Q G D+L+ G+ Sbjct: 23 VSLTD-FQGQRVLVYFYPKAMTPGCTV-QACGLRDNMDELKKAGVV 66 >gnl|CDD|179809 PRK04286, PRK04286, hypothetical protein; Provisional. Length = 298 Score = 25.7 bits (57), Expect = 6.6 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 57 DHQLPGFEKIYDDLRCEGIEEVY 79 DH P +E Y+ E +E+Y Sbjct: 77 DHHTPFYEDPYELSDEEIPKEIY 99 >gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional. Length = 257 Score = 25.8 bits (57), Expect = 6.9 Identities = 10/16 (62%), Positives = 11/16 (68%), Gaps = 1/16 (6%) Query: 122 DNVGFGLR-SWRYGAL 136 DNVG GL+ WR AL Sbjct: 100 DNVGLGLKGQWRDAAL 115 >gnl|CDD|130290 TIGR01223, Pmev_kin_anim, phosphomevalonate kinase, animal type. This enzyme is part of the mevalonate pathway, one of two alternative pathways for the biosynthesis of IPP. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found. One is this type, found in animals. The other is the ERG8 type, found in plants and fungi (TIGR01219) and in Gram-positive bacteria (TIGR01220). Length = 182 Score = 25.4 bits (55), Expect = 8.4 Identities = 5/53 (9%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Query: 88 VMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDM 140 + + ++ + +LL + + + M+ + + R G + + Sbjct: 37 LKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEK----RQADPGFFCRKI 85 >gnl|CDD|163297 TIGR03503, TIGR03503, conserved hypothetical protein TIGR03503. This set of conserved hypothetical protein has a phylogenetic range that closely matches that of TIGR03501, a putative C-terminal protein targeting signal. Length = 374 Score = 25.4 bits (56), Expect = 9.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 15 VATVLPDGSKAFQWK 29 V V PDGSK + W+ Sbjct: 32 VILVRPDGSKYYAWR 46 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.323 0.140 0.436 Gapped Lambda K H 0.267 0.0711 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,999,306 Number of extensions: 185656 Number of successful extensions: 317 Number of sequences better than 10.0: 1 Number of HSP's gapped: 316 Number of HSP's successfully gapped: 17 Length of query: 177 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 90 Effective length of database: 4,114,577 Effective search space: 370311930 Effective search space used: 370311930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.6 bits)