RPSBLAST alignment of GI: 254780311 and protein with PDBid: 1q98

>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Length = 165
 Score = 51.6 bits (123), Expect = 1e-07
 Identities = 30/142 (21%), Positives = 50/142 (35%), Gaps = 15/142 (10%)

Query: 14  RVATVLPDGS-KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRC 72
           +V  ++ +         DV   D FA KR  L   P   T  C    +  F +    L  
Sbjct: 18  QVGEIVENFILVGNDLADVALND-FASKRKVLNIFPSIDTGVC-ATSVRKFNQQAAKL-- 73

Query: 73  EGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPD-GSGEFTRKMGMLVY-KDNVGFGLRS 130
                V C+S +  F    +     I+N K +    +     ++G+ +      G   R+
Sbjct: 74  -SNTIVLCISADLPFAQARFCGAEGIENAKTVSTFRNHALHSQLGVDIQTGPLAGLTSRA 132

Query: 131 WRYGALIKD---MVVESWFVEE 149
                ++ D    V+ S  VEE
Sbjct: 133 ----VIVLDEQNNVLHSQLVEE 150