RPSBLAST alignment of GI: 254780311 and protein with PDBid: 3ixr

>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Length = 179
 Score = 56.9 bits (137), Expect = 3e-09
 Identities = 23/168 (13%), Positives = 47/168 (27%), Gaps = 19/168 (11%)

Query: 12  HMRVATVLPDGSKAF--QWKDVNTQDL--FAGKRVFLFALPGAFTPTCSDHQLPGFEKIY 67
           HM +   L                + L  +  + + L+  P   TP  S  +   F  + 
Sbjct: 20  HMNIGDTLNHSLLNHPLMLSGSTCKTLSDYTNQWLVLYFYPKDNTPGSST-EGLEFNLLL 78

Query: 68  DDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFG 127
                     V  +S +     +++  K       L+ D      +   ++  K   G  
Sbjct: 79  PQFEQINA-TVLGVSRDSVKSHDSFCAKQGF-TFPLVSDSDAILCKAFDVIKEKTMYGRQ 136

Query: 128 LRSW-RYGALI-KDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR 173
           +    R   LI     +   + +     +           E VL  ++
Sbjct: 137 VIGIERSTFLIGPTHRIVEAWRQVKVPGH----------AEEVLNKLK 174