>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114 This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism. It is phosphorylated by NtrB and interacts with sigma-54. One of the best studied examples is its activation of the gene glnA, which encodes the enzyme glutamine synthetase.. NtrC is composed of three domains , . The 124 residue N-terminal domain is homologous to receiver domains of other response regulator proteins in two-component signal transduction systems , . The 240 residue central domain of NtrC is homologous to a domain found in all activators of the sigma-54 RNA polymerase holoenzyme , . The C-terminal domain has been indicated to contain the determinants necessary for both DNA-binding and dimerization of full-length NtrC.; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay), 0009399 nitrogen fixation, 0050906 detection of stimulus during sensory perception.

Probab=99.96 E-value=3.9e-28 Score=189.60 Aligned_cols=117 Identities=32% Similarity=0.478 Sum_probs=114.3 Q ss_pred EEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECC Q ss_conf 99975998999999999998898999999979999999718-99899998365599979999999985899859999437 Q gi|254780312|r 5 ILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREE-PFSLLLTDIVMPEMDGIELARRATELDPDLKVMFITGF 83 (122) Q Consensus 5 ILiVDD~~~~r~~l~~~L~~~G~~v~~a~~g~~al~~~~~~-~~dlii~D~~mP~~dG~el~~~ir~~~~~~pii~~s~~ 83 (122) T Consensus 1 vwvvDDD~siR~VL~~AL~~~g~~v~~f~~A~~~l~~l~~~p~pD~~~tD~rMPg~~Gl~LL~~ik~~~P~LPVIvM~A~ 80 (471) T TIGR01818 1 VWVVDDDRSIRWVLEKALSRAGIEVRTFDNAASVLRALAREPQPDLLITDVRMPGEDGLDLLKQIKKRHPKLPVIVMTAH 80 (471) T ss_pred CEEEECCCHHHHHHHHHHHHCCCEEEEHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCCCEEEECCC T ss_conf 95776471899999999966695453113189999998447999879861226882489999999850899977987130 Q ss_pred CCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCC Q ss_conf 97899999997699869976979899999999996036 Q gi|254780312|r 84 AAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTIK 121 (122) Q Consensus 84 ~~~~~~~~~~~~g~~~~l~KP~~~~~L~~~i~~~l~~~ 121 (122) T Consensus 81 ~dl~~Av~a~~~GAfEYLpKPFD~de~v~lv~RA~~~~ 118 (471) T TIGR01818 81 SDLDSAVAAYQRGAFEYLPKPFDLDEAVTLVERALAHA 118 (471) T ss_pred HHHHHHHHHHHCCCHHCCCCCCCHHHHHHHHHHHHCCC T ss_conf 67899999973583021769876688999999861030

HHsearch alignment for GI: 254780312 and conserved domain: TIGR01818