RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780312|ref|YP_003064725.1| response regulator receiver protein [Candidatus Liberibacter asiaticus str. psy62] (122 letters) >gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]. Length = 464 Score = 97.7 bits (243), Expect = 7e-22 Identities = 47/118 (39%), Positives = 65/118 (55%) Query: 1 MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMD 60 M +IL+ +DD D+R L +AL AGYEVV+ + A + + E PF L+L DI MP MD Sbjct: 3 MMARILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMD 62 Query: 61 GIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLL 118 G+EL + DPDL V+ +TG + ++ L KPF L L+ V R L Sbjct: 63 GLELLKEIKSRDPDLPVIVMTGHGDIDTAVEALRLGAFDFLEKPFDLDRLLAIVERAL 120 >gnl|CDD|143854 pfam00072, Response_reg, Response regulator receiver domain. This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain. Length = 111 Score = 86.9 bits (216), Expect = 1e-18 Identities = 38/114 (33%), Positives = 56/114 (49%), Gaps = 6/114 (5%) Query: 5 ILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIEL 64 +L+ +DD +R L + L K GY V ++G A + ++E+ L+L DI MP MDG+EL Sbjct: 1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLKEKRPDLILLDIRMPGMDGLEL 60 Query: 65 ARRATELDPDLKVMFITGFAAVALNPDSNAPKNA---KVLSKPFHLRDLVNEVN 115 RR P V+ +T D+ A LSKPF +LV + Sbjct: 61 LRRIRRRPPTTPVIVLTAHGDE---EDAVEALKAGANDFLSKPFDPEELVAALR 111 >gnl|CDD|29071 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers. Length = 113 Score = 85.7 bits (212), Expect = 3e-18 Identities = 40/113 (35%), Positives = 60/113 (53%) Query: 6 LLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELA 65 L+ +DD +R L + L K GYEVV +G A + EE L+L DI+MP MDG+EL Sbjct: 1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELL 60 Query: 66 RRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLL 118 RR + PD+ ++F+T ++ L+KPF +L+ + LL Sbjct: 61 RRIRKRGPDIPIIFLTAHGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113 >gnl|CDD|33243 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms]. Length = 360 Score = 74.2 bits (182), Expect = 8e-15 Identities = 40/125 (32%), Positives = 61/125 (48%), Gaps = 9/125 (7%) Query: 4 KILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIE 63 +LL +D+ D L + L GY V+ NG A ++EEP L+L D+ MPEMDG E Sbjct: 16 TVLLVDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAE 75 Query: 64 LARRATELDP---DLKVMFITGFAAVALNPDSNAPKNAKV---LSKPFHLRDLVNEVNRL 117 + + + P + V+ +T +A + D A LSKP ++LV V+ Sbjct: 76 VLNKLKAMSPSTRRIPVILLTAYAD---SEDRQRALEAGADDYLSKPISPKELVARVSSH 132 Query: 118 LTIKN 122 L +K Sbjct: 133 LQLKR 137 >gnl|CDD|34367 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms]. Length = 475 Score = 72.3 bits (177), Expect = 3e-14 Identities = 26/84 (30%), Positives = 47/84 (55%), Gaps = 3/84 (3%) Query: 3 QKILLAEDDDDMRRFLIKAL--GKAGYEVV-SCNNGASAYDKVREEPFSLLLTDIVMPEM 59 K+L+ +D+ +R L + G EVV + NG A + ++E +++TDI MP M Sbjct: 2 YKVLIVDDEPLIREGLKSLIDWEALGIEVVGTAANGKEALELIQETQPDIVITDINMPGM 61 Query: 60 DGIELARRATELDPDLKVMFITGF 83 DG++L + E PD + + ++G+ Sbjct: 62 DGLDLIKAIKEQSPDTEFIILSGY 85 >gnl|CDD|31127 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms]. Length = 130 Score = 69.5 bits (169), Expect = 2e-13 Identities = 44/121 (36%), Positives = 64/121 (52%), Gaps = 3/121 (2%) Query: 1 MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNG-ASAYDKVREEP-FSLLLTDIVMPE 58 ++L+ +D+ RR L + L GYEVV +G A + +RE P L+L DI MP Sbjct: 4 SGLRVLVVDDEPVNRRLLKRLLEDLGYEVVEAADGEEEALELLRELPQPDLILLDINMPG 63 Query: 59 MDGIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKP-FHLRDLVNEVNRL 117 MDGIEL RR P++ V+ +T +A A + A L+KP F +L+ + RL Sbjct: 64 MDGIELLRRLRARGPNIPVILLTAYADEADRERALAAGADDYLTKPIFLEEELLAALRRL 123 Query: 118 L 118 L Sbjct: 124 L 124 >gnl|CDD|31088 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]. Length = 229 Score = 67.3 bits (164), Expect = 9e-13 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 2/116 (1%) Query: 4 KILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIE 63 +ILL EDD ++ L + L + GYEV +G A + RE+P L+L D+++P++DG+E Sbjct: 2 RILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAREQP-DLVLLDLMLPDLDGLE 60 Query: 64 LARRATEL-DPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLL 118 L RR ++ +T L+KPF R+L+ + LL Sbjct: 61 LCRRLRAKKGSGPPIIVLTARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRALL 116 >gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms]. Length = 435 Score = 64.2 bits (156), Expect = 1e-11 Identities = 35/124 (28%), Positives = 55/124 (44%), Gaps = 12/124 (9%) Query: 2 NQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDG 61 +KIL+ +DD R L + L G+ VV +G A ++ E P L+L D MP+MDG Sbjct: 132 PKKILVVDDDATQRERLRRILQVEGFRVVEATDGEEALLQLAELPPDLVLLDANMPDMDG 191 Query: 62 IELAR--RATELDPDLKVMFITG-----FAAVALNPDSNAPKNAKVLSKPFHLRDLVNEV 114 +EL R E D+ ++ ++ A N ++KP +L + Sbjct: 192 LELCTRLRQLERTRDIPIILLSSKDDDELVVRAFELGVN-----DYITKPIEEGELRARL 246 Query: 115 NRLL 118 R L Sbjct: 247 RRQL 250 Score = 33.4 bits (76), Expect = 0.016 Identities = 17/58 (29%), Positives = 23/58 (39%) Query: 15 RRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATELD 72 + L L EV + G A + + L D++MP MDG EL RR Sbjct: 1 VKLLEAKLPLEYKEVATAKKGLIALAILLDHKPDYKLLDVMMPGMDGFELCRRLKAEP 58 >gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms]. Length = 202 Score = 61.0 bits (148), Expect = 7e-11 Identities = 33/116 (28%), Positives = 52/116 (44%) Query: 5 ILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIEL 64 + + +DD+ +R L L AG++V + + LL D+ MP M G+EL Sbjct: 7 VHVVDDDESVRDALAFLLESAGFQVKCFASAEEFLAAAPLDRPGCLLLDVRMPGMSGLEL 66 Query: 65 ARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTI 120 R E L V+F+TG + + + L KPF +DL++ V R L Sbjct: 67 QDRLAERGIRLPVIFLTGHGDIPMAVQAMKAGAVDFLEKPFSEQDLLDAVERALAR 122 >gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]. Length = 211 Score = 59.2 bits (143), Expect = 3e-10 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 2/117 (1%) Query: 4 KILLAEDDDDMRRFLIKALGKAG-YEVVS-CNNGASAYDKVREEPFSLLLTDIVMPEMDG 61 K+L+ +D +R L + L EVV +NG A D RE ++L D+ MP MDG Sbjct: 2 KVLIVDDHPLVREGLRQLLELEPDLEVVGEASNGEEALDLARELKPDVVLLDLSMPGMDG 61 Query: 62 IELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLL 118 +E ++ PD+KV+ +T A + L K +LV + + Sbjct: 62 LEALKQLRARGPDIKVVVLTAHDDPAYVIRALRAGADGYLLKDASPEELVEAIRAVA 118 >gnl|CDD|33728 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms]. Length = 361 Score = 58.8 bits (142), Expect = 3e-10 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 2/115 (1%) Query: 4 KILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIE 63 +I++ +DD + + L L +AG+EV SC++ A D + L+ DIVMP M+GIE Sbjct: 2 RIIIVDDDAAIVKLLSVILSRAGHEVRSCSHPVEALDLLEVFKPDLIFLDIVMPYMNGIE 61 Query: 64 LARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLL 118 A + +++ + ++FI+ A A DS L KP L ++R L Sbjct: 62 FAEQVRDIESAVPIIFISSHAEYAD--DSFGMNLDDYLPKPVTPEKLNRAIDRRL 114 >gnl|CDD|34205 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription]. Length = 182 Score = 53.0 bits (127), Expect = 2e-08 Identities = 21/85 (24%), Positives = 45/85 (52%) Query: 3 QKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGI 62 + +LL +DD R L +A+ + G+ VV+ + A R P + + D+ + + G+ Sbjct: 10 KSLLLVDDDTPFLRTLARAMERRGFAVVTAESVEEALAAARTAPPAYAVVDLKLGDGSGL 69 Query: 63 ELARRATELDPDLKVMFITGFAAVA 87 + E D++++ +TG+A++A Sbjct: 70 AVIEALRERRADMRIVVLTGYASIA 94 >gnl|CDD|33090 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms]. Length = 244 Score = 52.7 bits (126), Expect = 3e-08 Identities = 32/117 (27%), Positives = 50/117 (42%), Gaps = 4/117 (3%) Query: 4 KILLAEDDDDMRRFL--IKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDG 61 K+L+ +D+ R L I V NG A ++ L+ DI MP+++G Sbjct: 3 KVLIVDDEPLAREELRRILNEIPDIEIVGEAENGEEALQLLQGLRPDLVFLDIAMPDING 62 Query: 62 IELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLL 118 IELA R + DP ++F+T A+ + + L KP L + RL Sbjct: 63 IELAARIRKGDPRPAIVFVTAHDEYAV--AAFEVEALDYLLKPISEERLAKTLERLR 117 >gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms]. Length = 786 Score = 52.4 bits (125), Expect = 3e-08 Identities = 39/122 (31%), Positives = 56/122 (45%), Gaps = 12/122 (9%) Query: 4 KILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVR-EEPFSLLLTDIVMPEMDGI 62 KILL +D+ R+ L K G EV N+G A DK++ + ++ D+ MPEMDG Sbjct: 668 KILLVDDNPVNRKVATGMLKKLGAEVTEVNSGQEALDKLKPPHSYDVIFMDLQMPEMDGY 727 Query: 63 ELARRATE-LDPDLKVMFITGFAAVALNPDSNAPKNAKV-----LSKPFHLRDLVNEVNR 116 E R + L ++ +T A S + +V LSKPF L LV + Sbjct: 728 EATREIRKKERWHLPIVALTADAD-----PSTEEECLEVGMDGYLSKPFTLEKLVKILRE 782 Query: 117 LL 118 L Sbjct: 783 FL 784 >gnl|CDD|164540 CHL00148, orf27, Ycf27; Reviewed. Length = 240 Score = 50.1 bits (120), Expect = 2e-07 Identities = 24/86 (27%), Positives = 50/86 (58%), Gaps = 1/86 (1%) Query: 2 NQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDG 61 +KIL+ +D+ +R+ L L GYEV++ ++G A R+E L++ D++MP++DG Sbjct: 6 KEKILVVDDEAYIRKILETRLSIIGYEVITASDGEEALKLFRKEQPDLVILDVMMPKLDG 65 Query: 62 IELARRATELDPDLKVMFITGFAAVA 87 + + + + D+ ++ +T V+ Sbjct: 66 YGVCQEIRK-ESDVPIIMLTALGDVS 90 >gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms]. Length = 224 Score = 47.9 bits (114), Expect = 6e-07 Identities = 34/119 (28%), Positives = 51/119 (42%), Gaps = 10/119 (8%) Query: 4 KILLAEDD---DDMRRFLIKALGKAGYEVV-SCNNGASAYDKVREEPFSLLLTDIVMPEM 59 +L+ EDD ++ R +K + G+ VV + A + E L+L DI MP+ Sbjct: 2 NVLIIEDDPMVAEIHRRYVKQI--PGFSVVGTAGTLEEAKMIIEEFKPDLILLDIYMPDG 59 Query: 60 DGIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKV--LSKPFHLRDLVNEVNR 116 +GIEL + V+ IT AA + A + V L KPF L + R Sbjct: 60 NGIELLPELRSQHYPVDVIVIT--AASDMETIKEALRYGVVDYLIKPFTFERLQQALTR 116 >gnl|CDD|32383 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms]. Length = 350 Score = 39.5 bits (92), Expect = 2e-04 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Query: 4 KILLAEDDDDMRRFLIKALGKAG--YEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDG 61 ++L+ +D MR+ + L V + NG A DKV++ ++ D+ MP MDG Sbjct: 3 RVLVVDDSALMRKVISDILNSDPDIEVVGTARNGREAIDKVKKLKPDVITLDVEMPVMDG 62 Query: 62 IELARRATELDPDLKVMFIT 81 +E R+ L P L V+ ++ Sbjct: 63 LEALRKIMRLRP-LPVIMVS 81 >gnl|CDD|33502 COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms]. Length = 194 Score = 30.6 bits (69), Expect = 0.10 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Query: 1 MNQKILLAEDDDDMRRFLIKALGKAGYEVVSC-NNGASAYDKVREEPFSLLLTDIVMPEM 59 M ++L+A+D+ R + + L +AGY+ V +G A + +++ DI MP Sbjct: 4 MLLRVLVADDEALTRMDIREGLLEAGYQRVGEAADGLEAVEVCERLQPDVVILDIEMPRR 63 Query: 60 DGIELARRATELDPDLKVMFI 80 D IE A+E V Sbjct: 64 DIIEALLLASENVARPIVALT 84 >gnl|CDD|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily. Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily. They are mostly present in archaea and eubacteria, and are primarily involved in scavenging solutes from the environment. ABC-type transporters couple ATP hydrolysis with the uptake and efflux of a wide range of substrates across bacterial membranes, including amino acids, peptides, lipids and sterols, and various drugs. These systems are comprised of transmembrane domains, nucleotide binding domains, and in most bacterial uptake systems, periplasmic binding proteins (PBPs) which transfer the ligand to the extracellular gate of the transmembrane domains. These PBPs bind their substrates selectively and with high affinity. Members of this group include ABC-type Leucine-Isoleucine-Valine-Binding Proteins (LIVBP), which are homologous to the aliphatic amidase transcriptional repressor, AmiC, of Pseudomonas aeruginosa. The uncharacterized periplasmic components of various ABC-type transport systems are included in this group. Length = 298 Score = 27.4 bits (61), Expect = 1.1 Identities = 20/110 (18%), Positives = 34/110 (30%), Gaps = 32/110 (29%) Query: 6 LLAEDDD---DMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTD--------- 53 ++ +D + +AL K G EVV+ EE + TD Sbjct: 140 IIYDDYAYGRGLAAAFREALKKLGGEVVA------------EETYPPGATDFSPLIAKLK 187 Query: 54 --------IVMPEMDGIELARRATELDPDLKVMFITGFAAVALNPDSNAP 95 + D ++A E + ++ G AA AL + Sbjct: 188 AAGPDAVFLAGYGGDAALFLKQAREAGLKVPIVGGDGAAAPALLELAGDA 237 >gnl|CDD|30592 COG0243, BisC, Anaerobic dehydrogenases, typically selenocysteine-containing [Energy production and conversion]. Length = 765 Score = 27.0 bits (59), Expect = 1.2 Identities = 15/82 (18%), Positives = 22/82 (26%), Gaps = 1/82 (1%) Query: 25 AGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGI-ELARRATELDPDLKVMFITGF 83 +V VR + G+ R E +K +F+ G Sbjct: 382 GARDVGGLVKPLPGLPVVRAKTAIPWGRPTDAAAKPGLSTADRALLEGPYPIKALFVYGG 441 Query: 84 AAVALNPDSNAPKNAKVLSKPF 105 V PD K A + F Sbjct: 442 NPVVSAPDDRNVKKALLRDDEF 463 >gnl|CDD|39020 KOG3816, KOG3816, KOG3816, Cell differentiation regulator of the Headcase family [Signal transduction mechanisms]. Length = 526 Score = 27.0 bits (59), Expect = 1.2 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 5/29 (17%) Query: 9 EDD-----DDMRRFLIKALGKAGYEVVSC 32 EDD D++R F++K+LG + V C Sbjct: 355 EDDCPQGGDEVRLFILKSLGASNLRAVPC 383 >gnl|CDD|111722 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain. L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate. The enzyme participates in the citric acid cycle. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. Length = 173 Score = 26.5 bits (59), Expect = 1.7 Identities = 11/34 (32%), Positives = 17/34 (50%) Query: 6 LLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAY 39 +D D LI+ + AGYEV+ G++ Y Sbjct: 55 ENLKDTDWELEELIERVQNAGYEVIEAKAGSTTY 88 >gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others, all of which use a nucleophilic aspartate in their phosphoryl transfer reaction. All members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. Members of this superfamily are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.. Length = 139 Score = 25.8 bits (57), Expect = 3.1 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 5/70 (7%) Query: 15 RRFLIKALGKAGYEV----VSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATE 70 RR +++ L + G + V +NGA+ Y DI P D + A + Sbjct: 51 RREVLELLEELGLDDYFDPVITSNGAAIYYPKEGLFLGGGPFDIGKPNPDKLLAALKLLG 110 Query: 71 LDPDLKVMFI 80 +DP+ +V+ + Sbjct: 111 VDPE-EVLMV 119 >gnl|CDD|30494 COG0145, HyuA, N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism]. Length = 674 Score = 25.0 bits (54), Expect = 4.8 Identities = 12/34 (35%), Positives = 15/34 (44%) Query: 85 AVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLL 118 AV L+ D KVL+ P +VN RL Sbjct: 16 AVLLDEDGGVLATIKVLTTPDLPSGIVNAGIRLA 49 >gnl|CDD|147269 pfam05002, SGS, SGS domain. This domain was thought to be unique to the SGT1-like proteins, but is also found in calcyclin binding proteins. Length = 78 Score = 25.1 bits (55), Expect = 5.5 Identities = 12/43 (27%), Positives = 22/43 (51%) Query: 4 KILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEP 46 K + + DDD +R ++K+ ++ V+S N KV +P Sbjct: 27 KKIYKDGDDDTKRAMMKSFVESNGTVLSTNWDEVGKKKVETKP 69 >gnl|CDD|99795 cd06198, FNR_like_3, NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.. Length = 216 Score = 24.5 bits (54), Expect = 7.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Query: 8 AEDDDDMRRFLIKALG 23 A D D RF IKALG Sbjct: 49 APDPDGRLRFTIKALG 64 >gnl|CDD|153382 cd07370, HPCD, The Class III extradiol dioxygenase, homoprotocatechuate 2,3-dioxygenase, catalyzes the key ring cleavage step in the metabolism of homoprotocatechuate. 3,4-dihydroxyphenylacetate (homoprotocatechuate) 2,3-dioxygenase (HPCD) catalyzes the key ring cleavage step in the metabolism of homoprotocatechuate (hpca), a central intermediate in the bacterial degradation of aromatic compounds. The enzyme incorporates both atoms of molecular oxygen into hpca, resulting in aromatic ring-opening to yield alpha-hydroxy-delta-carboxymethyl cis-muconic semialdehyde. HPCD is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Length = 280 Score = 24.6 bits (54), Expect = 7.9 Identities = 12/41 (29%), Positives = 17/41 (41%), Gaps = 13/41 (31%) Query: 54 IVMPEMDG-------------IELARRATELDPDLKVMFIT 81 +++ E G E+ RRA EL D V+F T Sbjct: 14 MMLSEQPGPNKGCRQAAIDGLKEIGRRARELGVDTIVVFDT 54 >gnl|CDD|36775 KOG1562, KOG1562, KOG1562, Spermidine synthase [Amino acid transport and metabolism]. Length = 337 Score = 24.1 bits (52), Expect = 8.9 Identities = 8/31 (25%), Positives = 15/31 (48%) Query: 34 NGASAYDKVREEPFSLLLTDIVMPEMDGIEL 64 +G + ++E PF +++TD P L Sbjct: 183 DGFLFLEDLKENPFDVIITDSSDPVGPACAL 213 >gnl|CDD|144681 pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemase. This family contains aspartate racemase, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase. Length = 212 Score = 24.3 bits (53), Expect = 9.2 Identities = 20/98 (20%), Positives = 33/98 (33%), Gaps = 16/98 (16%) Query: 6 LLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYD-----KVREEPFSLLLTDIVMPEMD 60 +LA + + L +AG EVV+ + ++ E L + D Sbjct: 111 VLATYGTIVSGLYQELLAEAGIEVVAPAIRLGIVEVLELGRIEEASVEALAAALERLAED 170 Query: 61 GIE-----------LARRATELDPDLKVMFITGFAAVA 87 G + L L+P+L V I A+A Sbjct: 171 GADAVILGCTELPLLLELIEALEPELGVPVIDSNQALA 208 >gnl|CDD|147313 pfam05066, RNA_pol_delta, DNA-directed RNA polymerase delta subunit. The delta protein is a dispensable subunit of Bacillus subtilis RNA polymerase (RNAP) that has major effects on the biochemical properties of the purified enzyme. In the presence of delta, RNAP displays an increased specificity of transcription, a decreased affinity for nucleic acids, and an increased efficiency of RNA synthesis because of enhanced recycling. The delta protein, contains two distinct regions, an N-terminal domain and a glutamate and aspartate residue-rich carboxyl-terminal region. Length = 94 Score = 24.1 bits (53), Expect = 9.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 103 KPFHLRDLVNEVNRLLTIKN 122 KP DLVNE+ +LL I + Sbjct: 29 KPMTFDDLVNEIQKLLGISD 48 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0755 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,447,710 Number of extensions: 69071 Number of successful extensions: 233 Number of sequences better than 10.0: 1 Number of HSP's gapped: 225 Number of HSP's successfully gapped: 51 Length of query: 122 Length of database: 6,263,737 Length adjustment: 82 Effective length of query: 40 Effective length of database: 4,491,799 Effective search space: 179671960 Effective search space used: 179671960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.4 bits)