Query         gi|254780314|ref|YP_003064727.1| outer membrane protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 351
No_of_seqs    25 out of 27
Neff          1.8 
Searched_HMMs 39220
Date          Sun May 29 14:56:12 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780314.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 pfam02530 Porin_2 Porin subfam 100.0 2.9E-41 1.4E-45  277.0  24.0  244   72-329    78-352 (378)
  2 pfam04966 OprB Carbohydrate-se  97.3  0.0096 2.4E-07   37.0  12.2   67  246-312   284-363 (365)
  3 pfam06178 KdgM Oligogalacturon  97.2   0.014 3.6E-07   35.9  11.6  103  214-320     2-109 (218)
  4 PRK13528 outer membrane recept  94.7    0.16   4E-06   29.4   6.8   56  268-325   423-478 (727)
  5 COG3203 OmpC Outer membrane pr  94.4    0.41 1.1E-05   26.8  12.0  224   84-329    59-328 (354)
  6 pfam09694 Gcw_chp Bacterial pr  93.8    0.54 1.4E-05   26.1  15.1  134  213-351    80-226 (226)
  7 pfam03349 Toluene_X Outer memb  93.8    0.56 1.4E-05   26.0  11.8   31  301-331   311-341 (415)
  8 PRK09980 ompL outer membrane p  93.6    0.21 5.3E-06   28.7   5.6   52  278-329   154-210 (230)
  9 PRK13524 outer membrane recept  93.1     0.3 7.6E-06   27.7   5.7   60  263-324   425-484 (742)
 10 pfam01389 OmpA_membrane OmpA-l  92.3    0.91 2.3E-05   24.7  11.7  123  220-350    35-173 (175)
 11 PRK10808 outer membrane protei  91.2     1.2   3E-05   23.9  10.0   27  303-329   145-171 (347)
 12 cd00342 gram_neg_porins Porins  90.2     1.5 3.8E-05   23.4  14.4  187  134-329    72-298 (329)
 13 pfam12094 DUF3570 Protein of u  89.6     1.7 4.2E-05   23.1   7.2   81  251-331   265-379 (407)
 14 PRK13484 putative iron-regulat  87.3     2.1 5.3E-05   22.5   5.8   12   21-32    132-143 (682)
 15 COG2067 FadL Long-chain fatty   84.9     3.1 7.9E-05   21.4  11.6  125  205-342   234-380 (440)
 16 PRK13513 putative outer membra  84.5     3.2 8.2E-05   21.3   6.6   22  308-329   528-549 (660)
 17 PRK09840 catecholate sideropho  82.7     3.8 9.7E-05   20.8  10.3   73  214-292   384-468 (760)
 18 COG3713 OmpV Outer membrane pr  82.1       4  0.0001   20.7   7.7   84  228-328   124-231 (258)
 19 PRK10064 colicin I receptor; P  81.4     4.2 0.00011   20.5  13.1   57  265-323   357-413 (663)
 20 PRK13486 bifunctional enteroba  80.4     4.6 0.00012   20.3   8.9   58  266-325   381-438 (696)
 21 COG4772 FecA Outer membrane re  78.1     5.4 0.00014   19.9   5.2  120  207-331   366-508 (753)
 22 pfam00267 Porin_1 Gram-negativ  73.6     7.1 0.00018   19.1  11.2  108  237-351   210-334 (334)
 23 TIGR03509 OMP_MtrB_PioB decahe  70.5     8.3 0.00021   18.7   5.9  240   74-327   211-508 (649)
 24 PRK13483 enterobactin receptor  66.1      10 0.00026   18.1  10.1   24  269-292   374-397 (663)
 25 pfam11854 DUF3374 Protein of u  52.0      18 0.00046   16.6   5.8   45  281-325   483-533 (675)
 26 pfam06980 DUF1302 Protein of u  48.6      20 0.00052   16.3  10.6  127  221-351   397-553 (553)
 27 cd01347 ligand_gated_channel T  44.8      23 0.00059   15.9   7.1   60  266-325   331-402 (635)
 28 COG4771 FepA Outer membrane re  43.0      25 0.00063   15.8   2.9   96  187-293   301-416 (699)
 29 PRK06330 transcript cleavage f  42.5      25 0.00064   15.7   3.5   45  205-252   829-877 (906)
 30 KOG3313 consensus               40.4      23 0.00058   16.0   2.3   22  308-329    90-111 (187)
 31 PRK10177 hypothetical protein;  39.9      28 0.00071   15.4   8.4   30  100-157    93-122 (452)
 32 PRK10003 ferric-rhodotorulic a  38.6      29 0.00074   15.3  10.9   53  269-323   454-513 (731)
 33 cd00817 ValRS_core This is the  37.5      23 0.00059   15.9   2.0   38   48-85     13-50  (363)
 34 PRK10716 long-chain fatty acid  37.0      31 0.00078   15.2  13.2   31  301-331   338-368 (437)
 35 pfam09270 Beta-trefoil Beta-tr  36.2      32 0.00081   15.1   2.7   22  161-184     5-26  (152)
 36 COG3637 Opacity protein and re  34.6      34 0.00086   14.9   3.6   29  301-329   144-172 (199)
 37 cd00812 LeuRS_core This is the  33.4      29 0.00073   15.4   1.9   38   47-84     11-48  (376)
 38 PRK08955 glyceraldehyde-3-phos  32.9      36 0.00091   14.7   2.9   17   48-64    204-220 (333)
 39 pfam11924 DUF3442 Protein of u  31.5      38 0.00096   14.6  12.1  113  201-322    91-227 (280)
 40 pfam10807 DUF2541 Protein of u  30.4      37 0.00096   14.6   2.1   44   56-99     13-64  (134)
 41 KOG0227 consensus               28.6      28 0.00071   15.4   1.2   33  117-159   171-203 (222)
 42 cd00818 IleRS_core This is the  27.2      44  0.0011   14.2   2.0   36   48-83     13-48  (339)
 43 COG4953 PbpC Membrane carboxyp  26.7      27 0.00069   15.5   0.9   15  301-315   516-530 (733)
 44 TIGR00036 dapB dihydrodipicoli  24.4      22 0.00057   16.0   0.1   49   92-140    42-95  (281)
 45 KOG3743 consensus               24.2      51  0.0013   13.8   2.1   30  160-191   318-348 (622)
 46 TIGR02073 PBP_1c penicillin-bi  23.5      39   0.001   14.5   1.2   71  163-236   345-440 (786)
 47 pfam06629 MipA MltA-interactin  23.0      54  0.0014   13.7  13.0   79  234-328    97-199 (226)
 48 PRK00133 metG methionyl-tRNA s  22.5      43  0.0011   14.3   1.2   37   48-84     14-50  (666)

No 1  
>pfam02530 Porin_2 Porin subfamily. This family consists of porins from the alpha subdivision of Proteobacteria the members of this family are related to pfam00267. The porins form large aqueous channels in the cell membrane allowing the selective entry of hydrophilic compounds this so called 'molecular sieve' is found in the cell walls of gram negative bacteria.
Probab=100.00  E-value=2.9e-41  Score=277.01  Aligned_cols=244  Identities=24%  Similarity=0.325  Sum_probs=210.0

Q ss_pred             CCCCCCCCCCCCCEEEEEEEEEECC----CCEEEEEEEEEECCCHHCCCCCCCCHHEEEEECCCCCCCHHHHEEEHHHEE
Q ss_conf             6877655433342000148997056----861349999974220000001112100012103555511252000110000
Q gi|254780314|r   72 NGNNEFNSLAYDIPVKGNLEVNANA----GDVTGVAKLKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGAR  147 (351)
Q Consensus        72 ng~~e~n~~~~d~~~~g~~~~~a~~----g~~tgv~~~~~~~d~~~~~~~~~~d~~a~~~~~~Ss~l~ldeayLdi~GfR  147 (351)
                      ++....++.+|+.+.|+.|.+.+.+    |+|...+.+.|+.++-       ++..  .=...++.+.|+.|||.++|||
T Consensus        78 ~~~~~~~~~~~~~~aR~~l~~dtrt~TEyGtlrty~~~~~~~~~g-------~~~~--~g~~~~~~~~l~~A~IqlgGft  148 (378)
T pfam02530        78 DGQGGRLTSDWDAFSRADLNVDTRTETELGTLRTFFESVFNWTTG-------SYTG--DGSDSNGGLGLYFAFIQLGGLR  148 (378)
T ss_pred             CCCCCCCCCCCCEEEEEEEEEECCCCCCCEEEEEEEEEEEEECCC-------CCCC--CCCCCCCCCCEEEEEEEECCEE
T ss_conf             543556665553266589997226552411147799999982378-------8666--6665677510215688871488


Q ss_pred             ECCEEEECC-----CCCCCCCCEEEECCCCCCCCCCEEEEEEECCC-EEEEEEHHHCCCCCC-----------CCEEEEE
Q ss_conf             012220024-----44455551023112224443322689982575-451033032146666-----------5403478
Q gi|254780314|r  148 LGYYKSWSD-----EVNPVYSPTTLYNDARGLDKMMSLSYRHSFGL-LKAGLSTDLLQKDGL-----------KQVLGIG  210 (351)
Q Consensus       148 aG~FySWWD-----EtddIgS~~TL~Nd~rg~dk~~SirYqYe~G~-F~AGiSvDeLE~dg~-----------~n~VGV~  210 (351)
                      +|+++||||     ++|.|...+...    +....|+|+|+|++|. |.|+||++|++....           .+...|.
T Consensus       149 ~G~~~S~fd~~~gy~gd~i~~~~~~~----g~~~~N~isYt~~~GnGfsA~islEd~~~~~~~~~~~~~~~~g~~~PdvV  224 (378)
T pfam02530       149 VGKDYSWFDTWLGYEGDVINNSGGPY----GNTGTNSISYTFDAGTGFSAGISLEELEGTRDLGAYGANSYIGSYTPDVV  224 (378)
T ss_pred             EECCCCCCCCCCCCCCCCCCCCCCCC----CCCEEEEEEEEEECCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCEE
T ss_conf             85030143034685553236633456----76225479999974883589998742667655555554455788688789


Q ss_pred             EEEEEEECCEEEEEEEEEECCCCCCEEEEEEEECCCCCC-EEEEEEEEECCCCCCCCCCC-------EEEEEEEEEEECE
Q ss_conf             896345412689998522114665127988861367882-02467887338640001121-------1366435563110
Q gi|254780314|r  211 YMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAG-TLDCGAVWASGDNSYYDKSK-------YSVFAGYKFDVAK  282 (351)
Q Consensus       211 g~vsg~aGavS~qltGGyDtd~eeGAIRAl~ta~iG~PG-TlglAgVwASgpNaYY~~SE-------WaVAAeYaikaTD  282 (351)
                      ++|..+.|..++|+.++||.+.|++|+|+.+++++| || ++.++|+|++|++.|+..++       |+|+++|++|+|+
T Consensus       225 g~v~~~qgwG~~q~~~a~ds~~~~~Av~~~~~~~~g-~g~s~~l~g~Y~~ga~~Y~~~~~~~~~~~~Wav~~~~~~~~t~  303 (378)
T pfam02530       225 GGVKVDQGWGAFQGVVAYDSDKEEGAVRARLSVKAG-DGDTLNIAGGYASGANRYTGDSEYHNWGGNWAVWAGYTYKATD  303 (378)
T ss_pred             EEEEEECCCEEEEEEEECCCCCCCEEEEEEEEEEEC-CCCEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEECCCC
T ss_conf             988762221268998742665425044899999867-9845899999815874223554443467750377656862333


Q ss_pred             EEEECCCEEEECCCC--CCCCCEEEEEEEEEEEEECCCEEEEEEEECCC
Q ss_conf             478604525404567--67852277877888885159127789873274
Q gi|254780314|r  283 SITISGGGQYFGDIN--KTGKDGWSAGISAKYMISSGLEAQASVAFNDN  329 (351)
Q Consensus       283 Kl~ITPG~QY~gd~~--~sg~DaWk~GlTvDYqItegL~tK~SVqY~D~  329 (351)
                      |++|+|++||.+...  ..+-++|++|+.++|++++||..+..|+|.|.
T Consensus       304 k~~~~~~~~~~~~~~~~~~d~~~~~vg~nv~ytpV~nl~~~~Ev~Yt~~  352 (378)
T pfam02530       304 KTAITPGAQWGGAGNVCNPDFDGWAVGANVDYTIVDNLTFTAEVRYTDL  352 (378)
T ss_pred             EEEEEECEEEECCCCCCCCCCCEEEEEEEEEEEECCCEEEEEEEEEEEC
T ss_conf             0898203375024543477754268888788788099689789999746


No 2  
>pfam04966 OprB Carbohydrate-selective porin, OprB family.
Probab=97.34  E-value=0.0096  Score=37.01  Aligned_cols=67  Identities=18%  Similarity=0.342  Sum_probs=48.7

Q ss_pred             CCCC-EEEEEEEEEC----------CCCCCCCCCCEEEEEEEEEEECEEEEECCCEEEECCC--CCCCCCEEEEEEEEEE
Q ss_conf             7882-0246788733----------8640001121136643556311047860452540456--7678522778778888
Q gi|254780314|r  246 SRAG-TLDCGAVWAS----------GDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDI--NKTGKDGWSAGISAKY  312 (351)
Q Consensus       246 G~PG-TlglAgVwAS----------gpNaYY~~SEWaVAAeYaikaTDKl~ITPG~QY~gd~--~~sg~DaWk~GlTvDY  312 (351)
                      ++|| .+|++.-|.-          +.+..-...|..+-+-|+++++|.+.|||++||.-+-  +....++|-.+|-.-.
T Consensus       284 ~r~gd~~G~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~E~~Y~~~v~dnIsITP~~~~i~nP~~~~~~~~~~v~~lRttf  363 (365)
T pfam04966       284 GRPGDTIGFGAGYNKVSDAARANQRLAGALAQDTEYVLELFYGYQLTPNLTLTPDLQYIINPGGNSDNDNALVLGLRTTF  363 (365)
T ss_pred             CCCCCEEEEEEEECCCCCHHHHCCCCCCCCCCCCCEEEEEEEEEECCCCEEEECCEEEEECCCCCCCCCCEEEEEEEEEE
T ss_conf             89998799999842337312201000266789977899999986656998994279999899998877987999999999


No 3  
>pfam06178 KdgM Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.
Probab=97.17  E-value=0.014  Score=35.94  Aligned_cols=103  Identities=14%  Similarity=0.169  Sum_probs=50.7

Q ss_pred             EEEECCEEEEEEEEEECCCCCCEEEEEEEECCCCCCE-EEEEEEEECC-CCCCCC---CCCEEEEEEEEEEECEEEEECC
Q ss_conf             3454126899985221146651279888613678820-2467887338-640001---1211366435563110478604
Q gi|254780314|r  214 SYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGT-LDCGAVWASG-DNSYYD---KSKYSVFAGYKFDVAKSITISG  288 (351)
Q Consensus       214 sg~aGavS~qltGGyDtd~eeGAIRAl~ta~iG~PGT-lglAgVwASg-pNaYY~---~SEWaVAAeYaikaTDKl~ITP  288 (351)
                      |-++-|++.++-..|..+.+.-+-|..++-... -|- |.+-+-|..+ ++--++   ..-.-+-+.|.+|++|+++|+|
T Consensus         2 s~~a~A~tidyRhey~~~s~~h~dRi~v~h~f~-nG~gfs~Eak~~~~~~~~~~d~~~~ng~E~~~~Y~ykl~~~~tl~P   80 (218)
T pfam06178         2 SVSAQAAYVDYRHEYNDASKAYEDRLRVSHRFA-NGFGFSLEAKTTDTYTNKPFSDLVANYNEIVISYNFKVTDKWAIQP   80 (218)
T ss_pred             EECCCCEEEEEHHCCCCCCCCCCEEEEEEEECC-CCEEEEEEEEECCCCCCCCCHHHCCCCEEEEEEEEEECCCCEEEEC
T ss_conf             001213079802400446546634899997637-7517999999615888876213205634899999766089869952


Q ss_pred             CEEEECCCCCCCCCEEEEEEEEEEEEECCCEE
Q ss_conf             52540456767852277877888885159127
Q gi|254780314|r  289 GGQYFGDINKTGKDGWSAGISAKYMISSGLEA  320 (351)
Q Consensus       289 G~QY~gd~~~sg~DaWk~GlTvDYqItegL~t  320 (351)
                      |...-..-.   +-..+..|.+-|+++++|..
T Consensus        81 G~~~~~~s~---~~~Y~Pylr~~y~~~~~~~~  109 (218)
T pfam06178        81 GFLIESGSD---GSTYKPYLRVQYKFTPDLNL  109 (218)
T ss_pred             CEEEEECCC---CCEEEEEEEEEEEECCCEEE
T ss_conf             228986589---84581068998997798489


No 4  
>PRK13528 outer membrane receptor FepA; Provisional
Probab=94.72  E-value=0.16  Score=29.42  Aligned_cols=56  Identities=11%  Similarity=0.286  Sum_probs=35.2

Q ss_pred             CCEEEEEEEEEEECEEEEECCCEEEECCCCCCCCCEEEEEEEEEEEEECCCEEEEEEE
Q ss_conf             2113664355631104786045254045676785227787788888515912778987
Q gi|254780314|r  268 SKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVA  325 (351)
Q Consensus       268 SEWaVAAeYaikaTDKl~ITPG~QY~gd~~~sg~DaWk~GlTvDYqItegL~tK~SVq  325 (351)
                      ..+++.++..++.+|+|++++|+.| ..+...+ +.|...+.+.|++.+.+..++++.
T Consensus       423 ~~~~~y~q~~~~~~~~l~l~~G~Ry-d~~~~~~-~~~sp~~~~~y~~~~~~~~~~~~~  478 (727)
T PRK13528        423 EISALYVEDNIEPVPGTNLIPGLRF-DYLSEFG-SNWSPSLNLSQELGDYFKVKAGIA  478 (727)
T ss_pred             EEEEEEEEEEEEECCCCCCCCCEEE-EECCCCC-CCCCCCCEEEEECCCCEEEEEEEE
T ss_conf             9999999999960577301353377-6123457-631664001674278889999888


No 5  
>COG3203 OmpC Outer membrane protein (porin) [Cell envelope biogenesis, outer membrane]
Probab=94.41  E-value=0.41  Score=26.81  Aligned_cols=224  Identities=19%  Similarity=0.202  Sum_probs=117.6

Q ss_pred             CEEEEEEEEEECCCCEEEEEEEEEEC--CCHHCCCCCCCCHHEEEEECCCCCCCHHHHEEEHHH-----EEECCEEE---
Q ss_conf             20001489970568613499999742--200000011121000121035555112520001100-----00012220---
Q gi|254780314|r   84 IPVKGNLEVNANAGDVTGVAKLKLAV--DDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKG-----ARLGYYKS---  153 (351)
Q Consensus        84 ~~~~g~~~~~a~~g~~tgv~~~~~~~--d~~~~~~~~~~d~~a~~~~~~Ss~l~ldeayLdi~G-----fRaG~FyS---  153 (351)
                      +-.||.-+++   +.++++-.+....  +..      |.++        ...+-.+.+|.-+++     ++.|-=|+   
T Consensus        59 ~GfkG~edlg---~gl~a~~~lE~~f~~~~g------~~~~--------~~~l~~R~afvGL~~~~~Gslt~GRq~~~~~  121 (354)
T COG3203          59 FGFKGETQIG---DGLTGYGQLESGFQANNG------ESNQ--------GGRLFTRLAFAGLKGADFGSLDYGRNYGVLY  121 (354)
T ss_pred             EEEEEEEECC---CCEEEEEEEEEEEECCCC------CCCC--------CCCCCCEEEEEECCCCCCEEEEECCCCCCCE
T ss_conf             9888888728---960799999974515877------5456--------8765332689860568711485433465414


Q ss_pred             ----ECCCCCCCCCCEE-EECCCCCCCCCCEEEEEE-ECCCEEEEEEHHHCCC--CCCC-CE-EEEEEEEEEEECCEEEE
Q ss_conf             ----0244445555102-311222444332268998-2575451033032146--6665-40-34788963454126899
Q gi|254780314|r  154 ----WSDEVNPVYSPTT-LYNDARGLDKMMSLSYRH-SFGLLKAGLSTDLLQK--DGLK-QV-LGIGYMASYAIGKIRST  223 (351)
Q Consensus       154 ----WWDEtddIgS~~T-L~Nd~rg~dk~~SirYqY-e~G~F~AGiSvDeLE~--dg~~-n~-VGV~g~vsg~aGavS~q  223 (351)
                          |-|-....+...+ .-+.......-++|+|+. +++.|..|++--+-|.  .+-. |+ .+......+..|.|...
T Consensus       122 Dv~~~~d~~~~~g~~~~~~~~~~~~~r~~n~v~Y~~~~f~Gl~~g~~y~f~~~~~~~~~~~g~~~~s~~~~y~~G~~~~~  201 (354)
T COG3203         122 DVAGWTDPLPEFGGDATLVDDNFMTGRADNVATYRNPDFGGLVDGLNYAFQYQGRPGKRKNGDFGYSATYDYGNGDFGLG  201 (354)
T ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCEEEEEEEEECCCCCHHHHCCCCCCEEEEEEECCCCEEHH
T ss_conf             35343356633477531034643456657558982775566888689984356632441278753358999546757120


Q ss_pred             EEEEEECC-------------CCCCEEEEEEEECCCCCCEEEEEEEEECCCCCCCCCC---------CEEEEEEEEEEEC
Q ss_conf             98522114-------------6651279888613678820246788733864000112---------1136643556311
Q gi|254780314|r  224 VTGGYDAG-------------TNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKS---------KYSVFAGYKFDVA  281 (351)
Q Consensus       224 ltGGyDtd-------------~eeGAIRAl~ta~iG~PGTlglAgVwASgpNaYY~~S---------EWaVAAeYaikaT  281 (351)
                      ..-.+.-.             ...-++.+=++.+++ +..  |++-|+-.-|.-....         .+.+.|+|.|...
T Consensus       202 aay~~~~~~~~~~~~~~~~~~~~~~~~~~G~~y~~g-~~~--l~a~Y~~~~~~~~~~~~~~~~~~~~~~~~~a~Y~~~~~  278 (354)
T COG3203         202 AAYDSSRRTNDQNSGLSNASGDKAEAWTVGAKYDAG-NAY--LAAGYAETRNATPTGAAPGFANKTQNIEVGAQYQFTFG  278 (354)
T ss_pred             HHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEEEECC-CEE--EEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCCC
T ss_conf             245565056554455456675310058666698327-011--32123345426654565433555540899999976877


Q ss_pred             EEEEECCCEEEE--CCCC--CCCCCEEEEEEEEEEEEECCCEEEEEEEECCC
Q ss_conf             047860452540--4567--67852277877888885159127789873274
Q gi|254780314|r  282 KSITISGGGQYF--GDIN--KTGKDGWSAGISAKYMISSGLEAQASVAFNDN  329 (351)
Q Consensus       282 DKl~ITPG~QY~--gd~~--~sg~DaWk~GlTvDYqItegL~tK~SVqY~D~  329 (351)
                      =++  .-..++.  .+..  ....+.+.+.+-++|....+..+-++..|...
T Consensus       279 l~~--~~~~~~~~~~~~~~~~~~~~~~~~~~ga~Y~fsKrt~~Yv~y~~~~~  328 (354)
T COG3203         279 LRL--SGAYYYSKGKDLNGVTDKDLVKYVDVGATYYFSKNTSTYVDYGINLL  328 (354)
T ss_pred             CEE--EEEEEEEECCCCCCCCCCCCCEEEEEEEEEEEECCEEEEEEEEEEEC
T ss_conf             215--78777530212235578876059995017998047248999888741


No 6  
>pfam09694 Gcw_chp Bacterial protein of unknown function (Gcw_chp). This entry represents a conserved hypothetical protein about 240 residues in length found so far in Proteobacteria including Shewanella oneidensis and Ralstonia solanacearum, usually as part of a paralogous family. The function is unknown.
Probab=93.85  E-value=0.54  Score=26.11  Aligned_cols=134  Identities=19%  Similarity=0.232  Sum_probs=65.5

Q ss_pred             EEEEECCEEEEEEEEEECCCCCCEEEEEEEECCCCCCEEEEEEEEECCCCCCC--CCCCEEEEEEEEEEECE-EEEECCC
Q ss_conf             63454126899985221146651279888613678820246788733864000--11211366435563110-4786045
Q gi|254780314|r  213 ASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYY--DKSKYSVFAGYKFDVAK-SITISGG  289 (351)
Q Consensus       213 vsg~aGavS~qltGGyDtd~eeGAIRAl~ta~iG~PGTlglAgVwASgpNaYY--~~SEWaVAAeYaikaTD-Kl~ITPG  289 (351)
                      +++-+|.+.|.-.|..+.+.++..--.-+...++ ++.+.+..-|+-.++.+-  .+..+-+...+.+...+ .+++.-.
T Consensus        80 ~~~dvg~~~Y~YPG~~~~~~~~~~n~~E~y~~l~-~~~~s~~~s~s~s~d~~G~~~~~s~Y~~~~~~~~l~~~~~tl~~h  158 (226)
T pfam09694        80 FTYDVGVLQYTYPGASNGGAPTDYNYGEAYAGLG-YKWISLKYAYAPTQDSFGFQSQGSGYLDLDAGVDLGLTGVTLNAH  158 (226)
T ss_pred             EEEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEE-ECCEEEEEEEEECCCCCCCCCCCCEEEEEEECEECCCCCEEEEEE
T ss_conf             0799889999978998777655667177999842-321789999984553355378875788614440328776699998


Q ss_pred             EEEECCCCC-CCC--CEEEEEEEEEEEEECCCEEEEEEEECCCCCCCCCCC-----CC-CCC-CCCCHHCCC
Q ss_conf             254045676-785--227787788888515912778987327421135423-----46-631-001101139
Q gi|254780314|r  290 GQYFGDINK-TGK--DGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAI-----DK-GVD-LSVGLKKSF  351 (351)
Q Consensus       290 ~QY~gd~~~-sg~--DaWk~GlTvDYqItegL~tK~SVqY~D~~~~~~~~~-----d~-g~d-~t~gl~~sf  351 (351)
                      +-|..-.+. ...  --|++|++.+.  ..+|  .+++.|.|--.++.-..     .+ +++ ...-|.|+|
T Consensus       159 ~G~q~~~~~~~~~~Y~Dw~vGvs~~~--~gg~--~~~laY~dTd~d~~~~~~~~~~~~~~d~~~v~SlSksF  226 (226)
T pfam09694       159 VGYQDVRNGFTAYSYTDWKIGLSKAL--DGGL--TLSAAYVDTDADVTAYTGNSGVVTLGDATFTVSLTKTF  226 (226)
T ss_pred             EEEEECCCCCCCCCEEEEEEEEEEEC--CCCE--EEEEEEEECCCCCCCEECCCCCCCCCCCEEEEEEEEEC
T ss_conf             56680137767787589999898984--7988--99999990458856200465564246887999998609


No 7  
>pfam03349 Toluene_X Outer membrane protein transport protein (OMPP1/FadL/TodX). This family includes TodX from Pseudomonas putida F1 and TbuX from Ralstonia pickettii PKO1. These are membrane proteins of uncertain function that are involved in toluene catabolism. Related proteins involved in the degradation of similar aromatic hydrocarbons are also in this family, such as CymD. This family also includes FadL involved in translocation of long-chain fatty acids across the outer membrane. It is also a receptor for the bacteriophage T2.
Probab=93.76  E-value=0.56  Score=26.02  Aligned_cols=31  Identities=13%  Similarity=0.276  Sum_probs=19.0

Q ss_pred             CCEEEEEEEEEEEEECCCEEEEEEEECCCCC
Q ss_conf             5227787788888515912778987327421
Q gi|254780314|r  301 KDGWSAGISAKYMISSGLEAQASVAFNDNFV  331 (351)
Q Consensus       301 ~DaWk~GlTvDYqItegL~tK~SVqY~D~~~  331 (351)
                      +|.|...+-+.||+++.|.-|+-+.|-..-+
T Consensus       311 ~d~~~~~~G~eY~~~~~l~LRaG~~yd~spv  341 (415)
T pfam03349       311 RDTTTYALGTDYQFNDRWTLRAGYAYDQSAT  341 (415)
T ss_pred             EEEEEEEEEEEEECCCCEEEEEEEEECCCCC
T ss_conf             1500898789998599869997476546787


No 8  
>PRK09980 ompL outer membrane porin L; Provisional
Probab=93.57  E-value=0.21  Score=28.68  Aligned_cols=52  Identities=19%  Similarity=0.353  Sum_probs=28.8

Q ss_pred             EEECEEEEECCCEEEECCCC----CCC-CCEEEEEEEEEEEEECCCEEEEEEEECCC
Q ss_conf             63110478604525404567----678-52277877888885159127789873274
Q gi|254780314|r  278 FDVAKSITISGGGQYFGDIN----KTG-KDGWSAGISAKYMISSGLEAQASVAFNDN  329 (351)
Q Consensus       278 ikaTDKl~ITPG~QY~gd~~----~sg-~DaWk~GlTvDYqItegL~tK~SVqY~D~  329 (351)
                      .++++++.++=-..||...+    ..| +..|.--.++.|+|...+..=+-++|+|-
T Consensus       154 y~~~~~~~~~~~~tY~~~vnd~~~~NgKk~~~E~n~~~~Yk~~~~w~PY~E~~~ld~  210 (230)
T PRK09980        154 FIITDKFSYTFEPHYFYNVNDFNSSNGTKHHWEITNTFRYRINEHWLPYFELRWLDR  210 (230)
T ss_pred             EEECCCEEEEEEEEEEEECCCCEECCCCCHHHHEEEEEEEECCCCCCCEEEEEECCC
T ss_conf             897574379973099985077073278640443102688842896243189874223


No 9  
>PRK13524 outer membrane receptor FepA; Provisional
Probab=93.11  E-value=0.3  Score=27.71  Aligned_cols=60  Identities=15%  Similarity=0.387  Sum_probs=40.3

Q ss_pred             CCCCCCCEEEEEEEEEEECEEEEECCCEEEECCCCCCCCCEEEEEEEEEEEEECCCEEEEEE
Q ss_conf             00011211366435563110478604525404567678522778778888851591277898
Q gi|254780314|r  263 SYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASV  324 (351)
Q Consensus       263 aYY~~SEWaVAAeYaikaTDKl~ITPG~QY~gd~~~sg~DaWk~GlTvDYqItegL~tK~SV  324 (351)
                      .+.....+++.++..++.+|+|.+++|+.| .++...+ +.|...+.+.|++.+.+.-++++
T Consensus       425 ~~~~~~~~~~f~q~~~~~~d~l~l~~G~Ry-d~~~~~g-~~~sp~l~~~~~~~~~~~l~~~~  484 (742)
T PRK13524        425 PYSKAEIFSLFAEDNMELTDSTMLTPGLRF-DHHSIVG-NNWSPSLNLSQGLGDDFTLKMGI  484 (742)
T ss_pred             CCCEEEEEEEEEEEEEEECCCEEEECCEEE-EEEECCC-CCCCCCCEEEEECCCCEEEEEEE
T ss_conf             653158999999989874476265022588-7320127-63266410155307887999988


No 10 
>pfam01389 OmpA_membrane OmpA-like transmembrane domain. The structure of OmpA transmembrane domain shows that it consists of an eight stranded beta barrel. This family includes some other distantly related outer membrane proteins with low scores.
Probab=92.30  E-value=0.91  Score=24.68  Aligned_cols=123  Identities=13%  Similarity=0.171  Sum_probs=68.1

Q ss_pred             EEEEEEEEEECCCCCCEEEEEEEECCCCCCEEEEEEEEECCCCCCCCCCCEEEEEEEEEEECEEEEE--CCCEEEEC-CC
Q ss_conf             6899985221146651279888613678820246788733864000112113664355631104786--04525404-56
Q gi|254780314|r  220 IRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITI--SGGGQYFG-DI  296 (351)
Q Consensus       220 vS~qltGGyDtd~eeGAIRAl~ta~iG~PGTlglAgVwASgpNaYY~~SEWaVAAeYaikaTDKl~I--TPG~QY~g-d~  296 (351)
                      +.+-+-+||++ |+.-||-+ +..++|.. ...     ....+.-+...-+++++-+.+.++|+|.+  .-|+-||. ++
T Consensus        35 ~~~glf~GYqf-n~~~a~E~-gY~~lG~~-~~~-----~~~~~~~~~~~~~~l~~k~~~pl~d~~~ly~K~G~a~~~~d~  106 (175)
T pfam01389        35 LTAGAFGGYQI-NNYLAAEL-GYDYLGRM-PYK-----GKGKNNAHKAQGVTLSLKLSYPLTDDLDVYGKVGGALVRADY  106 (175)
T ss_pred             CEEEEEEEEEC-CCEEEEEE-EEEECCCC-CCC-----CCCCCCCEEEEEEEEEEEEEEEECCCEEEEEEEEEEEEECCC
T ss_conf             17899986310-31122687-42431654-335-----534345404689999999888614856799971068996133


Q ss_pred             CC----------C-CCCEEEEEEEEEEEEECCCEEEEEEEECCCCCCCCCCC--CCCCCCCCCHHCC
Q ss_conf             76----------7-85227787788888515912778987327421135423--4663100110113
Q gi|254780314|r  297 NK----------T-GKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAI--DKGVDLSVGLKKS  350 (351)
Q Consensus       297 ~~----------s-g~DaWk~GlTvDYqItegL~tK~SVqY~D~~~~~~~~~--d~g~d~t~gl~~s  350 (351)
                      ..          + ..-.+..|+-+.|+|++++..|+.-||.+..-+.....  .|-+-.+.||.=.
T Consensus       107 ~~~~~~~~~~~~~d~~~~~~~G~G~eY~it~~~~~r~eYq~~~~~g~~~~~~~~~D~~~~slGlsYr  173 (175)
T pfam01389       107 KFYEDANGKTGNHDTGVSPLFALGVEYAVTPELAVRLEYQYLNNIGDLHKQGKRPDNGSASLGISYR  173 (175)
T ss_pred             CEECCCCCCCCCCCCCCCEEEEEEEEEEECCCCEEEEEEEEEHHCCCCCCCCCCCCCCEEEEEEEEE
T ss_conf             2102566642235677053888888998075827888899922258533567667777799999977


No 11 
>PRK10808 outer membrane protein A; Reviewed
Probab=91.23  E-value=1.2  Score=23.95  Aligned_cols=27  Identities=11%  Similarity=0.140  Sum_probs=16.0

Q ss_pred             EEEEEEEEEEEEECCCEEEEEEEECCC
Q ss_conf             277877888885159127789873274
Q gi|254780314|r  303 GWSAGISAKYMISSGLEAQASVAFNDN  329 (351)
Q Consensus       303 aWk~GlTvDYqItegL~tK~SVqY~D~  329 (351)
                      .|.+|+-+.|+|++++.+|+--||.++
T Consensus       145 s~~~g~GveY~lt~~~~~R~eYq~~~~  171 (347)
T PRK10808        145 SPVFAGGVEYAITPEWATRLEYQWTNN  171 (347)
T ss_pred             CCEEEEEEEEEECCCCEEEEEEEEEEE
T ss_conf             620672035880637268888999810


No 12 
>cd00342 gram_neg_porins Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane.  Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are  found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.
Probab=90.17  E-value=1.5  Score=23.36  Aligned_cols=187  Identities=20%  Similarity=0.219  Sum_probs=100.1

Q ss_pred             CCHHHHEEEHHH-----EEECCEEEE----CCCCCCCCCCE-----EEECCCCCC-CCCCEEEEEE-ECCCEEEEEEHHH
Q ss_conf             112520001100-----000122200----24444555510-----231122244-4332268998-2575451033032
Q gi|254780314|r  134 LSVEELSLSMKG-----ARLGYYKSW----SDEVNPVYSPT-----TLYNDARGL-DKMMSLSYRH-SFGLLKAGLSTDL  197 (351)
Q Consensus       134 l~ldeayLdi~G-----fRaG~FySW----WDEtddIgS~~-----TL~Nd~rg~-dk~~SirYqY-e~G~F~AGiSvDe  197 (351)
                      +--+++|+-|+|     +|+|-.++-    +..+|+.....     ...+...+. --=++|+|+. .++.|+++++.-.
T Consensus        72 ~~~R~~~VGL~~~~~G~v~~Gr~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~R~~N~i~Y~sp~~~Gf~~~a~y~~  151 (329)
T cd00342          72 LFGRQAYVGLSSDTYGTLTLGRQYTPLYDVLGTTDPFGGSGGGSAPGDGDNLAGTGRANNSVKYTSPFFGGLTFGAMYAF  151 (329)
T ss_pred             CCCCEEEEEECCCCCEEEEEEECCCHHHHEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCEEEEEEEEC
T ss_conf             52536899862588308998603777764114325553355442301246645670660289997676577899999953


Q ss_pred             CCCCCC-CCEEEEEEEEEEEECCEEEEEEEEEECCCC-------------CCEEEEEEEECCCCCCEEEEEEEEECCC--
Q ss_conf             146666-540347889634541268999852211466-------------5127988861367882024678873386--
Q gi|254780314|r  198 LQKDGL-KQVLGIGYMASYAIGKIRSTVTGGYDAGTN-------------NVAIRANISSPVSRAGTLDCGAVWASGD--  261 (351)
Q Consensus       198 LE~dg~-~n~VGV~g~vsg~aGavS~qltGGyDtd~e-------------eGAIRAl~ta~iG~PGTlglAgVwASgp--  261 (351)
                      =|.++. .++-+.+..+.++.|++  .+..+|+-...             .-..++-+.-+++   .+-+++.|....  
T Consensus       152 g~~~~~~~~~~~~~~~~~Y~~g~~--~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~ga~Y~~g---~~~l~~~Y~~~~~~  226 (329)
T cd00342         152 GNQAGSTSNGRGYGAGLSYENGPL--SLGAAYDQQRNGGGAAGGAAGATSQRAYGAGASYDFG---GLKLGAGYTNTRND  226 (329)
T ss_pred             CCCCCCCCCCCEEEEEEEEECCCE--EEEEEEEEEECCCCCCCCCCCCCCEEEEEEEEEEEEC---CEEEEEEEEEEECC
T ss_conf             667787777857999999952999--9999999850676444566776514899999999968---99999999998835


Q ss_pred             C----CCCCCCCEEEEEEEEEEECEEEEECCCEEEECC--C--CCCCCCEEEEEEEEEEEEECCCEEEEEEEECCC
Q ss_conf             4----000112113664355631104786045254045--6--767852277877888885159127789873274
Q gi|254780314|r  262 N----SYYDKSKYSVFAGYKFDVAKSITISGGGQYFGD--I--NKTGKDGWSAGISAKYMISSGLEAQASVAFNDN  329 (351)
Q Consensus       262 N----aYY~~SEWaVAAeYaikaTDKl~ITPG~QY~gd--~--~~sg~DaWk~GlTvDYqItegL~tK~SVqY~D~  329 (351)
                      +    .-....-|.+.|.|.+..  .  +++.++|.-.  -  ...+.+++...|-+||.+......-+...|.++
T Consensus       227 ~~~~~~~~~~~~~~~ga~y~~~~--~--~~~~~~y~~~~~~~~~~~~~~~~~~~lG~~Y~lSKrT~lY~~~~~~~n  298 (329)
T cd00342         227 NGGGGGSAKFNGYELGATYQLTP--A--LRLGAAYYYTKDRNDGGGDGKANQVALGADYALSKRTDLYAEYGYQKN  298 (329)
T ss_pred             CCCCCCCEEEEEEEEEEEEECCC--C--EEEEEEEEEEECCCCCCCCCCEEEEEEEEEEEECCCHHHHHHHHHEEC
T ss_conf             77778750268999999998078--7--389999999944567688897189999999971554898665054110


No 13 
>pfam12094 DUF3570 Protein of unknown function (DUF3570). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 396 to 444 amino acids in length.
Probab=89.57  E-value=1.7  Score=23.06  Aligned_cols=81  Identities=15%  Similarity=0.228  Sum_probs=58.3

Q ss_pred             EEEEEEEECCCCC-------CCCC----CCEEEEEEEEEEECEEEEECCCEEEEC--------CC---------------
Q ss_conf             2467887338640-------0011----211366435563110478604525404--------56---------------
Q gi|254780314|r  251 LDCGAVWASGDNS-------YYDK----SKYSVFAGYKFDVAKSITISGGGQYFG--------DI---------------  296 (351)
Q Consensus       251 lglAgVwASgpNa-------YY~~----SEWaVAAeYaikaTDKl~ITPG~QY~g--------d~---------------  296 (351)
                      +.+-..|.-++++       ||.+    .--++-++|.++.+++++|+|...||-        .+               
T Consensus       265 ~~~r~~~~l~~~~~l~~~YRyy~DdWgi~sHT~~~~~~~~l~~~~~l~p~~RyY~Q~~AdFy~~~~~~~~~~~~~~ssDy  344 (407)
T pfam12094       265 VYLRAKYYLPDRAALRFSYRYYSDDWGITSHTLEAEYRQPLGDRWYLEPHYRYYTQTAADFYRPYLLHESPLPEFYSSDY  344 (407)
T ss_pred             HHHHEEEECCCCCEEEEEEEEEECCCCCCEEEEEEEEEEECCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             01022020587725678778884677751068616999953898799888998956751003443436787632222343


Q ss_pred             CCCCCCEEEEEEEEEEEEECCCEEEEEEEECCCCC
Q ss_conf             76785227787788888515912778987327421
Q gi|254780314|r  297 NKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFV  331 (351)
Q Consensus       297 ~~sg~DaWk~GlTvDYqItegL~tK~SVqY~D~~~  331 (351)
                      .-+.=.+...||.+.+++..++.--+...|++.+-
T Consensus       345 rLs~f~a~t~Gl~~~~~l~~~~~~~~~~~~Y~~~~  379 (407)
T pfam12094       345 RLSAFGAYTIGLKFGKKLSGGLEIDLRYEYYQQNP  379 (407)
T ss_pred             CHHCCCCEEEEEEEEEEECCCCEEEEEEEEEECCC
T ss_conf             40027664883679999379948985411143078


No 14 
>PRK13484 putative iron-regulated outer membrane virulence protein; Provisional
Probab=87.31  E-value=2.1  Score=22.46  Aligned_cols=12  Identities=33%  Similarity=0.481  Sum_probs=4.9

Q ss_pred             CCEEEEECCEEE
Q ss_conf             212343022001
Q gi|254780314|r   21 ESFAYVRGKTSM   32 (351)
Q Consensus        21 ~~~~~~~~~~~~   32 (351)
                      |...-+||-.|.
T Consensus       132 erIEVlrGp~S~  143 (682)
T PRK13484        132 ERIEVIRGPMSS  143 (682)
T ss_pred             EEEEEEECCCHH
T ss_conf             499999688010


No 15 
>COG2067 FadL Long-chain fatty acid transport protein [Lipid metabolism]
Probab=84.87  E-value=3.1  Score=21.38  Aligned_cols=125  Identities=13%  Similarity=0.244  Sum_probs=62.8

Q ss_pred             CEEEEEEEEEEEECCEEEEEEEEEECCCCCCE----E------EEE---EEECCCCCCEEEEEEEEECCCCCCCCCCCEE
Q ss_conf             40347889634541268999852211466512----7------988---8613678820246788733864000112113
Q gi|254780314|r  205 QVLGIGYMASYAIGKIRSTVTGGYDAGTNNVA----I------RAN---ISSPVSRAGTLDCGAVWASGDNSYYDKSKYS  271 (351)
Q Consensus       205 n~VGV~g~vsg~aGavS~qltGGyDtd~eeGA----I------RAl---~ta~iG~PGTlglAgVwASgpNaYY~~SEWa  271 (351)
                      +.+|..+.-     .|..++.++|......+.    |      +-.   +...+--|-.+.+.+.+.-.       -.|+
T Consensus       234 ~r~g~~YrS-----~V~~~~~g~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~l~lP~~~el~~~~~~~-------d~w~  301 (440)
T COG2067         234 NRIGLSYRS-----KVKMDFKGGYESSLNLGMAGLPIGPLALGGVTPGSGKLTLSLPASAELSGQHKVA-------DQWA  301 (440)
T ss_pred             EEEEEEEEE-----EEEEECCCCCCCCCCCCCCCCCCCCCCCCCEECCCCEEEEECCCEEEEEEEECCC-------CCEE
T ss_conf             057789730-----5567425773210255444444432244743023434777058579972264038-------8707


Q ss_pred             EEEEEEEEE---CEEEEECCC---EEEECCCCCCCCCEEEEEEEEEEEEECCCEEEEEEEECCCCCCCCC---CCCCCCC
Q ss_conf             664355631---104786045---2540456767852277877888885159127789873274211354---2346631
Q gi|254780314|r  272 VFAGYKFDV---AKSITISGG---GQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGV---AIDKGVD  342 (351)
Q Consensus       272 VAAeYaika---TDKl~ITPG---~QY~gd~~~sg~DaWk~GlTvDYqItegL~tK~SVqY~D~~~~~~~---~~d~g~d  342 (351)
                      +..+++---   =+||++++-   .++-+..+ .=||.|+..+.+.||..|-|.-|+++.|-.-..+..-   .|-++|-
T Consensus       302 ~~~s~~wT~WS~f~~l~~~~~~~~~~~~~~~~-~yrD~wt~a~G~~Y~~nd~~tlragiayD~s~s~~~~~~~~iPd~Dr  380 (440)
T COG2067         302 IHGSVKWTDWSSFDKLDFVFTFGKTLFAKTED-GYRDTWTVALGTTYKFNDQWTLRAGIAYDQSPSPAQNRSISIPDTDR  380 (440)
T ss_pred             EEEEEEEEECCCCCEEEEEECCCCCCCCCCCC-CCCCCCEEEEECEEECCCCCEEEEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             99889986516774488897688752246533-41043179400106738663375003345788854455432478775


No 16 
>PRK13513 putative outer membrane receptor; Provisional
Probab=84.46  E-value=3.2  Score=21.26  Aligned_cols=22  Identities=9%  Similarity=0.200  Sum_probs=8.4

Q ss_pred             EEEEEEEECCCEEEEEEEECCC
Q ss_conf             7888885159127789873274
Q gi|254780314|r  308 ISAKYMISSGLEAQASVAFNDN  329 (351)
Q Consensus       308 lTvDYqItegL~tK~SVqY~D~  329 (351)
                      +.+.|+|+++|...++..|+|.
T Consensus       528 ~~~~~~~~~~~~l~~~yty~~~  549 (660)
T PRK13513        528 ATFAWDINQAWSLATNYTFTQS  549 (660)
T ss_pred             EEEEEEECCCEEEEEEEEEEEE
T ss_conf             9999985599899999999942


No 17 
>PRK09840 catecholate siderophore receptor Fiu; Provisional
Probab=82.69  E-value=3.8  Score=20.81  Aligned_cols=73  Identities=16%  Similarity=0.311  Sum_probs=40.5

Q ss_pred             EEEECCEEEEEEEEEECCCCCCEEEEEEEECCCCCCEEEEEEEEE------------CCCCCCCCCCCEEEEEEEEEEEC
Q ss_conf             345412689998522114665127988861367882024678873------------38640001121136643556311
Q gi|254780314|r  214 SYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWA------------SGDNSYYDKSKYSVFAGYKFDVA  281 (351)
Q Consensus       214 sg~aGavS~qltGGyDtd~eeGAIRAl~ta~iG~PGTlglAgVwA------------SgpNaYY~~SEWaVAAeYaikaT  281 (351)
                      ....|.+..++..|++...++-.-..     +. +-++..+.+|.            .+.++-.....|+++++-.++.+
T Consensus       384 ~~~~g~~~~~~~~G~~~~~~~~~~~~-----~~-~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~a~y~~~~~~lt  457 (760)
T PRK09840        384 TFYTGSIGHDVSTGVEFTRETQTNYG-----VN-PVTLPAVNLYHPDSSIHPGGLTRNGANANGQTDTFAIYAFDTLQLT  457 (760)
T ss_pred             EEECCCEEEEEEEEEEEEEEEEECCC-----CC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEEEEEC
T ss_conf             98616503699998999831122222-----03-3214522102787666666536666554441567888999888505


Q ss_pred             EEEEECCCEEE
Q ss_conf             04786045254
Q gi|254780314|r  282 KSITISGGGQY  292 (351)
Q Consensus       282 DKl~ITPG~QY  292 (351)
                      |+|+++.|+.|
T Consensus       458 d~l~l~~G~R~  468 (760)
T PRK09840        458 RDFELNGGIRL  468 (760)
T ss_pred             CCEEEEEEEEE
T ss_conf             75799998888


No 18 
>COG3713 OmpV Outer membrane protein V [Cell envelope biogenesis, outer membrane]
Probab=82.12  E-value=4  Score=20.68  Aligned_cols=84  Identities=20%  Similarity=0.273  Sum_probs=57.1

Q ss_pred             EECCCCCCEEEEEEEECCCCCCEEEEEEEEECCCCCCCCCCCEEEEEEEEEEECEEEEECCC--EEEEC-CCC-------
Q ss_conf             21146651279888613678820246788733864000112113664355631104786045--25404-567-------
Q gi|254780314|r  228 YDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGG--GQYFG-DIN-------  297 (351)
Q Consensus       228 yDtd~eeGAIRAl~ta~iG~PGTlglAgVwASgpNaYY~~SEWaVAAeYaikaTDKl~ITPG--~QY~g-d~~-------  297 (351)
                      ++...+.+-||+....+++     +--+.+..            +.+.|.+-.+++|.||||  ++|.. +|+       
T Consensus       124 ~~~~~~~~~~~~~~~~~i~-----~~~~~~~~------------~~~~~~~~~~~~~~ispg~g~s~~s~~Y~~yYfGVs  186 (258)
T COG3713         124 AAYLTDWLRIRAETAADIL-----DNSGGLVT------------DLLAYPRMLIGRLSLSPGPGVSWASSKYNDYYFGVS  186 (258)
T ss_pred             EEEECCCEEEEEEECHHHH-----CCCCCEEE------------EEEEEEEECCCCEEECCCCCEEEECCCCCCEEECCC
T ss_conf             7786131699742100123-----05883685------------335899830597898547732771223342020528


Q ss_pred             ------------CCCCCEEEE--EEEEEEEEECCCEEEEEEEECC
Q ss_conf             ------------678522778--7788888515912778987327
Q gi|254780314|r  298 ------------KTGKDGWSA--GISAKYMISSGLEAQASVAFND  328 (351)
Q Consensus       298 ------------~sg~DaWk~--GlTvDYqItegL~tK~SVqY~D  328 (351)
                                  .-+.+.|.+  ++.+.|+|+++.....++.|.-
T Consensus       187 ~~esa~Sgl~~Y~p~~g~~s~~l~ls~~y~~t~~w~~~~~~~~~R  231 (258)
T COG3713         187 AAESARSGLASYNPGGGAKSPGLGLSATYMITDHWSVGGTAGYSR  231 (258)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCCCEEEEEEEECCCEEEEEEEEEEE
T ss_conf             899730477740799884346723799997068779998887131


No 19 
>PRK10064 colicin I receptor; Provisional
Probab=81.44  E-value=4.2  Score=20.53  Aligned_cols=57  Identities=14%  Similarity=0.278  Sum_probs=26.9

Q ss_pred             CCCCCEEEEEEEEEEECEEEEECCCEEEECCCCCCCCCEEEEEEEEEEEEECCCEEEEE
Q ss_conf             01121136643556311047860452540456767852277877888885159127789
Q gi|254780314|r  265 YDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQAS  323 (351)
Q Consensus       265 Y~~SEWaVAAeYaikaTDKl~ITPG~QY~gd~~~sg~DaWk~GlTvDYqItegL~tK~S  323 (351)
                      .+...+++.++..++.+|+|++++|+.|=. .. .-.+.|..-+.+-|++++.+..+++
T Consensus       357 ~~~~~~a~f~q~~~~~~~~l~l~~G~R~d~-~~-~~~~~~sp~~~l~y~~~~~~~l~~~  413 (663)
T PRK10064        357 TSASQYALFVEDEWRIFEPLALTTGVRMDD-HE-TYGEHWSPRAYLVYNATDTVTVKGG  413 (663)
T ss_pred             CEEEEEEEEEEEEEEECCCEEEECCEEEEC-CC-CCCCCCCCCEEEEECCCCCEEEEEE
T ss_conf             217899999986888617638632347650-10-3576446422357506878799985


No 20 
>PRK13486 bifunctional enterobactin receptor/adhesin protein; Provisional
Probab=80.39  E-value=4.6  Score=20.31  Aligned_cols=58  Identities=16%  Similarity=0.339  Sum_probs=30.3

Q ss_pred             CCCCEEEEEEEEEEECEEEEECCCEEEECCCCCCCCCEEEEEEEEEEEEECCCEEEEEEE
Q ss_conf             112113664355631104786045254045676785227787788888515912778987
Q gi|254780314|r  266 DKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVA  325 (351)
Q Consensus       266 ~~SEWaVAAeYaikaTDKl~ITPG~QY~gd~~~sg~DaWk~GlTvDYqItegL~tK~SVq  325 (351)
                      ....|++.++..+..+|+|.+++|+.|=- +...+ ..|...+.+-|++++.+..++++.
T Consensus       381 ~~~~~~~y~q~~~~~~d~l~l~~G~Ryd~-~~~~~-~~~sp~~~~~y~~~~~~~l~~s~~  438 (696)
T PRK13486        381 RQKSWSVFAEDEWHLTDALALTAGSRYEH-HEQFG-GHFSPRAYLVWDVADAWTLKGGVT  438 (696)
T ss_pred             CCCEEEEEEEEEEEECCCEEEEEEEEEEE-ECCCC-CEECCCEEEEEECCHHHEEEEEEE
T ss_conf             00105899998898537538964334551-10347-621663023786583126874000


No 21 
>COG4772 FecA Outer membrane receptor for Fe3+-dicitrate [Inorganic ion transport and metabolism]
Probab=78.08  E-value=5.4  Score=19.86  Aligned_cols=120  Identities=14%  Similarity=0.186  Sum_probs=68.7

Q ss_pred             EEEEEEE--EEEECCEEEEEEEEEECCCCCCEEEEEEEECCCCCCE---EEEEEEEECCCCCCCCCCCEEEEEEEEEEEC
Q ss_conf             3478896--3454126899985221146651279888613678820---2467887338640001121136643556311
Q gi|254780314|r  207 LGIGYMA--SYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGT---LDCGAVWASGDNSYYDKSKYSVFAGYKFDVA  281 (351)
Q Consensus       207 VGV~g~v--sg~aGavS~qltGGyDtd~eeGAIRAl~ta~iG~PGT---lglAgVwASgpNaYY~~SEWaVAAeYaikaT  281 (351)
                      -|++-.+  -.-.|+++-.+--|+-.-+|+--.|..-+.-.-.-+|   =.-++... +-+--++ --||+.++=+|.+-
T Consensus       366 ~g~Eprl~~if~tg~~~qe~~~G~Ry~~e~~~~~q~~~~~~~~~~~~~ps~~s~~~~-~~~~~~~-eatA~y~sD~Ie~g  443 (753)
T COG4772         366 NGFEPRLNLIFNTGKVKQEFEMGARYLTEDMNRRQYQSTTEKANPTILPSVGSGGDQ-DNRLNFN-EATAVYLSDKIEAG  443 (753)
T ss_pred             HCCCCEEEEEEECCCEEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC-CCCCCCC-EEEEEEEEEEEEEC
T ss_conf             234522678885154016884103455677888765044433674114788888776-5545675-05899984278736


Q ss_pred             EEEEECCCEEEEC-CCCCCC-----------------CCEEEEEEEEEEEEECCCEEEEEEEECCCCC
Q ss_conf             0478604525404-567678-----------------5227787788888515912778987327421
Q gi|254780314|r  282 KSITISGGGQYFG-DINKTG-----------------KDGWSAGISAKYMISSGLEAQASVAFNDNFV  331 (351)
Q Consensus       282 DKl~ITPG~QY~g-d~~~sg-----------------~DaWk~GlTvDYqItegL~tK~SVqY~D~~~  331 (351)
                      + |+||||..|=- |++..+                 -+.|--+|.+-|..+++...  -.+|+--|.
T Consensus       444 ~-~TItPGLRye~Iny~~~n~~~~~~~~~~~t~k~~~~n~~~PaLnv~y~~~~~~~l--yan~~rsF~  508 (753)
T COG4772         444 N-LTITPGLRYEFINYDQKNAPSAPGRPLPGTTKERDYNEWIPALNVGYHPTDEWLL--YANYHRSFA  508 (753)
T ss_pred             C-EEECCCCEEEEECCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCEEEEECCCEEE--EEEECCCCC
T ss_conf             5-2774660578730233566534677677844520125647542015433453699--864215658


No 22 
>pfam00267 Porin_1 Gram-negative porin.
Probab=73.60  E-value=7.1  Score=19.12  Aligned_cols=108  Identities=19%  Similarity=0.222  Sum_probs=62.5

Q ss_pred             EEEEEEECCCCCCEEEEEEEEECCCCCC--------CCCCCEEEEEEEEEEECEEEEECCCEEEEC----CCCCC--CCC
Q ss_conf             7988861367882024678873386400--------011211366435563110478604525404----56767--852
Q gi|254780314|r  237 IRANISSPVSRAGTLDCGAVWASGDNSY--------YDKSKYSVFAGYKFDVAKSITISGGGQYFG----DINKT--GKD  302 (351)
Q Consensus       237 IRAl~ta~iG~PGTlglAgVwASgpNaY--------Y~~SEWaVAAeYaikaTDKl~ITPG~QY~g----d~~~s--g~D  302 (351)
                      +|+-+.-+.+   -|-+|+.|+-.-+..        -....|-++++|++..    .++|.+.|--    +.+..  ..+
T Consensus       210 ~~~ga~Y~~~---~l~la~~Y~~~~~~~~~~~~~~~~~~~~~e~~~~Y~~~~----g~~~~~~Y~~~~~~~~~~~~~~~~  282 (334)
T pfam00267       210 WRLGGKYDAN---NVYLAVAYAQTRNATPYGDVGFANKNQNFEVAAQYQFDF----GLRPRVSYAQSKGKDLNGAYGDND  282 (334)
T ss_pred             EEEEEEEEEC---CEEEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEEEECC----CCCEEEEEEEEECCCCCCCCCCCC
T ss_conf             9999999805---489999986542010137643344404699999997424----631699999874222356557764


Q ss_pred             -EEEEEEEEEEEEECCCEEEEEEEECCC--CCCCCCCCCCCCCCCCCHHCCC
Q ss_conf             -277877888885159127789873274--2113542346631001101139
Q gi|254780314|r  303 -GWSAGISAKYMISSGLEAQASVAFNDN--FVKKGVAIDKGVDLSVGLKKSF  351 (351)
Q Consensus       303 -aWk~GlTvDYqItegL~tK~SVqY~D~--~~~~~~~~d~g~d~t~gl~~sf  351 (351)
                       ...+-|.+||.+...+.+=++-+++..  --.+...++.-+-+++||+-.|
T Consensus       283 ~~~q~~lg~dY~fSKrt~~Y~~Y~~~~~d~~~~~~~~~~~dd~~~vGlRY~F  334 (334)
T pfam00267       283 LVKYVDVGATYYFNKNMSAYVDYKINLLDKGDDFAAGINTDDAVAVGLVYQF  334 (334)
T ss_pred             EEEEEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEEEC
T ss_conf             5899999989996588049999987625666544467776888999808819


No 23 
>TIGR03509 OMP_MtrB_PioB decaheme-associated outer membrane protein, MtrB/PioB family. Members of this protein family are integral proteins of the bacterial outer membrane, associated with multiheme c-type cytochromes involved in electron transfer. The MtrB protein of Shewanella oneidensis MR-1 (SO1776) has been shown to form a complex with 1:1:1 stochiometry with the small, periplasmic decaheme cytochrome MtrA and large, surface-exposed decaheme cytochrome MtrC.
Probab=70.54  E-value=8.3  Score=18.69  Aligned_cols=240  Identities=18%  Similarity=0.238  Sum_probs=116.9

Q ss_pred             CCCCCCCCCCCEEEEEEEEEECCCCEEEEEEEEEECCCH-----HCCCCCCCCHHEEEEECCCCCCCHHHHEEEHHHEEE
Q ss_conf             776554333420001489970568613499999742200-----000011121000121035555112520001100000
Q gi|254780314|r   74 NNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDV-----LSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARL  148 (351)
Q Consensus        74 ~~e~n~~~~d~~~~g~~~~~a~~g~~tgv~~~~~~~d~~-----~~~~~~~~d~~a~~~~~~Ss~l~ldeayLdi~GfRa  148 (351)
                      .|+.+++.|+-|.-+..  +   .+.+|  .|-++.||-     ++.|+.-.... +..++--+...-||+++.......
T Consensus       211 ~N~~~~l~~~npf~~~~--g---~~~~~--~~a~~PdNqahq~slsg~y~l~~~~-~sg~l~~g~mtQde~f~~~t~~~~  282 (649)
T TIGR03509       211 RNDIAALTWQNPYNGAF--G---AAYTN--RYALAPDNQAHQLAVSGGYNLGGTT-VAGRLLYGQMTQNEAFAPFTYNPA  282 (649)
T ss_pred             ECCCCEEEECCCCCCCC--C---CCCCC--CCCCCCCCHHEEEEEEEEEECCCCE-EEEEEEEEEEEECCCCCCCCCCCC
T ss_conf             76765366336766776--6---54456--1543898613079998687148868-987998766871534443444658


Q ss_pred             -CCEEEECC-CCCCCCCCEEEECCCCCCCCCCEEEEEEECC------CEEEEEEHHHCCC------CCCCCE--EEEEEE
Q ss_conf             -12220024-4445555102311222444332268998257------5451033032146------666540--347889
Q gi|254780314|r  149 -GYYKSWSD-EVNPVYSPTTLYNDARGLDKMMSLSYRHSFG------LLKAGLSTDLLQK------DGLKQV--LGIGYM  212 (351)
Q Consensus       149 -G~FySWWD-EtddIgS~~TL~Nd~rg~dk~~SirYqYe~G------~F~AGiSvDeLE~------dg~~n~--VGV~g~  212 (351)
                       ++=-+=|| |+|-+..-..+.+-+. -+---+.+|.|.--      --+.++++|..-.      |-+++.  +...+.
T Consensus       283 ~~~p~~sldG~VdTl~~~lk~tsr~~-~~l~l~a~ydY~DRDNkT~~~~~~~~~~~~~~~~~N~~~d~tk~~~~l~a~YR  361 (649)
T TIGR03509       283 SPLPADSLDGEVNTLNANLKITSRPS-PDLRLTAAYDYSDRDNQTPVYNVAGSGATNVNTATNRPYDKTKQKAELAADYR  361 (649)
T ss_pred             CCCCCCCCCCEEEEEECCEEEECCCC-CCEEEEEEEEEECCCCCCCCEEECCCCCCCCCCEECCCCCCCCEECCEEEEEE
T ss_conf             88874366738896213237863186-77079887876515688765461211014543312266550000320333487


Q ss_pred             EEEEECCEEEEEEEEEECC-----------CCCCEEEEEEEECCCCCCEEEEEEEEECCCCCCCCCCCEEEEE-------
Q ss_conf             6345412689998522114-----------6651279888613678820246788733864000112113664-------
Q gi|254780314|r  213 ASYAIGKIRSTVTGGYDAG-----------TNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFA-------  274 (351)
Q Consensus       213 vsg~aGavS~qltGGyDtd-----------~eeGAIRAl~ta~iG~PGTlglAgVwASgpNaYY~~SEWaVAA-------  274 (351)
                      +     .-++.|.+|||-+           ++|-.+++-.-.-+-..-.|.+.+-|+.-.-+=|..++|+-..       
T Consensus       362 ~-----~~~~~l~~gy~~~~~dRs~~dre~T~E~~~~ak~~~r~~~~~~l~~k~~y~~R~gs~Y~~~~~ts~~~n~~lRk  436 (649)
T TIGR03509       362 F-----TRSVKLTAGYDYKNDDRSYQDRQETDESTVWAKLRYRLNPGLSLNLKGSYSNRDGSNYEANRSTSSTGNPLLRK  436 (649)
T ss_pred             E-----CCCCEEECCEEEEECCCCCCCCCCCCCCEEEEEEEEEECCCEEEEEEEEEECCCCCCCCCCCCCCCCCCHHHHC
T ss_conf             5-----46727761120775222201135532114899999876566468876887346776546763426789877831


Q ss_pred             -----------E--EEEEECEEEEECCCEEEEC-CC-----CCCCCCEEEEEEEEEEEEECCCEEEEEEEEC
Q ss_conf             -----------3--5563110478604525404-56-----7678522778778888851591277898732
Q gi|254780314|r  275 -----------G--YKFDVAKSITISGGGQYFG-DI-----NKTGKDGWSAGISAKYMISSGLEAQASVAFN  327 (351)
Q Consensus       275 -----------e--YaikaTDKl~ITPG~QY~g-d~-----~~sg~DaWk~GlTvDYqItegL~tK~SVqY~  327 (351)
                                 +  --+..+++|.|.+.++|-. ||     +-+..+-|..+|.+.|++.++|..-+...+.
T Consensus       437 y~LADR~R~~~~~~~~~~p~~~l~l~~~~~ya~DDY~dt~iGLtes~~~~ydl~~sy~~~~~ls~~Af~~~q  508 (649)
T TIGR03509       437 FYLADRERDKLKAFADYQPTEGLTLGATARYAKDDYPDTLIGLTESTDYGYDLDASYTFTDGLSLHAFYNQQ  508 (649)
T ss_pred             CCHHHCCHHEEEEECCCCCCCCEEEEEEEEECCCCCCCCCCCCEECCEEEEEEEEEEEECCCEEEEEEEEEE
T ss_conf             232214403006754103432578835788734788776565131434216555889967981899988888


No 24 
>PRK13483 enterobactin receptor protein; Provisional
Probab=66.07  E-value=10  Score=18.12  Aligned_cols=24  Identities=25%  Similarity=0.602  Sum_probs=9.7

Q ss_pred             CEEEEEEEEEEECEEEEECCCEEE
Q ss_conf             113664355631104786045254
Q gi|254780314|r  269 KYSVFAGYKFDVAKSITISGGGQY  292 (351)
Q Consensus       269 EWaVAAeYaikaTDKl~ITPG~QY  292 (351)
                      .|+++++-.++.+|+|++++|+.|
T Consensus       374 ~~a~f~q~~~~~~~~~~l~~G~R~  397 (663)
T PRK13483        374 QWSVFSEDEWRIADNFALTGGLRL  397 (663)
T ss_pred             EEEEEEEEEEECCCCEEEEECEEE
T ss_conf             789999706621476168401166


No 25 
>pfam11854 DUF3374 Protein of unknown function (DUF3374). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 665 to 712 amino acids in length.
Probab=51.95  E-value=18  Score=16.60  Aligned_cols=45  Identities=16%  Similarity=0.197  Sum_probs=24.0

Q ss_pred             CEEEEECCCEEEEC-CC-----CCCCCCEEEEEEEEEEEEECCCEEEEEEE
Q ss_conf             10478604525404-56-----76785227787788888515912778987
Q gi|254780314|r  281 AKSITISGGGQYFG-DI-----NKTGKDGWSAGISAKYMISSGLEAQASVA  325 (351)
Q Consensus       281 TDKl~ITPG~QY~g-d~-----~~sg~DaWk~GlTvDYqItegL~tK~SVq  325 (351)
                      +++|.|...++|-- ||     +-+..+-|..+|.+.|+|.++|.--+..+
T Consensus       483 ~~~lsl~~~~~ya~DDY~~t~iGLtes~~~gydv~~~y~~~~~ls~~af~~  533 (675)
T pfam11854       483 LDWLSLDFSARYALDDYSDTEIGLTESKDYGYDVDASYQFNDDLSLNAFYN  533 (675)
T ss_pred             CCCEEEEEEEEECCCCCCCCCCCCEECCEEEEEEEEEEEECCCEEEEEEEE
T ss_conf             545678478898136877765552304145586557789648669999876


No 26 
>pfam06980 DUF1302 Protein of unknown function (DUF1302). This family contains a number of hypothetical bacterial proteins of unknown function that are approximately 600 residues long. Most family members seem to be from Pseudomonas.
Probab=48.56  E-value=20  Score=16.27  Aligned_cols=127  Identities=20%  Similarity=0.254  Sum_probs=70.1

Q ss_pred             EEEEEEEEECCCCCCEEEEEEEECCC----------------CCCEEEEEEEEECCCCCCCCCCCEEEEEEEEE---EEC
Q ss_conf             89998522114665127988861367----------------88202467887338640001121136643556---311
Q gi|254780314|r  221 RSTVTGGYDAGTNNVAIRANISSPVS----------------RAGTLDCGAVWASGDNSYYDKSKYSVFAGYKF---DVA  281 (351)
Q Consensus       221 S~qltGGyDtd~eeGAIRAl~ta~iG----------------~PGTlglAgVwASgpNaYY~~SEWaVAAeYai---kaT  281 (351)
                      ..|+++-+-....-||=++.+.+|++                |+++++.+.--....+.+-.+.-|........   ++-
T Consensus       397 q~ql~~i~~~~~~~gad~~tl~~Ev~~~~v~~l~~~~~~~~gr~~~~g~~~~~~~~~~g~~T~~s~Gyr~~~~~~Y~nvf  476 (553)
T pfam06980       397 QAQLTAIYSFGPTLGADRLTLLAEVGYVHVPGLPSGNELRYGRPGTYGGALSNGCANDGFVTRFSWGYRLRATLDYNNVF  476 (553)
T ss_pred             EEEEEEEEEECCCCCCCCEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCC
T ss_conf             99999999837766725316999999998157887542100566544666788753457777741589999878701452


Q ss_pred             EEEEECCCEEEECCCC----------CCCCCEEEEEEEEEEEEECCCEEEEEEEECCCCCC-CCCCCCCCCCCCCCHHCC
Q ss_conf             0478604525404567----------67852277877888885159127789873274211-354234663100110113
Q gi|254780314|r  282 KSITISGGGQYFGDIN----------KTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVK-KGVAIDKGVDLSVGLKKS  350 (351)
Q Consensus       282 DKl~ITPG~QY~gd~~----------~sg~DaWk~GlTvDYqItegL~tK~SVqY~D~~~~-~~~~~d~g~d~t~gl~~s  350 (351)
                      .-+.++|.+.+--++.          .-|+-.+.+||+.+|+=    .-+++++|++-|=. .--...|-|=.+.-++++
T Consensus       477 ~G~dLsp~i~~shdv~G~sp~~~~~f~Eg~~s~slgl~~~y~~----~~~~~l~Yt~f~G~g~~n~l~DRDfvs~svs~s  552 (553)
T pfam06980       477 AGVDLSPPIAWSHDVKGYSPDPGGGFMEGRKSLSLGLDADYLN----TWQASLSYTNFFGGGDYNTLSDRDFVSLSVKYS  552 (553)
T ss_pred             CCEEEEEEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEECC----CEEEEEEEEEECCCCCCCCCCCCCEEEEEEEEC
T ss_conf             4678756889994574434786677657884699999999725----469999968711777778656666289999971


Q ss_pred             C
Q ss_conf             9
Q gi|254780314|r  351 F  351 (351)
Q Consensus       351 f  351 (351)
                      |
T Consensus       553 F  553 (553)
T pfam06980       553 F  553 (553)
T ss_pred             C
T ss_conf             9


No 27 
>cd01347 ligand_gated_channel TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel.   Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing  inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock.  In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated  signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.
Probab=44.83  E-value=23  Score=15.91  Aligned_cols=60  Identities=22%  Similarity=0.383  Sum_probs=33.9

Q ss_pred             CCCCEEEEEEEEEEECEEEEECCCEEEEC--CC----------CCCCCCEEEEEEEEEEEEECCCEEEEEEE
Q ss_conf             11211366435563110478604525404--56----------76785227787788888515912778987
Q gi|254780314|r  266 DKSKYSVFAGYKFDVAKSITISGGGQYFG--DI----------NKTGKDGWSAGISAKYMISSGLEAQASVA  325 (351)
Q Consensus       266 ~~SEWaVAAeYaikaTDKl~ITPG~QY~g--d~----------~~sg~DaWk~GlTvDYqItegL~tK~SVq  325 (351)
                      ....+++.++..++.+++|++++|+.|=-  ..          .....+.|...+.+.|++.+.+.-+++..
T Consensus       331 ~~~~~~~f~~~~~~~~~~l~~~~G~R~d~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~y~~~~~~~l~~~~~  402 (635)
T cd01347         331 DEKQTALYAQDTIELTDDLTLTLGLRYDHYDQDSKDTIAGGTTAKKSYSHWSPSLGLVYKLTDGLSLYASYS  402 (635)
T ss_pred             EEEEEEEEEEEEEECCCCEEEEEEEEEEEEEEEEECCCCCCCCCCCCCCEECCEEEEEEECCCCCEEEEEEE
T ss_conf             799999999999962798899998899999987603335665432337538418999985498727999997


No 28 
>COG4771 FepA Outer membrane receptor for ferrienterochelin and colicins [Inorganic ion transport and metabolism]
Probab=43.01  E-value=25  Score=15.75  Aligned_cols=96  Identities=19%  Similarity=0.362  Sum_probs=55.0

Q ss_pred             CCEEEEEEHHHCCCCCCCC---EEEEEEEEEEEECC----EEEEEEEEEECCCCCCEEEEEEEECCCCCCEEEEEEEEEC
Q ss_conf             7545103303214666654---03478896345412----6899985221146651279888613678820246788733
Q gi|254780314|r  187 GLLKAGLSTDLLQKDGLKQ---VLGIGYMASYAIGK----IRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWAS  259 (351)
Q Consensus       187 G~F~AGiSvDeLE~dg~~n---~VGV~g~vsg~aGa----vS~qltGGyDtd~eeGAIRAl~ta~iG~PGTlglAgVwAS  259 (351)
                      |.+--|.|.--++-+.+.|   +-|+++..-++++.    .+..+.+           .-....+++.--+|-+++-|..
T Consensus       301 G~wd~G~S~~~~qye~t~N~~r~eg~~~~~e~~~~~~~~l~~~~~~g-----------~~~lp~~l~~~h~Lt~GgEw~~  369 (699)
T COG4771         301 GRWDFGTSESYLQYEETRNKRRNEGLSGGTEGKFGENRELKDVNLDG-----------EVNLPLPLGENHTLTVGGEWRH  369 (699)
T ss_pred             CEECCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEE-----------EEECCEECCCCEEEEEECEEHH
T ss_conf             54457735046543020477656676777667666443220235640-----------3612330255348996020025


Q ss_pred             -------------CCCCCCCCCCEEEEEEEEEEECEEEEECCCEEEE
Q ss_conf             -------------8640001121136643556311047860452540
Q gi|254780314|r  260 -------------GDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYF  293 (351)
Q Consensus       260 -------------gpNaYY~~SEWaVAAeYaikaTDKl~ITPG~QY~  293 (351)
                                   .-..+....-|+++||=-+..+|-+.+|||..|=
T Consensus       370 e~L~D~~~~~~~~~~~~~~sa~~~ALFaEDe~~l~~~~~LT~G~R~D  416 (699)
T COG4771         370 EKLKDKVNLTGGTSRSSKFSAEIWALFAEDEWELTDDLALTPGLRFD  416 (699)
T ss_pred             HHHCCCCCCCCCCCCCCCCHHHHHHHEECCEEEECCCEEECCCCCCC
T ss_conf             35313224567767754312566444210012344770303553343


No 29 
>PRK06330 transcript cleavage factor/unknown domain fusion protein; Validated
Probab=42.55  E-value=25  Score=15.69  Aligned_cols=45  Identities=16%  Similarity=0.260  Sum_probs=33.4

Q ss_pred             CEEEEEEEEEEEEC----CEEEEEEEEEECCCCCCEEEEEEEECCCCCCEEE
Q ss_conf             40347889634541----2689998522114665127988861367882024
Q gi|254780314|r  205 QVLGIGYMASYAIG----KIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLD  252 (351)
Q Consensus       205 n~VGV~g~vsg~aG----avS~qltGGyDtd~eeGAIRAl~ta~iG~PGTlg  252 (351)
                      +.||++-.|.-+--    -.+|.++|-||.|.++|-|--+  +++| -+-||
T Consensus       829 ~kVg~GTkV~l~n~~tg~~etYtILGpWDaDPek~IISY~--SP~G-~~LLg  877 (906)
T PRK06330        829 SKVGFGTKVKLKNESTGEEESYSILGPWESDPEKGIISYQ--SPLG-KSLLG  877 (906)
T ss_pred             CEECCCEEEEEEECCCCCEEEEEEECCCCCCCCCCCEECC--CHHH-HHHHC
T ss_conf             3440554899875577866789974476678212823401--7554-76527


No 30 
>KOG3313 consensus
Probab=40.36  E-value=23  Score=15.97  Aligned_cols=22  Identities=27%  Similarity=0.510  Sum_probs=9.9

Q ss_pred             EEEEEEEECCCEEEEEEEECCC
Q ss_conf             7888885159127789873274
Q gi|254780314|r  308 ISAKYMISSGLEAQASVAFNDN  329 (351)
Q Consensus       308 lTvDYqItegL~tK~SVqY~D~  329 (351)
                      +...|+|.+|+++|++|+-.|.
T Consensus        90 ~~t~f~lsd~vy~ka~V~~~~k  111 (187)
T KOG3313          90 FETTFLLSDGVYTKASVPPTDK  111 (187)
T ss_pred             EEEEEEECCCCEEEEECCCCCE
T ss_conf             5678874165355564398686


No 31 
>PRK10177 hypothetical protein; Provisional
Probab=39.87  E-value=28  Score=15.44  Aligned_cols=30  Identities=27%  Similarity=0.404  Sum_probs=18.4

Q ss_pred             EEEEEEEEECCCHHCCCCCCCCHHEEEEECCCCCCCHHHHEEEHHHEEECCEEEECCC
Q ss_conf             3499999742200000011121000121035555112520001100000122200244
Q gi|254780314|r  100 TGVAKLKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDE  157 (351)
Q Consensus       100 tgv~~~~~~~d~~~~~~~~~~d~~a~~~~~~Ss~l~ldeayLdi~GfRaG~FySWWDE  157 (351)
                      -|-+..+|++|+-.                            ++.|-++-+|..|+|.
T Consensus        93 ~G~A~v~L~~d~~~----------------------------~l~~S~~dll~Plyd~  122 (452)
T PRK10177         93 WGNASVDLKVDNEG----------------------------HFTGSRGSWFVPLQDN  122 (452)
T ss_pred             HCEEEEEEEECCCC----------------------------CCCCCEEEEEEEEEEC
T ss_conf             27489998407888----------------------------7167301167754527


No 32 
>PRK10003 ferric-rhodotorulic acid outer membrane transporter; Provisional
Probab=38.61  E-value=29  Score=15.31  Aligned_cols=53  Identities=21%  Similarity=0.279  Sum_probs=35.2

Q ss_pred             CEEEEEEEEEEECEEEEECCCEEEEC------CCCCC-CCCEEEEEEEEEEEEECCCEEEEE
Q ss_conf             11366435563110478604525404------56767-852277877888885159127789
Q gi|254780314|r  269 KYSVFAGYKFDVAKSITISGGGQYFG------DINKT-GKDGWSAGISAKYMISSGLEAQAS  323 (351)
Q Consensus       269 EWaVAAeYaikaTDKl~ITPG~QY~g------d~~~s-g~DaWk~GlTvDYqItegL~tK~S  323 (351)
                      .+++.++-.++.+|+|.+++|+-|-.      .++.. +.-.|++||  -|++.+++..-+|
T Consensus       454 ~~~~y~~d~~~l~d~l~l~~G~Ry~~~~~~~~~~~~~~~~~tp~~gl--~Y~~~~~~s~Yas  513 (731)
T PRK10003        454 MKSLYAATRVSLADPLHLILGARYTNWRVDTLTYSMEKNHTTPYAGL--VYDINDNWSTYAS  513 (731)
T ss_pred             EEEEEEEEEEEECCCEEEEEEEEEEEEEECCCCCCCCCCCCCCCEEE--EEECCCCEEEEEE
T ss_conf             98679998997437269985401773340453223225641441589--9984888027667


No 33 
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) . This enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  ValRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=37.51  E-value=23  Score=15.90  Aligned_cols=38  Identities=21%  Similarity=0.208  Sum_probs=31.5

Q ss_pred             HHHHHHHHHCHHHHHHHHHHHHCCCCCCCCCCCCCCCE
Q ss_conf             01112563120256666654101368776554333420
Q gi|254780314|r   48 NVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIP   85 (351)
Q Consensus        48 ~~~~~~~~~~~~~~~~~~~~~~~lng~~e~n~~~~d~~   85 (351)
                      |-.|||-.+-..+-.-.-+||++|.|.+-.--..+|.-
T Consensus        13 NG~~HiGHa~~~i~aDv~aRy~rm~G~~V~f~~G~DeH   50 (363)
T cd00817          13 TGSLHIGHALTNTIQDIIARYKRMKGYNVLWPPGTDHA   50 (363)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             88613527898999999999998169977887845756


No 34 
>PRK10716 long-chain fatty acid outer membrane transporter; Provisional
Probab=36.98  E-value=31  Score=15.15  Aligned_cols=31  Identities=23%  Similarity=0.469  Sum_probs=25.3

Q ss_pred             CCEEEEEEEEEEEEECCCEEEEEEEECCCCC
Q ss_conf             5227787788888515912778987327421
Q gi|254780314|r  301 KDGWSAGISAKYMISSGLEAQASVAFNDNFV  331 (351)
Q Consensus       301 ~DaWk~GlTvDYqItegL~tK~SVqY~D~~~  331 (351)
                      +|.|+..+-+.|+.++.|.-|+-+.|-.--|
T Consensus       338 ~Dtw~~~~G~~Y~~~~~l~LRaG~aYD~sPv  368 (437)
T PRK10716        338 KDAYRIALGTTYYYDDNWTFRTGIAFDDSPV  368 (437)
T ss_pred             CCCEEEEEEEEEECCCCCEEEEEEEECCCCC
T ss_conf             4100799789998799818988778746888


No 35 
>pfam09270 Beta-trefoil Beta-trefoil. Members of this family of DNA binding domains adopt a beta-trefoil fold, that is, a capped beta-barrel with internal pseudo threefold symmetry. In the DNA-binding protein LAG-1, it also is the site of mutually exclusive interactions with NotchIC (and the viral protein EBNA2) and corepressors (SMRT/N-Cor and CIR).
Probab=36.20  E-value=32  Score=15.08  Aligned_cols=22  Identities=32%  Similarity=0.345  Sum_probs=17.3

Q ss_pred             CCCCEEEECCCCCCCCCCEEEEEE
Q ss_conf             555102311222444332268998
Q gi|254780314|r  161 VYSPTTLYNDARGLDKMMSLSYRH  184 (351)
Q Consensus       161 IgS~~TL~Nd~rg~dk~~SirYqY  184 (351)
                      -||.+-|||-+|+|+-  |-||..
T Consensus         5 sgs~VsLFNRlRSQTV--sTrYL~   26 (152)
T pfam09270         5 SGSKVALFNRLRSQTV--STRYLH   26 (152)
T ss_pred             CCCEEEEEEEECCCEE--EEEEEE
T ss_conf             7989984550014144--147999


No 36 
>COG3637 Opacity protein and related surface antigens [Cell envelope biogenesis, outer membrane]
Probab=34.60  E-value=34  Score=14.92  Aligned_cols=29  Identities=17%  Similarity=0.388  Sum_probs=23.9

Q ss_pred             CCEEEEEEEEEEEEECCCEEEEEEEECCC
Q ss_conf             52277877888885159127789873274
Q gi|254780314|r  301 KDGWSAGISAKYMISSGLEAQASVAFNDN  329 (351)
Q Consensus       301 ~DaWk~GlTvDYqItegL~tK~SVqY~D~  329 (351)
                      +-.|..|.=++|++++++..++.-.|.|-
T Consensus       144 ~~g~~~gAGv~~~~tdnv~vd~~Y~y~~~  172 (199)
T COG3637         144 KTGYAYGAGVQYNPTDNVAIDLGYEYSDF  172 (199)
T ss_pred             EEEEEEEEEEEECCCCCEEEEEEEEEEEC
T ss_conf             78867841079815598799889998815


No 37 
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. In Aquifex aeolicus, the gene encoding LeuRS is split in two, just before the KMSKS motif. Consequently, LeuRS is a heterodimer, which likely superimposes with the LeuRS monomer found in most other organisms. LeuRS has an insertion in the core domain, which is subject to both deletions and rearrangements and thus differs between prokaryotic LeuRS and archaeal/eukaryotic LeuRS. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=33.38  E-value=29  Score=15.35  Aligned_cols=38  Identities=21%  Similarity=0.320  Sum_probs=29.9

Q ss_pred             HHHHHHHHHHCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             00111256312025666665410136877655433342
Q gi|254780314|r   47 GNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDI   84 (351)
Q Consensus        47 ~~~~~~~~~~~~~~~~~~~~~~~~lng~~e~n~~~~d~   84 (351)
                      -|--|||-.+-+.+-.-.-+||++|.|++-.--..+|.
T Consensus        11 ~NG~~HiGH~~~~i~aDi~~Ry~Rm~G~~V~~~~G~De   48 (376)
T cd00812          11 PSGRLHVGHVRTYTIGDIIARYKRMKGYNVLFPMGFDA   48 (376)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             89745468869899999999999955997046884565


No 38 
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated
Probab=32.89  E-value=36  Score=14.74  Aligned_cols=17  Identities=12%  Similarity=0.339  Sum_probs=6.8

Q ss_pred             HHHHHHHHHCHHHHHHH
Q ss_conf             01112563120256666
Q gi|254780314|r   48 NVLPHITKVGGSLEKSL   64 (351)
Q Consensus        48 ~~~~~~~~~~~~~~~~~   64 (351)
                      |..|..|...-.+++-+
T Consensus       204 nIIPttTgAakai~~vl  220 (333)
T PRK08955        204 SLIPTTTGSATAITEIF  220 (333)
T ss_pred             CCCCCCCCHHHHHHHHC
T ss_conf             57877663889998644


No 39 
>pfam11924 DUF3442 Protein of unknown function (DUF3442). This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 334 to 948 amino acids in length.
Probab=31.55  E-value=38  Score=14.61  Aligned_cols=113  Identities=19%  Similarity=0.237  Sum_probs=61.0

Q ss_pred             CCCCCEEEEEEEEEEEECCEEEEEEEEEECCCCCCEEEEEEEECCCCCCEEEEEEEEECCCCCCCCCCCEE---------
Q ss_conf             66654034788963454126899985221146651279888613678820246788733864000112113---------
Q gi|254780314|r  201 DGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYS---------  271 (351)
Q Consensus       201 dg~~n~VGV~g~vsg~aGavS~qltGGyDtd~eeGAIRAl~ta~iG~PGTlglAgVwASgpNaYY~~SEWa---------  271 (351)
                      +...-++|++..--  ....-+-+-.=||-|-++.--|+-+-+|+-       ...+.-..|.|+..|.|.         
T Consensus        91 ~r~~~N~GlG~R~~--~~~~m~G~N~F~D~d~~~~h~R~g~G~E~~-------~~~~~~~~N~Y~~ls~w~~~~~~~~~~  161 (280)
T pfam11924        91 DRTTGNLGLGYRHF--NDDWMLGANAFYDYDFSRSHSRIGLGAEAW-------TDYLKLSANYYFPLSGWKDSKDFENYE  161 (280)
T ss_pred             CCEEEEEEEEEEEE--CCCEEEEEEEEEECCCCCCCEEEEECHHHE-------ECCEEEEEEEEEECCCCCCCCCCCCCE
T ss_conf             98599877799997--798289979998247999860555115214-------321568878886057864457778821


Q ss_pred             --EEEEEEEEECEEEEECCC-------EEEECCC------CCCCCCEEEEEEEEEEEEECCCEEEE
Q ss_conf             --664355631104786045-------2540456------76785227787788888515912778
Q gi|254780314|r  272 --VFAGYKFDVAKSITISGG-------GQYFGDI------NKTGKDGWSAGISAKYMISSGLEAQA  322 (351)
Q Consensus       272 --VAAeYaikaTDKl~ITPG-------~QY~gd~------~~sg~DaWk~GlTvDYqItegL~tK~  322 (351)
                        +|-.|-+.+.-.|-.-|.       .||+|+-      +...++.+..-+-+.|..+..|...+
T Consensus       162 Er~a~G~D~~~~~~lP~~p~lg~~l~yeqy~gd~v~lf~~~~~q~~p~a~t~gl~ytP~pllt~~~  227 (280)
T pfam11924       162 ERPASGYDLRLGARLPAYPQLGGKLKYEQYYGDNVALFGSGNLQKDPHAVTLGLNYTPVPLLTVGA  227 (280)
T ss_pred             EEECCCEEEEEEEECCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEEECCCCCEEEEE
T ss_conf             463597326742446867566746999997657533236665556861179988840368779987


No 40 
>pfam10807 DUF2541 Protein of unknown function (DUF2541). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. All proteins are annotated as YaaI precursor however currently no function is known.
Probab=30.42  E-value=37  Score=14.61  Aligned_cols=44  Identities=39%  Similarity=0.551  Sum_probs=34.1

Q ss_pred             HCHHHHHHHHHHHHCCCC-----CCCCCCCCCCCEEEE---EEEEEECCCCE
Q ss_conf             120256666654101368-----776554333420001---48997056861
Q gi|254780314|r   56 VGGSLEKSLQARYHKLNG-----NNEFNSLAYDIPVKG---NLEVNANAGDV   99 (351)
Q Consensus        56 ~~~~~~~~~~~~~~~lng-----~~e~n~~~~d~~~~g---~~~~~a~~g~~   99 (351)
                      .|-.|-.+-+|.-||+-|     .||-||++..+||--   ..|.+|..||+
T Consensus        13 ~gl~l~~~a~andhkilgviamprnetndl~lk~pvcrvvkriqltad~gdi   64 (134)
T pfam10807        13 FGLAFISSAAANDHKILGVIAMPRNETNDLALKIPVCRIVKRIQLSADHGDI   64 (134)
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCCCCEEEECCCEEEEEEEEEECCCCCE
T ss_conf             9998761533077617889960667777527723430367757850346856


No 41 
>KOG0227 consensus
Probab=28.65  E-value=28  Score=15.42  Aligned_cols=33  Identities=27%  Similarity=0.407  Sum_probs=21.8

Q ss_pred             CCCCCHHEEEEECCCCCCCHHHHEEEHHHEEECCEEEECCCCC
Q ss_conf             1112100012103555511252000110000012220024444
Q gi|254780314|r  117 FAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVN  159 (351)
Q Consensus       117 ~~~~d~~a~~~~~~Ss~l~ldeayLdi~GfRaG~FySWWDEtd  159 (351)
                      ||----.-|||.+||-.++--          -|.|++.||+..
T Consensus       171 faaePyE~Iafk~p~~Eid~s----------e~Kf~t~wd~~t  203 (222)
T KOG0227         171 FAAEPYENIAFKVPSREIDKS----------EGKFWTHWDAET  203 (222)
T ss_pred             EEECCCCCEEEECCCHHHHHC----------CCCEEEEECCCC
T ss_conf             981431013466584143213----------574003323777


No 42 
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) . This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  IleRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=27.16  E-value=44  Score=14.17  Aligned_cols=36  Identities=25%  Similarity=0.365  Sum_probs=28.8

Q ss_pred             HHHHHHHHHCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             011125631202566666541013687765543334
Q gi|254780314|r   48 NVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYD   83 (351)
Q Consensus        48 ~~~~~~~~~~~~~~~~~~~~~~~lng~~e~n~~~~d   83 (351)
                      |-.|||-..-+..-.-.-+||++|.|++-+--..+|
T Consensus        13 Ng~pHiGHa~~~i~aDv~aRy~Rl~G~~v~f~~GtD   48 (339)
T cd00818          13 NGLPHYGHALNKILKDIINRYKTMQGYYVPRRPGWD   48 (339)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             787345588999999999999980699887788514


No 43 
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane]
Probab=26.67  E-value=27  Score=15.48  Aligned_cols=15  Identities=33%  Similarity=1.046  Sum_probs=11.4

Q ss_pred             CCEEEEEEEEEEEEE
Q ss_conf             522778778888851
Q gi|254780314|r  301 KDGWSAGISAKYMIS  315 (351)
Q Consensus       301 ~DaWk~GlTvDYqIt  315 (351)
                      ||+|.+|++-+|-|.
T Consensus       516 RDAWsvG~~g~Y~l~  530 (733)
T COG4953         516 RDAWSVGVFGRYVLG  530 (733)
T ss_pred             CCCEEECCCCCEEEE
T ss_conf             331463235865899


No 44 
>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770   Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine. It catalyses the the reduced pyridine nucleotide-dependent reduction of the alpha,beta-unsaturated cyclic imine, dihydrodipicolinate, to generate tetrahydrodipicolinate as shown below : 2,3-dihydrodipicolinate + NAD(P)H = 2,3,4,5-tetrahydrodipicolinate + NAD(P)(+) As this enzyme is not found in mammals it is a potential target for the development of novel antibacterial and herbicidal compounds.   The structures of the Escherichia coli (P04036 from SWISSPROT) and Mycobacterium tuberculosis (P72024 from SWISSPROT) enzymes have been determined , . The enzyme is a homotetramer where each monomer is composed of two domains, an N-terminal NAD(P)H-binding domain which forms a Rossman fold, and a C-terminal substrate-binding domain that forms an open, mixed alpha-beta sandwich.Tetramerisation occurs exclusively through interactions between C-terminal domain residues. Both enzymes show relatively little preference for either NADH or NADPH as cofactor. Conformational changes upon substrate binding bring the cofactor and substrate into close proximity and allow catalysis to occur. ; GO: 0008839 dihydrodipicolinate reductase activity, 0009089 lysine biosynthetic process via diaminopimelate, 0005737 cytoplasm.
Probab=24.36  E-value=22  Score=16.02  Aligned_cols=49  Identities=24%  Similarity=0.476  Sum_probs=37.5

Q ss_pred             EEECCCCEEEEEEEEEECCCHHCCC----CCCCCHHEE-EEECCCCCCCHHHHE
Q ss_conf             9705686134999997422000000----111210001-210355551125200
Q gi|254780314|r   92 VNANAGDVTGVAKLKLAVDDVLSMQ----FAESDVRAL-AFTVPSSKLSVEELS  140 (351)
Q Consensus        92 ~~a~~g~~tgv~~~~~~~d~~~~~~----~~~~d~~a~-~~~~~Ss~l~ldeay  140 (351)
                      .-.-+|.+.|+.++-..+++.+..+    |.|++.|-| -||.|+--.+.=+..
T Consensus        42 ~G~D~GEl~g~g~~gv~v~~~~~~~~~l~~~~~~~DVliDFT~p~g~~~~~~~a   95 (281)
T TIGR00036        42 QGTDIGELAGIGKVGVPVTDDLEAVLVLAFTETKPDVLIDFTTPEGVVENVKIA   95 (281)
T ss_pred             CCCCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHH
T ss_conf             665420242255478410005788999874023686478738605678999999


No 45 
>KOG3743 consensus
Probab=24.20  E-value=51  Score=13.79  Aligned_cols=30  Identities=27%  Similarity=0.264  Sum_probs=23.2

Q ss_pred             CCCCCEEEECCCCCCCCCCEEEEEE-ECCCEEE
Q ss_conf             5555102311222444332268998-2575451
Q gi|254780314|r  160 PVYSPTTLYNDARGLDKMMSLSYRH-SFGLLKA  191 (351)
Q Consensus       160 dIgS~~TL~Nd~rg~dk~~SirYqY-e~G~F~A  191 (351)
                      .-|+.|-|||-+|+|+-  |-||.. |.|.|.|
T Consensus       318 ~sGs~VsLFNRlrSQtv--sTrYl~vE~gqF~a  348 (622)
T KOG3743         318 RSGSKVSLFNRLRSQTV--STRYLSVENGQFHA  348 (622)
T ss_pred             CCCCEEEEEHHHHHHHC--CEEEEEEECCEEEC
T ss_conf             36978862024432200--21578740660331


No 46 
>TIGR02073 PBP_1c penicillin-binding protein 1C; InterPro: IPR011815    This entry contains penicillin binding proteins includes the member from Escherichia coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this entry are presumed to have the same basic function..
Probab=23.47  E-value=39  Score=14.48  Aligned_cols=71  Identities=15%  Similarity=0.226  Sum_probs=33.7

Q ss_pred             CCEEEECCCCCCCCCCE--EEEEEEC--CCEEEEEEHH-------------HCCCCCCC------CEEEEEEEEEEE--E
Q ss_conf             51023112224443322--6899825--7545103303-------------21466665------403478896345--4
Q gi|254780314|r  163 SPTTLYNDARGLDKMMS--LSYRHSF--GLLKAGLSTD-------------LLQKDGLK------QVLGIGYMASYA--I  217 (351)
Q Consensus       163 S~~TL~Nd~rg~dk~~S--irYqYe~--G~F~AGiSvD-------------eLE~dg~~------n~VGV~g~vsg~--a  217 (351)
                      -|.+|-.|+-  ..|.+  --|+=|+  ..|..-|+|-             .||.=+.+      +.+|+...-.-.  .
T Consensus       345 ~p~slL~D~P--~~fg~~SG~Y~P~Nf~~~F~G~V~v~~AL~~SLNiPAV~ll~~~g~~~f~~~L~~~G~~~~~~~~~~~  422 (786)
T TIGR02073       345 HPDSLLKDVP--LRFGDVSGLYAPENFDKTFHGPVPVREALARSLNIPAVRLLERLGPPRFASFLRQAGLKLLKPKSRDY  422 (786)
T ss_pred             CCCCHHHHCC--HHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCHHHHHHHHCCHHHHHHHHHHHCCCCCCHHHHCC
T ss_conf             2010101012--10147233326788777646776399986430671489999742926899999970565578000025


Q ss_pred             CCEEEEEEEEEECCCCCCE
Q ss_conf             1268999852211466512
Q gi|254780314|r  218 GKIRSTVTGGYDAGTNNVA  236 (351)
Q Consensus       218 GavS~qltGGyDtd~eeGA  236 (351)
                      .+.|. +|||=++-.+|-|
T Consensus       423 yGLSL-~LGG~e~tL~dLa  440 (786)
T TIGR02073       423 YGLSL-ILGGAEITLQDLA  440 (786)
T ss_pred             CCCEE-EECCCCCCHHHHH
T ss_conf             76013-1230174489999


No 47 
>pfam06629 MipA MltA-interacting protein MipA. This family consists of several bacterial MltA-interacting protein (MipA) like sequences. As well as interacting with the membrane-bound lytic transglycosylase MltA, MipA is known to bind to PBP1B, a bifunctional murein transglycosylase/transpeptidase. MipA is considered to be a structural protein mediating the assembly of MltA to PBP1B into a complex.
Probab=23.01  E-value=54  Score=13.65  Aligned_cols=79  Identities=20%  Similarity=0.294  Sum_probs=45.5

Q ss_pred             CCEEEEEEEECCCCCCEEEEEEEEECCCCCCCCCCCEEEEEEEEEEECEEEEECCC--EEEEC-----------------
Q ss_conf             51279888613678820246788733864000112113664355631104786045--25404-----------------
Q gi|254780314|r  234 NVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGG--GQYFG-----------------  294 (351)
Q Consensus       234 eGAIRAl~ta~iG~PGTlglAgVwASgpNaYY~~SEWaVAAeYaikaTDKl~ITPG--~QY~g-----------------  294 (351)
                      .+.+|+.+..++.+ +.               .--+..+.+.|.+..++++.++|+  ++|-.                 
T Consensus        97 ~~~~~~~~~~dv~~-~~---------------~G~~~~~~~~~~~~~~~~~~l~~~~~~~~~s~~y~~yyyGV~~~ea~~  160 (226)
T pfam06629        97 WGTVRAELEQDISN-GS---------------RGFVADIGLAATYDLGDRLSLSPSLGLSYASRKYNDYYFGVSAAESAR  160 (226)
T ss_pred             CEEEEEEEEEECCC-CC---------------CCEEEEEEEEEEEECCCCEEEEEEEEEEECCHHHHHHHHCCCHHHHHH
T ss_conf             88999999993246-73---------------889999999999963997799997899986776756553779789612


Q ss_pred             ----CCCC-CCCCEEEEEEEEEEEEECCCEEEEEEEECC
Q ss_conf             ----5676-785227787788888515912778987327
Q gi|254780314|r  295 ----DINK-TGKDGWSAGISAKYMISSGLEAQASVAFND  328 (351)
Q Consensus       295 ----d~~~-sg~DaWk~GlTvDYqItegL~tK~SVqY~D  328 (351)
                          -|.- +|--.+.++++..|+|+++....+.+.|.-
T Consensus       161 s~~~~Y~a~~g~~~~~~~~~~~y~l~~~w~~~~~~~~~~  199 (226)
T pfam06629       161 SGLAQYNAGAGLWSAGLGLSATYMLTDHWSALGSASYTR  199 (226)
T ss_pred             CCCCCCCCCCCEEEEEEEEEEEEEECCCEEEEEEEEEEE
T ss_conf             378640578770789999999999669999999999998


No 48 
>PRK00133 metG methionyl-tRNA synthetase; Reviewed
Probab=22.47  E-value=43  Score=14.25  Aligned_cols=37  Identities=19%  Similarity=0.268  Sum_probs=29.1

Q ss_pred             HHHHHHHHHCHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             0111256312025666665410136877655433342
Q gi|254780314|r   48 NVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDI   84 (351)
Q Consensus        48 ~~~~~~~~~~~~~~~~~~~~~~~lng~~e~n~~~~d~   84 (351)
                      |--|||-.+-+.+-.-.-|||+++.|++-+--..+|-
T Consensus        14 Ng~~HiGH~~~~i~aDv~aRy~Rl~G~~v~f~~GtDe   50 (666)
T PRK00133         14 NGPIHLGHLLEYIQADIWVRYQRMRGHEVLFVCADDA   50 (666)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             8984312467699999999999836995498474278


Done!