RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780314|ref|YP_003064727.1| outer membrane protein [Candidatus Liberibacter asiaticus str. psy62] (351 letters) >gnl|CDD|152187 pfam11751, DUF3308, Protein of unknown function (DUF3308). Some members of this family of bacterial proteins are annotated as being one of the several TonB-dependent siderophore receptors, but this could not be confirmed. Length = 274 Score = 29.9 bits (68), Expect = 1.2 Identities = 13/73 (17%), Positives = 25/73 (34%), Gaps = 4/73 (5%) Query: 259 SGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGL 318 + ++ Y + AGY FD+ + + + Y S ++A + + Sbjct: 168 NDNSESSLPRHYYLTAGYVFDLNEELKLKPSVLY----KYQEGAPLSLDLNANLLYNDKF 223 Query: 319 EAQASVAFNDNFV 331 AS ND Sbjct: 224 WLGASYRNNDAIS 236 >gnl|CDD|178719 PLN03175, PLN03175, hypothetical protein; Provisional. Length = 415 Score = 26.7 bits (59), Expect = 9.0 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 7/41 (17%) Query: 53 ITKVGGSLEKSLQARYHKLNGNNEFNSL-------AYDIPV 86 I V + EKSL+ R K+N N ++N L DIP+ Sbjct: 309 INTVRDAFEKSLRNRLQKMNPNTDYNCLKTFGSFFTEDIPI 349 >gnl|CDD|162685 TIGR02073, PBP_1c, penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. Length = 727 Score = 26.6 bits (59), Expect = 9.7 Identities = 10/22 (45%), Positives = 14/22 (63%), Gaps = 5/22 (22%) Query: 298 KTG-----KDGWSAGISAKYMI 314 KTG +D W+AG+S +Y I Sbjct: 490 KTGTSYGFRDAWAAGVSGRYTI 511 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.131 0.369 Gapped Lambda K H 0.267 0.0748 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,494,832 Number of extensions: 344161 Number of successful extensions: 372 Number of sequences better than 10.0: 1 Number of HSP's gapped: 372 Number of HSP's successfully gapped: 5 Length of query: 351 Length of database: 5,994,473 Length adjustment: 94 Effective length of query: 257 Effective length of database: 3,963,321 Effective search space: 1018573497 Effective search space used: 1018573497 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 58 (26.1 bits)