Query gi|254780315|ref|YP_003064728.1| hypothetical protein CLIBASIA_01000 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 45 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 14:49:21 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780315.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 pfam11630 DUF3254 Protein of u 16.6 57 0.0015 16.1 0.8 15 31-45 34-48 (97) 2 PTZ00285 glucosamine-6-phospha 16.1 1.2E+02 0.003 14.6 3.1 40 3-42 35-75 (253) 3 cd03783 MATH_Meprin_Alpha Mepr 15.1 57 0.0014 16.1 0.5 17 19-35 150-166 (167) 4 pfam06604 consensus 11.8 49 0.0012 16.4 -0.6 22 2-23 97-118 (181) 5 TIGR01754 flav_RNR ribonucleot 11.4 86 0.0022 15.2 0.5 38 8-45 9-59 (145) 6 cd03771 MATH_Meprin Meprin fam 11.1 87 0.0022 15.2 0.5 17 19-35 150-166 (167) 7 cd03782 MATH_Meprin_Beta Mepri 9.6 97 0.0025 15.0 0.3 18 18-35 149-166 (167) 8 KOG3853 consensus 9.2 1.7E+02 0.0044 13.8 1.4 21 10-30 97-118 (350) 9 KOG3094 consensus 9.2 1.8E+02 0.0046 13.7 1.5 12 12-23 233-244 (284) 10 pfam07134 DUF1383 Protein of u 9.0 1.5E+02 0.0039 14.0 1.1 14 31-44 203-216 (328) No 1 >pfam11630 DUF3254 Protein of unknown function (DUF3254). This family of proteins is most likely a family of anti-lipopolysaccharide factor proteins however this cannot be confirmed. Probab=16.58 E-value=57 Score=16.09 Aligned_cols=15 Identities=47% Similarity=0.826 Sum_probs=12.0 Q ss_pred EEEEEEEEEEEEECC Q ss_conf 240242121112049 Q gi|254780315|r 31 FKLKFLRFDLYFLGK 45 (45) Q Consensus 31 fklkflrfdlyflgk 45 (45) .+-++-||+|||-|| T Consensus 34 v~P~~kr~elyy~G~ 48 (97) T pfam11630 34 VKPTIKRFQLYYKGK 48 (97) T ss_pred ECCCEEEEEEEEEEE T ss_conf 566412104899888 No 2 >PTZ00285 glucosamine-6-phosphate isomerase; Provisional Probab=16.10 E-value=1.2e+02 Score=14.59 Aligned_cols=40 Identities=18% Similarity=0.318 Sum_probs=30.0 Q ss_pred CEEEEECCCCHHHHHHHHHHHHCC-CEEEEEEEEEEEEEEE Q ss_conf 247652288568999999997121-0410240242121112 Q gi|254780315|r 3 SIWELSLGGSPCLMFFLLRSFLKD-QIVFFKLKFLRFDLYF 42 (45) Q Consensus 3 siwelslggspclmffllrsflkd-qivffklkflrfdlyf 42 (45) ...-|+-|.||-.+|-.|....++ .|-|-+..+...|-|. T Consensus 35 ~~i~LsgG~tP~~~y~~L~~~~~~~~i~~~~v~~f~~DEy~ 75 (253) T PTZ00285 35 FVLGLPTGSTPLPTYQELIRAYREGRVSFSNVVTFNMDEYV 75 (253) T ss_pred EEEEECCCCCHHHHHHHHHHHHHCCCCCHHHEEEECCCCCC T ss_conf 29996998349999999999986159985795997363222 No 3 >cd03783 MATH_Meprin_Alpha Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides. They are composed of two related subunits, alpha and beta, which form homo- or hetro-complexes where the basic unit is a disulfide-linked dimer. The alpha subunit is synthesized as a membrane spanning protein, however, it is cleaved during biosynthesis and loses its transmembrane domain. It oligomerizes into large complexes, containing 10-100 subunits (dimers that associate noncovalently), which are secreted as latent proteases and can move through extracellular spaces in a nondestructive manner. This allows delivery of the concentrated protease to sites containing activating enzymes, such as sites of inflammation, infection or cancerous growth. Meprin alpha shows preference for small or hydrophobic residues at the P1 and P1' sites of its substrate. Both Probab=15.10 E-value=57 Score=16.10 Aligned_cols=17 Identities=35% Similarity=0.507 Sum_probs=14.0 Q ss_pred HHHHHHCCCEEEEEEEE Q ss_conf 99997121041024024 Q gi|254780315|r 19 LLRSFLKDQIVFFKLKF 35 (45) Q Consensus 19 llrsflkdqivffklkf 35 (45) --|+|+||.-+|+++++ T Consensus 150 ~~R~fiKdDtlfi~v~v 166 (167) T cd03783 150 RRRSFLKNDDLIIFVDF 166 (167) T ss_pred HHCCCCCCCEEEEEEEE T ss_conf 42785339869999982 No 4 >pfam06604 consensus Probab=11.79 E-value=49 Score=16.41 Aligned_cols=22 Identities=23% Similarity=0.607 Sum_probs=17.4 Q ss_pred CCEEEEECCCCHHHHHHHHHHH Q ss_conf 7247652288568999999997 Q gi|254780315|r 2 RSIWELSLGGSPCLMFFLLRSF 23 (45) Q Consensus 2 rsiwelslggspclmffllrsf 23 (45) --.|.+|.||+-|-||.-+..| T Consensus 97 ~G~W~vs~gg~sC~~~ltlTk~ 118 (181) T pfam06604 97 AGVWNASVGGQSCKIATPQTKL 118 (181) T ss_pred EEEEEEECCCCCEEEEEEECCC T ss_conf 5466850389712788533133 No 5 >TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative; InterPro: IPR010088 This entry represents a family of proteins found immediately downstream of ribonucleotide reductase genes in Xyella fastidiosa and some Gram-positive bacteria. It appears to be a highly divergent flavodoxin of the short chain type, more like the flavodoxins of the sulphate-reducing genus Desulfovibrio than like the NifF flavodoxins associated with nitrogen fixation.. Probab=11.44 E-value=86 Score=15.24 Aligned_cols=38 Identities=32% Similarity=0.499 Sum_probs=17.8 Q ss_pred ECCCCHHHHHHHHHHHHCCCE-----EEEEEE--------EEEEEEEEECC Q ss_conf 228856899999999712104-----102402--------42121112049 Q gi|254780315|r 8 SLGGSPCLMFFLLRSFLKDQI-----VFFKLK--------FLRFDLYFLGK 45 (45) Q Consensus 8 slggspclmffllrsflkdqi-----vffklk--------flrfdlyflgk 45 (45) |+.|..--.-+..+..|...= |-+.+. =-.||||+||. T Consensus 9 slSGNT~eVA~~I~~~l~~~G~eVDW~~~r~~~La~~pldPe~ydL~~LGt 59 (145) T TIGR01754 9 SLSGNTKEVADIIRDILEKDGHEVDWVEFRISTLADAPLDPEDYDLYLLGT 59 (145) T ss_pred HCCCCHHHHHHHHHHHHHHCCCEEEEEEECCHHHHCCCCCCCCCCEEEEEE T ss_conf 148777899999999998479776766400046424678998631577431 No 6 >cd03771 MATH_Meprin Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces. They are expressed in renal and intestinal brush border membranes, leukocytes, and cancer cells, and are capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides. Meprin proteases are composed of two related subunits, alpha and beta, which form homo- or hetro-complexes where the basic unit is a disulfide-linked dimer. Despite their similarity, the two subunits differ in their ability to self-associate, in proteolytic processing during biosynthesis and in substrate specificity. Both subunits are synthesized as membrane spanning proteins, however, the alpha subunit is cleaved during biosynthesis and loses its transmembrane domain. Meprin beta forms homodimers or heterotetramers while meprin alpha oligomerizes into large complexes co Probab=11.10 E-value=87 Score=15.21 Aligned_cols=17 Identities=35% Similarity=0.499 Sum_probs=13.7 Q ss_pred HHHHHHCCCEEEEEEEE Q ss_conf 99997121041024024 Q gi|254780315|r 19 LLRSFLKDQIVFFKLKF 35 (45) Q Consensus 19 llrsflkdqivffklkf 35 (45) --|.|+||.-+|+++++ T Consensus 150 ~~r~fiKdDtlfI~v~v 166 (167) T cd03771 150 RRRDFLKGDDLIILLDF 166 (167) T ss_pred HHCCCCCCCEEEEEEEE T ss_conf 54795328869999984 No 7 >cd03782 MATH_Meprin_Beta Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides. They are composed of two related subunits, alpha and beta, which form homo- or hetro-complexes where the basic unit is a disulfide-linked dimer. The beta subunit is a type I membrane protein, which forms homodimers or heterotetramers (alpha2beta2 or alpha3beta). Meprin beta shows preference for acidic residues at the P1 and P1' sites of its substrate. Among its best substrates are growth factors and chemokines such as gastrin and osteopontin. Both alpha and beta subunits contain a catalytic astacin (M12 family) protease domain followed by the adhesion or interaction domains MAM, MATH and AM. The MATH and MAM domains provide symmetrical intersubunit disulfide bonds necessary for the dimerization of meprin subunits. The MATH domain may also be required for f Probab=9.65 E-value=97 Score=14.98 Aligned_cols=18 Identities=33% Similarity=0.521 Sum_probs=13.6 Q ss_pred HHHHHHHCCCEEEEEEEE Q ss_conf 999997121041024024 Q gi|254780315|r 18 FLLRSFLKDQIVFFKLKF 35 (45) Q Consensus 18 fllrsflkdqivffklkf 35 (45) .--|.|+||.-+|+++.+ T Consensus 149 L~~R~fiK~D~l~i~v~v 166 (167) T cd03782 149 LRSRDFIKGDDVIFLLTM 166 (167) T ss_pred HHHCCCCCCCCEEEEEEE T ss_conf 852796338928999982 No 8 >KOG3853 consensus Probab=9.23 E-value=1.7e+02 Score=13.75 Aligned_cols=21 Identities=38% Similarity=0.249 Sum_probs=16.0 Q ss_pred CCCHHHHHHHHHH-HHCCCEEE Q ss_conf 8856899999999-71210410 Q gi|254780315|r 10 GGSPCLMFFLLRS-FLKDQIVF 30 (45) Q Consensus 10 ggspclmffllrs-flkdqivf 30 (45) +-|.|+|+.+|.. |-.-||+- T Consensus 97 ~~Sn~~m~~~LqraFP~vQI~s 118 (350) T KOG3853 97 LISNHLMLDILQRAFPQVQIVS 118 (350) T ss_pred HHHHHHHHHHHHHHCCCEEECC T ss_conf 4552799999986387337312 No 9 >KOG3094 consensus Probab=9.17 E-value=1.8e+02 Score=13.69 Aligned_cols=12 Identities=42% Similarity=0.523 Sum_probs=9.1 Q ss_pred CHHHHHHHHHHH Q ss_conf 568999999997 Q gi|254780315|r 12 SPCLMFFLLRSF 23 (45) Q Consensus 12 spclmffllrsf 23 (45) +-|.++||+||. T Consensus 233 ~~a~gvFLlRSl 244 (284) T KOG3094 233 YLAFGVFLLRSL 244 (284) T ss_pred HHHHHHHHHHHH T ss_conf 999999999999 No 10 >pfam07134 DUF1383 Protein of unknown function (DUF1383). This family consists of several hypothetical Nucleopolyhedrovirus proteins of around 375 residues in length. The function of this family is unknown. Probab=9.02 E-value=1.5e+02 Score=14.03 Aligned_cols=14 Identities=50% Similarity=0.956 Sum_probs=11.6 Q ss_pred EEEEEEEEEEEEEC Q ss_conf 24024212111204 Q gi|254780315|r 31 FKLKFLRFDLYFLG 44 (45) Q Consensus 31 fklkflrfdlyflg 44 (45) -.++|.-||+||+. T Consensus 203 ~~l~~~pfdvyFld 216 (328) T pfam07134 203 KSLGFFPFDVYFLD 216 (328) T ss_pred CCCCCEEEEEEEEE T ss_conf 12264256789988 Done!