RPSBLAST alignment for GI: 254780316 and conserved domain: pfam01588

>gnl|CDD|110582 pfam01588, tRNA_bind, Putative tRNA binding domain. This domain is found in prokaryotic methionyl-tRNA synthetases, prokaryotic phenylalanyl tRNA synthetases the yeast GU4 nucleic-binding protein (G4p1 or p42, ARC1), human tyrosyl-tRNA synthetase, and endothelial-monocyte activating polypeptide II. G4p1 binds specifically to tRNA form a complex with methionyl-tRNA synthetases. In human tyrosyl-tRNA synthetase this domain may direct tRNA to the active site of the enzyme. This domain may perform a common function in tRNA aminoacylation. Length = 94
 Score = 61.1 bits (149), Expect = 1e-09
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 20/106 (18%)

Query: 44  FTIVKVLSVERNPDLD-CAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNM 102
             + KVL  E++P+ D   +L++D G+  E Q+V GA NV                   +
Sbjct: 1   LRVGKVLEAEKHPNADKLLVLKVDVGEE-ERQIVSGAVNVYPPEE----------LVGKL 49

Query: 103 IVNV-----RKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVG 143
           +V V      K+RG+ES GM+ S +E      S  ++E P D P G
Sbjct: 50  VVVVANLKPAKLRGVESEGMILSAEE---DGGSVGLLEPPGDVPPG 92