RPSBLAST alignment for GI: 254780316 and conserved domain: PLN02265

>gnl|CDD|177906 PLN02265, PLN02265, probable phenylalanyl-tRNA synthetase beta chain. Length = 597
 Score = 73.6 bits (181), Expect = 2e-13
 Identities = 82/305 (26%), Positives = 118/305 (38%), Gaps = 59/305 (19%)

Query: 409 SEVKRLSGIDVPIEDSLRILER--LGFSVIGEYD-KFEVSVPSWRQDVEEKADLVEEILR 465
           S +    G+ +  E+   +L +  L      +      VSVP  R D+    D+ E++  
Sbjct: 317 SYINSSIGVSLDAEEVASLLNKMQLQAEQSSDDGCTIRVSVPPTRSDILHPCDVAEDVAI 376

Query: 466 IYGVDQIKSE---------PLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFI 516
            YG + I              PL Q  D             ++  +A     EV+ W   
Sbjct: 377 AYGYNNIPKRKPKSMTVGKQQPLNQFSDL------------LRAEVAMAGFTEVLTWILC 424

Query: 517 SKEQSVLFGGGQRE------LEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIF 570
           S +++  F    RE      + I NP SAD   +RTSLLPGLLK  G N D       +F
Sbjct: 425 SHKEN--FAMLNREDDGNSAVIIGNPRSADFEVVRTSLLPGLLKTLGHNKDAPKP-IKLF 481

Query: 571 EVSHVYENDTPE-----GQKYMAAGIRKGSSGIEGSGRLWSDKSEE--RCRFVDLFDAKA 623
           EVS V   D  +       + +AA     +SG E    L  D+  E     FV++ D   
Sbjct: 482 EVSDVVLLDESKDVGARNSRRLAALYCGTTSGFEVIHGL-VDRIMEVLGIPFVEIGDNNG 540

Query: 624 DALSVIEPFVSLDSLRFESGAPSWYHPGR-SGIIKTSAEIVLGYFGEFHPNILDFFGLSN 682
             +               S  P  Y PGR + II     +  G FG  HP +L+ F + +
Sbjct: 541 YYVE-------------PSNEPE-YFPGRQASIIYKGKHV--GTFGIVHPEVLNNFDIPD 584

Query: 683 PICGF 687
           P C F
Sbjct: 585 P-CSF 588