HHSEARCH alignment of GI: 254780318 and SCOP domain: d2j01u1

Alignment
>d2j01u1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
Probab=100.00  E-value=0  Score=327.81  Aligned_cols=116  Identities=50%  Similarity=0.801  Sum_probs=115.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             87756655568998999974131564523699999999999999874699889999999998677999971899999999
Q gi|254780318|r    2 TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFIN   81 (123)
Q Consensus         2 ~Rvk~g~~~~~rrkkilk~akGfrG~r~~~~r~A~~~v~kAl~yayrdRk~kKr~fR~LWI~RINAa~r~~g~sYS~fi~   81 (123)
                      ||||+|+++++||++||++||||+|++|+||++|+|+|+|||+|||+||+.+||+||+|||+|||||+|++|++||+||+
T Consensus         1 pRvk~g~~~~~rrkkilk~akGfrG~~s~~~r~A~~~v~kAl~yayrdRk~kKr~fR~LWI~RINAa~r~~glsYS~fi~   80 (117)
T d2j01u1           1 PRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIH   80 (117)
T ss_dssp             CCCCCCSHHHHHHHHHHHHTTTCSSGGGTSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTCCHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             99766289999999999980646777653359999999999999997299999999999999999999505999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHH
Q ss_conf             999629864689999997419899999999999985
Q gi|254780318|r   82 GLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL  117 (123)
Q Consensus        82 ~L~~~~i~LnRKvLa~LAi~dp~~F~~lv~~ak~~l  117 (123)
                      +|+++||+|||||||||||+||++|++||+++|++|
T Consensus        81 ~L~k~~I~LnRKvLs~lAi~dp~~F~~lv~~~k~~~  116 (117)
T d2j01u1          81 GLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQ  116 (117)
T ss_dssp             HHHTTCCSCSCTTTTTTTTSSHHHHHHHHHHHHHHT
T ss_pred             HHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHC
T ss_conf             999948866399999999609999999999998756


SCOP domain information

class: All alpha proteins
fold: PABP domain-like
superfamily: Ribosomal protein L20
family: Ribosomal protein L20
domain: Ribosomal protein L20
species: Thermus thermophilus [TaxId: 274]