BLAST/PSIBLAST alignment of GI: 254780318 and GI: 241207215 at iteration 1
>gi|241207215|ref|YP_002978311.1| 50S ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 134
>gi|240861105|gb|ACS58772.1| ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 134
 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKGFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVSAAKKAL 117