BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780318|ref|YP_003064731.1| ribosomal protein L20
[Candidatus Liberibacter asiaticus str. psy62]
         (123 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780318|ref|YP_003064731.1| ribosomal protein L20 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039995|gb|ACT56791.1| ribosomal protein L20 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 123

 Score =  241 bits (615), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL
Sbjct: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD
Sbjct: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120

Query: 121 VAS 123
           VAS
Sbjct: 121 VAS 123


>gi|315122258|ref|YP_004062747.1| ribosomal protein L20 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495660|gb|ADR52259.1| ribosomal protein L20 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 118

 Score =  196 bits (499), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 109/118 (92%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRGVVS+AKHKKVLK AKGFYGRRKNTIR AKAAVDRS+QYAYRDRRVKKRDFRSL
Sbjct: 1   MTRVKRGVVSNAKHKKVLKLAKGFYGRRKNTIRTAKAAVDRSRQYAYRDRRVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR+YDLNYSQFINGL KAGI LDR+ LS+LAI +  SF+KIV++S++ L+
Sbjct: 61  WIQRINAAVRLYDLNYSQFINGLQKAGITLDRRTLSELAIEKPGSFEKIVDVSKANLI 118


>gi|217977996|ref|YP_002362143.1| 50S ribosomal protein L20 [Methylocella silvestris BL2]
 gi|254800330|sp|B8EM00|RL20_METSB RecName: Full=50S ribosomal protein L20
 gi|217503372|gb|ACK50781.1| ribosomal protein L20 [Methylocella silvestris BL2]
          Length = 119

 Score =  172 bits (437), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/117 (73%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK L++AKGFYGRRKNTIRAAKAAVDRS QYA RDRR KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLEAAKGFYGRRKNTIRAAKAAVDRSMQYATRDRRAKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQR+NAAVR   L YS+FI+GL KAG+ +DRKVLSDLAITQ ++FK IV+ ++S L
Sbjct: 61  WIQRLNAAVRECGLTYSRFIDGLAKAGVAVDRKVLSDLAITQPEAFKAIVDKAKSAL 117


>gi|182679948|ref|YP_001834094.1| 50S ribosomal protein L20 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226730357|sp|B2IBH9|RL20_BEII9 RecName: Full=50S ribosomal protein L20
 gi|182635831|gb|ACB96605.1| ribosomal protein L20 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 121

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 85/117 (72%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK L++A GFYGRRKNTIRAAKAAVDRS QYA RDRRVKKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLEAATGFYGRRKNTIRAAKAAVDRSMQYATRDRRVKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQR+NAAVR   L YS+FI+GL KAG+ +DRKVLS+LAI+Q ++FK IVE ++S L
Sbjct: 61  WIQRLNAAVRELGLTYSRFIDGLAKAGVEIDRKVLSELAISQPEAFKAIVEQAKSAL 117


>gi|227824127|ref|YP_002828100.1| 50S ribosomal protein L20 [Sinorhizobium fredii NGR234]
 gi|254800334|sp|C3MCP9|RL20_RHISN RecName: Full=50S ribosomal protein L20
 gi|227343129|gb|ACP27347.1| 50S ribosomal protein L20 [Sinorhizobium fredii NGR234]
          Length = 134

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 83/117 (70%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKK LK+AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKTLKAAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE S+  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEASKKAL 117


>gi|114706183|ref|ZP_01439086.1| 50S ribosomal protein L20 [Fulvimarina pelagi HTCC2506]
 gi|114539029|gb|EAU42150.1| 50S ribosomal protein L20 [Fulvimarina pelagi HTCC2506]
          Length = 140

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/117 (70%), Positives = 101/117 (86%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIRAAKAAVDRS+QYA RDRR KKR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRAAKAAVDRSKQYATRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++FK + + S++ L
Sbjct: 61  WIQRINAAVREHGLTYGRFIDGLNKAGIEVDRKVLSDIAIHEPEAFKALCDQSKTAL 117


>gi|15964037|ref|NP_384390.1| 50S ribosomal protein L20 [Sinorhizobium meliloti 1021]
 gi|307301183|ref|ZP_07580945.1| ribosomal protein L20 [Sinorhizobium meliloti BL225C]
 gi|307321084|ref|ZP_07600489.1| ribosomal protein L20 [Sinorhizobium meliloti AK83]
 gi|20978619|sp|Q92ST1|RL20_RHIME RecName: Full=50S ribosomal protein L20
 gi|15073213|emb|CAC41721.1| Probable 50S ribosomal protein L20 [Sinorhizobium meliloti 1021]
 gi|306893256|gb|EFN24037.1| ribosomal protein L20 [Sinorhizobium meliloti AK83]
 gi|306903639|gb|EFN34226.1| ribosomal protein L20 [Sinorhizobium meliloti BL225C]
          Length = 134

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 83/117 (70%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK LK+AKGFYGRRKNTIRAAKAAVDRS+Q+AYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLKAAKGFYGRRKNTIRAAKAAVDRSKQFAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE S+  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEASKKAL 117


>gi|150398671|ref|YP_001329138.1| 50S ribosomal protein L20 [Sinorhizobium medicae WSM419]
 gi|166220787|sp|A6UF73|RL20_SINMW RecName: Full=50S ribosomal protein L20
 gi|150030186|gb|ABR62303.1| ribosomal protein L20 [Sinorhizobium medicae WSM419]
          Length = 134

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 83/117 (70%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK LK+AKGFYGRRKNTIRAAKAAVDRS+Q+AYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLKAAKGFYGRRKNTIRAAKAAVDRSKQFAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE S+  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEASKKAL 117


>gi|190889928|ref|YP_001976470.1| 50S ribosomal protein L20 [Rhizobium etli CIAT 652]
 gi|218514449|ref|ZP_03511289.1| 50S ribosomal protein L20 [Rhizobium etli 8C-3]
 gi|226730441|sp|B3PYE1|RL20_RHIE6 RecName: Full=50S ribosomal protein L20
 gi|190695207|gb|ACE89292.1| 50S ribosomal protein L20 [Rhizobium etli CIAT 652]
 gi|327191954|gb|EGE58935.1| 50S ribosomal protein L20 [Rhizobium etli CNPAF512]
          Length = 134

 Score =  170 bits (430), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 100/117 (85%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVNAAKKAL 117


>gi|116250036|ref|YP_765874.1| 50S ribosomal protein L20 [Rhizobium leguminosarum bv. viciae 3841]
 gi|166220733|sp|Q1MMP4|RL20_RHIL3 RecName: Full=50S ribosomal protein L20
 gi|115254684|emb|CAK05758.1| putative 50S ribosomal protein L20 [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 134

 Score =  169 bits (429), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKGFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVSAAKKAL 117


>gi|241207215|ref|YP_002978311.1| 50S ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240861105|gb|ACS58772.1| ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 134

 Score =  169 bits (429), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKGFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVSAAKKAL 117


>gi|90420459|ref|ZP_01228366.1| 50S ribosomal protein L20 [Aurantimonas manganoxydans SI85-9A1]
 gi|90335187|gb|EAS48940.1| 50S ribosomal protein L20 [Aurantimonas manganoxydans SI85-9A1]
          Length = 139

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK+LK A GFYGRRKNTIRAAKAAVDRS+QYA RDRRVKKR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKILKQAAGFYGRRKNTIRAAKAAVDRSKQYATRDRRVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + + Y +FI+GL+KAGI +DRKVLSD+AI + ++F  + E ++S L
Sbjct: 61  WIQRINAAVREHGMTYGRFIDGLNKAGIEVDRKVLSDIAIHEPEAFGALCEQAKSAL 117


>gi|222147172|ref|YP_002548129.1| 50S ribosomal protein L20 [Agrobacterium vitis S4]
 gi|254800292|sp|B9JYM9|RL20_AGRVS RecName: Full=50S ribosomal protein L20
 gi|221734162|gb|ACM35125.1| 50S ribosomal protein L20 [Agrobacterium vitis S4]
          Length = 134

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/117 (70%), Positives = 100/117 (85%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKHKKVLK+AKGFYGRRKNTIRAAKAAVDRS+Q+AYRDR+V KR+FR+L
Sbjct: 1   MSRVKRGVAAHAKHKKVLKAAKGFYGRRKNTIRAAKAAVDRSKQFAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE S+  L
Sbjct: 61  WIQRINAAVRESGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEASKKAL 117


>gi|209551837|ref|YP_002283754.1| 50S ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226730442|sp|B5ZXR9|RL20_RHILW RecName: Full=50S ribosomal protein L20
 gi|209537593|gb|ACI57528.1| ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 134

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVNAAKKAL 117


>gi|218680048|ref|ZP_03527945.1| 50S ribosomal protein L20 [Rhizobium etli CIAT 894]
          Length = 134

 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVAAHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVNAAKKAL 117


>gi|296446654|ref|ZP_06888595.1| ribosomal protein L20 [Methylosinus trichosporium OB3b]
 gi|296255882|gb|EFH02968.1| ribosomal protein L20 [Methylosinus trichosporium OB3b]
          Length = 121

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK L +AKGFYGRRKNTIRAAKAAVDRS QYA RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLDAAKGFYGRRKNTIRAAKAAVDRSMQYATRDRKAKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQR+N AVR + + YS+FI+GL KAG+++DRKVLS+LAI+Q ++FK +VE ++S L
Sbjct: 61  WIQRLNGAVREFGITYSRFIDGLTKAGVIIDRKVLSELAISQPEAFKALVEKAKSAL 117


>gi|154245876|ref|YP_001416834.1| ribosomal protein L20 [Xanthobacter autotrophicus Py2]
 gi|226730476|sp|A7IGN4|RL20_XANP2 RecName: Full=50S ribosomal protein L20
 gi|154159961|gb|ABS67177.1| ribosomal protein L20 [Xanthobacter autotrophicus Py2]
          Length = 120

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/119 (70%), Positives = 102/119 (85%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKV ++AKGFYGRRKNTIRAAK+AV+RS QYAYRDR+VKKR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVFEAAKGFYGRRKNTIRAAKSAVERSMQYAYRDRKVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLN--YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR  DL+  YS+FI+GL KAGI +DRKVLSD+AI + D+FK +VE +++ L
Sbjct: 61  WIQRINAGVRALDLDLTYSRFIDGLGKAGIEVDRKVLSDIAIHEPDAFKALVEKAKAAL 119


>gi|325291692|ref|YP_004277556.1| 50S ribosomal protein L20 [Agrobacterium sp. H13-3]
 gi|325059545|gb|ADY63236.1| 50S ribosomal protein L20 [Agrobacterium sp. H13-3]
          Length = 134

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 98/117 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKH K LK+AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSRAKHTKTLKAAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE ++  L
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGVLVETAKKAL 117


>gi|222084530|ref|YP_002543059.1| ribosomal protein L20 [Agrobacterium radiobacter K84]
 gi|254800291|sp|B9J7G2|RL20_AGRRK RecName: Full=50S ribosomal protein L20
 gi|221721978|gb|ACM25134.1| ribosomal protein L20 [Agrobacterium radiobacter K84]
          Length = 134

 Score =  167 bits (423), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 97/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK A+GFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKQARGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  S+  L
Sbjct: 61  WIQRINAAVREHGLTYGRFIDGLTKAGIEVDRKVLSDMAIHETEAFGALVAASKKAL 117


>gi|254501329|ref|ZP_05113480.1| ribosomal protein L20 [Labrenzia alexandrii DFL-11]
 gi|222437400|gb|EEE44079.1| ribosomal protein L20 [Labrenzia alexandrii DFL-11]
          Length = 119

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 79/117 (67%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK+AKG+YGRRKNTIR AK AV+++ QYAYRDR+ KKR+FRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLKAAKGYYGRRKNTIRVAKQAVEKAGQYAYRDRKAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R + + Y  FINGL+KAGI +DRKVLSDLAI+Q D+FK +V+ ++  L
Sbjct: 61  WIQRINAATRQHGMTYGTFINGLNKAGIEVDRKVLSDLAISQPDAFKALVDQAQGAL 117


>gi|15887606|ref|NP_353287.1| 50S ribosomal protein L20 [Agrobacterium tumefaciens str. C58]
 gi|22096073|sp|Q8UIN7|RL20_AGRT5 RecName: Full=50S ribosomal protein L20
 gi|15155149|gb|AAK86072.1| 50S ribosomal protein L20 [Agrobacterium tumefaciens str. C58]
          Length = 134

 Score =  166 bits (421), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 97/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKH K LK+AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSRAKHTKTLKAAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE ++  L
Sbjct: 61  WIQRINAAVRESGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEAAKKAL 117


>gi|307943570|ref|ZP_07658914.1| ribosomal protein L20 [Roseibium sp. TrichSKD4]
 gi|307773200|gb|EFO32417.1| ribosomal protein L20 [Roseibium sp. TrichSKD4]
          Length = 118

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/117 (66%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK+AKG+YGRRKNTIR AK AV+++ QYAYRDR+ KKR+FRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R + + Y +FI+GL+KAG+ +DRKVLSDLAI Q D+FK +VE ++  L
Sbjct: 61  WIQRINAATRQHGMTYGRFIDGLNKAGVEVDRKVLSDLAINQPDAFKALVEKAQGAL 117


>gi|86355920|ref|YP_467812.1| 50S ribosomal protein L20 [Rhizobium etli CFN 42]
 gi|109893142|sp|Q2KDK1|RL20_RHIEC RecName: Full=50S ribosomal protein L20
 gi|86280022|gb|ABC89085.1| 50S ribosomal protein L20 [Rhizobium etli CFN 42]
          Length = 134

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 94/106 (88%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIR AKAAVDR++QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVAAHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRAKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAF 106


>gi|118591292|ref|ZP_01548690.1| 50S ribosomal protein L20 [Stappia aggregata IAM 12614]
 gi|118435964|gb|EAV42607.1| 50S ribosomal protein L20 [Stappia aggregata IAM 12614]
          Length = 119

 Score =  164 bits (415), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/117 (66%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK+AKG+YGRRKNTIR AK AV+++ QYAYRDR+ KKR+FRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R + + Y +FI+GL+KAGI +DRKVLSDLAI Q D+FK +V+ ++  L
Sbjct: 61  WIQRINAATRQHGMTYGRFIDGLNKAGIEVDRKVLSDLAINQPDAFKALVDQAQGAL 117


>gi|323138785|ref|ZP_08073849.1| ribosomal protein L20 [Methylocystis sp. ATCC 49242]
 gi|322395933|gb|EFX98470.1| ribosomal protein L20 [Methylocystis sp. ATCC 49242]
          Length = 121

 Score =  164 bits (414), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 95/117 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK LK+AKGFYGRRKNTIR AKAAVDRS QYA RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLKAAKGFYGRRKNTIRTAKAAVDRSMQYATRDRKAKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQR+NAAVR + L YS+FI+GL KAG+ +DRKVLS LAI + ++F  IV  ++S L
Sbjct: 61  WIQRLNAAVREHGLTYSRFIDGLAKAGVAVDRKVLSQLAIEKPEAFAAIVAQAKSAL 117


>gi|328541820|ref|YP_004301929.1| Phenylalanyl-tRNA synthetase, alpha subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326411572|gb|ADZ68635.1| Phenylalanyl-tRNA synthetase, alpha subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 118

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/117 (66%), Positives = 100/117 (85%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK+AKGFYGRRKNTIR AK AV+++ QYAYRDR+V+KR+FRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLKAAKGFYGRRKNTIRIAKQAVEKAAQYAYRDRKVRKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R + + Y +FI+GL+KAGI +DRKVLSDLAI Q ++FK +V+ ++  L
Sbjct: 61  WIQRINAATREHGMTYGRFIDGLNKAGIEVDRKVLSDLAIHQPEAFKALVDKAQGAL 117


>gi|329849637|ref|ZP_08264483.1| ribosomal protein L20 [Asticcacaulis biprosthecum C19]
 gi|328841548|gb|EGF91118.1| ribosomal protein L20 [Asticcacaulis biprosthecum C19]
          Length = 119

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/117 (70%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVVS A+HKKVLK AKGFYGRRKNTIR AKAAVD++ QYAYRDRR KKR+FRSL
Sbjct: 1   MARVKRGVVSHARHKKVLKLAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRRTKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+    YSQFI+GL  AGI +DRKVLSD+A+     FK I E  R+ L
Sbjct: 61  WIQRINAAARIEGFTYSQFIHGLDVAGIDIDRKVLSDVAMNDEAGFKAIAEKVRTAL 117


>gi|312113591|ref|YP_004011187.1| ribosomal protein L20 [Rhodomicrobium vannielii ATCC 17100]
 gi|311218720|gb|ADP70088.1| ribosomal protein L20 [Rhodomicrobium vannielii ATCC 17100]
          Length = 124

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL+ AKGFYGRRKNTIR AK AV++S QYAYRDRR KKR+FRSL
Sbjct: 1   MSRVKRGVAAHARHKKVLEQAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRRTKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R + L Y +FI+GL+KAGI +DRKVLSD+AIT    F  +V  +R  L  +
Sbjct: 61  WIQRINAATREHGLTYGRFIDGLNKAGIEIDRKVLSDMAITDPTGFAALVGKAREALPAE 120

Query: 121 VAS 123
           + S
Sbjct: 121 LQS 123


>gi|240849766|ref|YP_002971154.1| 50S ribosomal protein L20 [Bartonella grahamii as4aup]
 gi|240266889|gb|ACS50477.1| 50S ribosomal protein L20 [Bartonella grahamii as4aup]
          Length = 133

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVRAEGLTYGRFIDGLSKAGIEVDRKVLSDIAIHEAEAFSALVASAKKAL 117


>gi|163867392|ref|YP_001608586.1| 50S ribosomal protein L20 [Bartonella tribocorum CIP 105476]
 gi|189041849|sp|A9ILQ7|RL20_BART1 RecName: Full=50S ribosomal protein L20
 gi|161017033|emb|CAK00591.1| 50S ribosomal protein L20 [Bartonella tribocorum CIP 105476]
          Length = 133

 Score =  162 bits (410), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVRAEGLTYGRFIDGLSKAGIEVDRKVLSDIAIYEAEAFSALVASAKKAL 117


>gi|254474236|ref|ZP_05087626.1| ribosomal protein L20 [Pseudovibrio sp. JE062]
 gi|211956610|gb|EEA91820.1| ribosomal protein L20 [Pseudovibrio sp. JE062]
          Length = 118

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 99/115 (86%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKV+K+AKG+YGRRKNTIR AK AV+++ QYAYRDR+ +KR+FR+L
Sbjct: 1   MSRVKRGVTAHARHKKVIKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKARKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAA R + + Y +FI+GL+KAGI +DRKVLSDLAI Q D+FK +VE +++
Sbjct: 61  WIQRINAATREHGMTYGRFIDGLNKAGIEVDRKVLSDLAINQPDAFKALVEKAQA 115


>gi|319403568|emb|CBI77150.1| 50S ribosomal protein L20 [Bartonella rochalimae ATCC BAA-1498]
 gi|319406480|emb|CBI80121.1| 50S ribosomal protein L20 [Bartonella sp. 1-1C]
          Length = 133

 Score =  161 bits (408), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 96/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVLK AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVVAHAKHKKVLKQAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVRV  L Y +FI+GL KAGI +DRK+LSD+AI     F  +V+ ++  L
Sbjct: 61  WIQRINAAVRVEGLTYGRFIDGLTKAGIEIDRKILSDIAIYDPTVFIALVDSAKKAL 117


>gi|158426072|ref|YP_001527364.1| 50S ribosomal protein L20 [Azorhizobium caulinodans ORS 571]
 gi|172047850|sp|A8HWM3|RL20_AZOC5 RecName: Full=50S ribosomal protein L20
 gi|158332961|dbj|BAF90446.1| ribosomal protein L20 [Azorhizobium caulinodans ORS 571]
          Length = 119

 Score =  161 bits (408), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 78/117 (66%), Positives = 96/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKV K+AKGFYGRRKNTIRAAK+AV+RS QY YRDR+VKKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVFKAAKGFYGRRKNTIRAAKSAVERSMQYNYRDRKVKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   + Y +FI+GL KAGI +DRKVLSD+A+ + ++ K +VE +++ L
Sbjct: 61  WIQRINAGVRELGMTYGRFIDGLGKAGIEVDRKVLSDIAVHEPETLKALVEKAQAAL 117


>gi|148251833|ref|YP_001236418.1| 50S ribosomal protein L20 [Bradyrhizobium sp. BTAi1]
 gi|166219612|sp|A5E8L8|RL20_BRASB RecName: Full=50S ribosomal protein L20
 gi|146404006|gb|ABQ32512.1| LSU ribosomal protein L20P [Bradyrhizobium sp. BTAi1]
          Length = 119

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 76/117 (64%), Positives = 99/117 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKHKKV K+AKG+YGRRKNTIR AK AV+++ QYA+RDR+ KKR FR+L
Sbjct: 1   MSRVKRGVTAHAKHKKVFKAAKGYYGRRKNTIRTAKQAVEKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQR+NAAVR ++L YS+FI+GL K+GI +DRKVLSDLAI +  +F+ IVE +++ L
Sbjct: 61  WIQRLNAAVRPFELTYSRFIDGLSKSGITVDRKVLSDLAINEPAAFQAIVEKAKAAL 117


>gi|220925396|ref|YP_002500698.1| 50S ribosomal protein L20 [Methylobacterium nodulans ORS 2060]
 gi|254800329|sp|B8IP77|RL20_METNO RecName: Full=50S ribosomal protein L20
 gi|219950003|gb|ACL60395.1| ribosomal protein L20 [Methylobacterium nodulans ORS 2060]
          Length = 125

 Score =  160 bits (406), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 78/122 (63%), Positives = 98/122 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQR+NAAVR + L YS+FI+GL KAGIV+DRK LS+LAI +  +F  +VE +++ L  +
Sbjct: 61  WIQRLNAAVREHGLTYSRFIDGLAKAGIVVDRKALSELAIHEPAAFSAVVEKAKAALPAE 120

Query: 121 VA 122
            A
Sbjct: 121 TA 122


>gi|49474905|ref|YP_032946.1| 50S ribosomal protein L20 [Bartonella henselae str. Houston-1]
 gi|81827762|sp|Q6G5E4|RL20_BARHE RecName: Full=50S ribosomal protein L20
 gi|49237710|emb|CAF26899.1| 50S ribosomal protein l20 [Bartonella henselae str. Houston-1]
          Length = 133

 Score =  160 bits (405), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 95/117 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI +  +F  +V  ++  L
Sbjct: 61  WIQRINAAVRAEGLTYGRFIDGLSKAGIEIDRKVLSDIAIHESAAFSALVASAKKAL 117


>gi|170743417|ref|YP_001772072.1| 50S ribosomal protein L20 [Methylobacterium sp. 4-46]
 gi|226730421|sp|B0UPJ6|RL20_METS4 RecName: Full=50S ribosomal protein L20
 gi|168197691|gb|ACA19638.1| ribosomal protein L20 [Methylobacterium sp. 4-46]
          Length = 125

 Score =  160 bits (405), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 78/122 (63%), Positives = 97/122 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ +KR+FRSL
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNRKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQR+NAA R + L YS+ I+GL KAGIV+DRK LS+LAI +  +F  +VE +R+ L  +
Sbjct: 61  WIQRLNAAAREHGLTYSRLIDGLAKAGIVVDRKALSELAIHEPAAFAAVVEQARAALPAE 120

Query: 121 VA 122
            A
Sbjct: 121 TA 122


>gi|121601857|ref|YP_989562.1| 50S ribosomal protein L20 [Bartonella bacilliformis KC583]
 gi|166219609|sp|A1UUA9|RL20_BARBK RecName: Full=50S ribosomal protein L20
 gi|120614034|gb|ABM44635.1| ribosomal protein L20 [Bartonella bacilliformis KC583]
          Length = 133

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 79/117 (67%), Positives = 95/117 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKK+LK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKILKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR+  L Y +FI+GL KAGI +DRKVLSD+AI +   F  +V  ++  L
Sbjct: 61  WIQRINAAVRMEGLTYGRFIDGLSKAGIEIDRKVLSDIAIHEPTVFSALVASAKKAL 117


>gi|319407949|emb|CBI81603.1| 50S ribosomal protein L20 [Bartonella schoenbuchensis R1]
          Length = 133

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 80/110 (72%), Positives = 92/110 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK A+GF GRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FRSL
Sbjct: 1   MARVKRGVTAHAKHKKVLKEAEGFRGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVRV  L Y +FI+GL KAGI +DRKVLSD+AI +  +F  +V
Sbjct: 61  WIQRINAAVRVEGLTYGRFIDGLSKAGIEIDRKVLSDIAIYEPTAFAALV 110


>gi|49473759|ref|YP_031801.1| 50S ribosomal protein L20 [Bartonella quintana str. Toulouse]
 gi|81827665|sp|Q6G1G7|RL20_BARQU RecName: Full=50S ribosomal protein L20
 gi|49239262|emb|CAF25583.1| 50s ribosomal protein l20 [Bartonella quintana str. Toulouse]
          Length = 133

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 96/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVVAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRIFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+A+ +  +F  +V  ++  L
Sbjct: 61  WIQRINAAVRAEGLTYGRFIDGLSKAGIEIDRKVLSDIAVHESAAFSALVASAKKAL 117


>gi|298290327|ref|YP_003692266.1| ribosomal protein L20 [Starkeya novella DSM 506]
 gi|296926838|gb|ADH87647.1| ribosomal protein L20 [Starkeya novella DSM 506]
          Length = 122

 Score =  160 bits (404), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 77/117 (65%), Positives = 96/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG++GRRKNTIR AK AV+++QQYAYRDR+VKKR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYFGRRKNTIRVAKQAVEKAQQYAYRDRKVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R     Y +FI+GL KAGI +DRKVLSD+AI +  +F  +VE +++ L
Sbjct: 61  WIQRINAATRELGFTYGRFIDGLGKAGIEVDRKVLSDIAIHEPAAFAALVEQAKAAL 117


>gi|146337307|ref|YP_001202355.1| 50S ribosomal protein L20 [Bradyrhizobium sp. ORS278]
 gi|166219613|sp|A4YJM9|RL20_BRASO RecName: Full=50S ribosomal protein L20
 gi|146190113|emb|CAL74105.1| 50S ribosomal subunit protein L20 [Bradyrhizobium sp. ORS278]
          Length = 119

 Score =  160 bits (404), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 76/109 (69%), Positives = 95/109 (87%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKHKKV K+AKGFYGRRKNTIRAAKAAV+++ QYA+RDR+ KKR FR+L
Sbjct: 1   MSRVKRGVTAHAKHKKVYKAAKGFYGRRKNTIRAAKAAVEKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKI 109
           WIQR+NAAVR ++L YS+FI+GL K+GI +DRKVLSDLAI +  +F+ I
Sbjct: 61  WIQRLNAAVRPFELTYSRFIDGLSKSGITVDRKVLSDLAINEPAAFEAI 109


>gi|27375818|ref|NP_767347.1| 50S ribosomal protein L20 [Bradyrhizobium japonicum USDA 110]
 gi|31563106|sp|Q89WI0|RL20_BRAJA RecName: Full=50S ribosomal protein L20
 gi|27348956|dbj|BAC45972.1| 50S ribosomal protein L20 [Bradyrhizobium japonicum USDA 110]
          Length = 119

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 93/107 (86%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKHKKV K+AKGFYGRRKNTIRAAK AV+++QQYA+RDR+ KKR FR+L
Sbjct: 1   MSRVKRGVTAHAKHKKVYKAAKGFYGRRKNTIRAAKPAVEKAQQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WIQR+NAAVR + L YS+FI+GL K+GI +DRKVLSDLAI +  SF+
Sbjct: 61  WIQRLNAAVRPFGLTYSRFIDGLAKSGITVDRKVLSDLAINEPASFQ 107


>gi|319898275|ref|YP_004158368.1| 50S ribosomal protein L20 [Bartonella clarridgeiae 73]
 gi|319402239|emb|CBI75772.1| 50S ribosomal protein L20 [Bartonella clarridgeiae 73]
          Length = 133

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/117 (66%), Positives = 94/117 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKK+LK A+GFYGRRKNTIRAAK AVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKILKQAEGFYGRRKNTIRAAKTAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVRV  L Y +FI+GL KAGI +DRK+LSD+AI +   F  +V  ++  L
Sbjct: 61  WIQRINAAVRVEGLTYGRFIDGLSKAGIKIDRKILSDIAINEPTIFNALVASAKKAL 117


>gi|197106437|ref|YP_002131814.1| 50S ribosomal protein L20 [Phenylobacterium zucineum HLK1]
 gi|226730433|sp|B4R9C5|RL20_PHEZH RecName: Full=50S ribosomal protein L20
 gi|196479857|gb|ACG79385.1| 50S ribosomal protein L20 [Phenylobacterium zucineum HLK1]
          Length = 118

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVL+ AKGFYGRRKNTIRAAKAAVD++ QYAYRDR+V+KR+FRSL
Sbjct: 1   MARVKRGVVAHAKHKKVLEQAKGFYGRRKNTIRAAKAAVDKAGQYAYRDRKVRKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+    YS+FI GL KAGI +DRKVL+D+A      FK I +  R+ L
Sbjct: 61  WIQRINAAARLEGFTYSRFIFGLEKAGIEMDRKVLADIAGNDPAGFKAIADKVRAAL 117


>gi|86747171|ref|YP_483667.1| 50S ribosomal protein L20 [Rhodopseudomonas palustris HaA2]
 gi|109893144|sp|Q2J454|RL20_RHOP2 RecName: Full=50S ribosomal protein L20
 gi|86570199|gb|ABD04756.1| LSU ribosomal protein L20P [Rhodopseudomonas palustris HaA2]
          Length = 119

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/107 (72%), Positives = 92/107 (85%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV K+AKGF GRRKNTIRAAKAAVD++ QYA+RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVYKAAKGFRGRRKNTIRAAKAAVDKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WIQRINAAVR + + YS FINGL K+GIV+DRKVLSDLAIT+  +F+
Sbjct: 61  WIQRINAAVRPFGMTYSVFINGLSKSGIVVDRKVLSDLAITEPAAFQ 107


>gi|319404994|emb|CBI78603.1| 50S ribosomal protein L20 [Bartonella sp. AR 15-3]
          Length = 133

 Score =  159 bits (401), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/117 (67%), Positives = 95/117 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVIAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR+  L Y +FI+GL KAGI +DRK+LSD+AI     F  +V  ++  L
Sbjct: 61  WIQRINAAVRIEGLTYGRFIDGLSKAGIKIDRKILSDIAIYDPAVFTALVASAKKAL 117


>gi|163793840|ref|ZP_02187814.1| ribosomal protein L20 [alpha proteobacterium BAL199]
 gi|159180951|gb|EDP65468.1| ribosomal protein L20 [alpha proteobacterium BAL199]
          Length = 119

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 95/117 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  A G+YGRRKN  R A  AV+++QQYAYRDR+V+KR+FR+L
Sbjct: 1   MARVKRGVTAHARHKKVIDKAAGYYGRRKNVFRVAVQAVEKAQQYAYRDRKVRKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR+Y + YS F+NG+  AGI LDRKVLSDLAI + D+FK+IVE +++ L
Sbjct: 61  WIQRINAGVRLYGMTYSTFMNGMKLAGIELDRKVLSDLAIREPDAFKQIVEQAKAAL 117


>gi|16125297|ref|NP_419861.1| 50S ribosomal protein L20 [Caulobacter crescentus CB15]
 gi|221234034|ref|YP_002516470.1| 50S ribosomal protein L20 [Caulobacter crescentus NA1000]
 gi|20978654|sp|Q9A9E3|RL20_CAUCR RecName: Full=50S ribosomal protein L20
 gi|254800308|sp|B8H308|RL20_CAUCN RecName: Full=50S ribosomal protein L20
 gi|13422341|gb|AAK23029.1| ribosomal protein L20 [Caulobacter crescentus CB15]
 gi|220963206|gb|ACL94562.1| LSU ribosomal protein L20P [Caulobacter crescentus NA1000]
          Length = 118

 Score =  158 bits (399), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 79/117 (67%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVL+ AKGFYGRRKNTIR AKAAVD++ QYAYRDR+V+KR FRSL
Sbjct: 1   MARVKRGVVAHAKHKKVLEQAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRKVRKRAFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R+    YSQFI+GL  AGIV+DRKVL+D+A     +FK I +  R+ L
Sbjct: 61  WIQRINAGARLEGFTYSQFIHGLDVAGIVMDRKVLADIAGNDPAAFKAIADKVRAAL 117


>gi|209883594|ref|YP_002287451.1| ribosomal protein L20 [Oligotropha carboxidovorans OM5]
 gi|226730429|sp|B6JCK6|RL20_OLICO RecName: Full=50S ribosomal protein L20
 gi|209871790|gb|ACI91586.1| ribosomal protein L20 [Oligotropha carboxidovorans OM5]
          Length = 119

 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 93/107 (86%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV K+A+GF GRRKNTIRAAKAAVD++QQYAY  R++KKR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVYKAAEGFRGRRKNTIRAAKAAVDKAQQYAYVGRKLKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WIQRINAAVR + L YS+FINGL K+G+V+DRKVLSDLAI +  +F+
Sbjct: 61  WIQRINAAVRPFGLTYSRFINGLAKSGVVIDRKVLSDLAIHEPAAFQ 107


>gi|167645156|ref|YP_001682819.1| 50S ribosomal protein L20 [Caulobacter sp. K31]
 gi|189041852|sp|B0SXZ8|RL20_CAUSK RecName: Full=50S ribosomal protein L20
 gi|167347586|gb|ABZ70321.1| ribosomal protein L20 [Caulobacter sp. K31]
          Length = 119

 Score =  157 bits (397), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL+ AKGFYGRRKNTIR AKAAVD++ QYAYRDR+V+KR FRSL
Sbjct: 1   MARVKRGVTAHAKHKKVLEQAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRKVRKRAFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  RV    YSQFI+GL  AGIV+DRKVLSD+A     +FK I +  R+ L
Sbjct: 61  WIQRINAGARVEGFTYSQFIHGLDVAGIVIDRKVLSDIAGQDPVAFKAIADKVRAAL 117


>gi|295690593|ref|YP_003594286.1| 50S 50S ribosomal protein L20 [Caulobacter segnis ATCC 21756]
 gi|295432496|gb|ADG11668.1| ribosomal protein L20 [Caulobacter segnis ATCC 21756]
          Length = 118

 Score =  157 bits (397), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 79/117 (67%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVL+ AKGFYGRRKNTIR AKAAVD++ QYAYRDR+V+KR FRSL
Sbjct: 1   MARVKRGVVAHAKHKKVLEQAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRKVRKRAFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R+    YSQFI+GL  AGIV+DRKVL+D+A     +FK I +  R+ L
Sbjct: 61  WIQRINAGARLEGFTYSQFIHGLDVAGIVMDRKVLADIAGADPVAFKAIADKVRAAL 117


>gi|110633031|ref|YP_673239.1| 50S ribosomal protein L20 [Mesorhizobium sp. BNC1]
 gi|122966206|sp|Q11KK1|RL20_MESSB RecName: Full=50S ribosomal protein L20
 gi|110284015|gb|ABG62074.1| LSU ribosomal protein L20P [Chelativorans sp. BNC1]
          Length = 133

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 96/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIR AK AV++S QYAYRDR+ +KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R + L Y +FI+GL+KAGI +DRKVL+D+A+ +  +F  +V  S++ L
Sbjct: 61  WIQRINAATREHGLTYGRFIDGLNKAGIEIDRKVLADMAVHEPQAFAALVAKSKASL 117


>gi|188580862|ref|YP_001924307.1| 50S ribosomal protein L20 [Methylobacterium populi BJ001]
 gi|226730419|sp|B1ZGB4|RL20_METPB RecName: Full=50S ribosomal protein L20
 gi|179344360|gb|ACB79772.1| ribosomal protein L20 [Methylobacterium populi BJ001]
          Length = 121

 Score =  156 bits (395), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 77/117 (65%), Positives = 94/117 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQR+NAAVR + L YS+FIN L K+GI +DRK LS+LAI +  +F  +VE ++S L
Sbjct: 61  WIQRLNAAVREHGLTYSRFINALAKSGIEVDRKALSELAIHEPAAFAAVVEKAKSAL 117


>gi|254417803|ref|ZP_05031527.1| ribosomal protein L20 [Brevundimonas sp. BAL3]
 gi|196183980|gb|EDX78956.1| ribosomal protein L20 [Brevundimonas sp. BAL3]
          Length = 117

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 91/117 (77%), Gaps = 1/117 (0%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVL+ AKGF GRRKNTIR AKAAVDR+ QYAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLEQAKGFSGRRKNTIRTAKAAVDRAGQYAYRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+    YSQFINGL+KAGI LDRKVL+ +A      FK + +  R+ L
Sbjct: 61  WIQRINAAARIEGFTYSQFINGLNKAGIELDRKVLASIAADGA-GFKAVADKVRAAL 116


>gi|40062679|gb|AAR37592.1| ribosomal protein L20 [uncultured marine bacterium 314]
          Length = 118

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/117 (65%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S A+HKKVLK  KG YGRRKNTIR AK A++++ QYAYRDRR KKR+FRSL
Sbjct: 1   MARVKRGVTSHARHKKVLKQVKGQYGRRKNTIRVAKQALEKAMQYAYRDRRAKKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   + YS+FINGL+K+GI LDRKVL+D+A    ++FK IV+  +S L
Sbjct: 61  WIQRINAGVRAEGITYSKFINGLNKSGIKLDRKVLADIAYNNPEAFKSIVKKVQSSL 117


>gi|329891065|ref|ZP_08269408.1| ribosomal protein L20 [Brevundimonas diminuta ATCC 11568]
 gi|328846366|gb|EGF95930.1| ribosomal protein L20 [Brevundimonas diminuta ATCC 11568]
          Length = 117

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 91/117 (77%), Gaps = 1/117 (0%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV RGV S AKHKKVLK AKGFYGRRKNTIRAAKAAVDR+ QYAYRDRR KKR FR+L
Sbjct: 1   MARVTRGVTSHAKHKKVLKQAKGFYGRRKNTIRAAKAAVDRAGQYAYRDRRNKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R     YSQF++GL+KAGI LDRKVL+ +A  +   FK I +  R+ L
Sbjct: 61  WIQRINAAARTEGFTYSQFMHGLNKAGIELDRKVLAAIAADEA-GFKGIADKVRAAL 116


>gi|163851055|ref|YP_001639098.1| ribosomal protein L20 [Methylobacterium extorquens PA1]
 gi|240138189|ref|YP_002962661.1| 50S ribosomal protein L20 [Methylobacterium extorquens AM1]
 gi|254560749|ref|YP_003067844.1| 50S ribosomal protein L20 [Methylobacterium extorquens DM4]
 gi|226730417|sp|A9W371|RL20_METEP RecName: Full=50S ribosomal protein L20
 gi|163662660|gb|ABY30027.1| ribosomal protein L20 [Methylobacterium extorquens PA1]
 gi|240008158|gb|ACS39384.1| 50S ribosomal protein L20 [Methylobacterium extorquens AM1]
 gi|254268027|emb|CAX23898.1| 50S ribosomal protein L20 [Methylobacterium extorquens DM4]
          Length = 121

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/117 (64%), Positives = 94/117 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQR+NAAVR + L YS+FIN L ++GI +DRK LS+LAI +  +F  +VE ++S L
Sbjct: 61  WIQRLNAAVREHGLTYSRFINALAQSGIEVDRKALSELAIHEPAAFAAVVEKAKSAL 117


>gi|153008136|ref|YP_001369351.1| 50S ribosomal protein L20 [Ochrobactrum anthropi ATCC 49188]
 gi|239833161|ref|ZP_04681490.1| ribosomal protein L20 [Ochrobactrum intermedium LMG 3301]
 gi|166219670|sp|A6WX18|RL20_OCHA4 RecName: Full=50S ribosomal protein L20
 gi|151560024|gb|ABS13522.1| ribosomal protein L20 [Ochrobactrum anthropi ATCC 49188]
 gi|239825428|gb|EEQ96996.1| ribosomal protein L20 [Ochrobactrum intermedium LMG 3301]
          Length = 134

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/117 (66%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL  A GF GRRKNTIR AKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLDQAAGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + D+F  +V  ++  L
Sbjct: 61  WIQRINAAVREQGLTYGRFIDGLAKAGIEIDRKVLSDIAIHEPDAFGALVASAKKAL 117


>gi|91974647|ref|YP_567306.1| 50S ribosomal protein L20 [Rhodopseudomonas palustris BisB5]
 gi|123735863|sp|Q13ET4|RL20_RHOPS RecName: Full=50S ribosomal protein L20
 gi|91681103|gb|ABE37405.1| LSU ribosomal protein L20P [Rhodopseudomonas palustris BisB5]
          Length = 119

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV K AKGF GRRKNTIRAAKAAVD++ QYA+RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVYKLAKGFRGRRKNTIRAAKAAVDKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WIQRINAAVR   + YS FINGL K+G+++DRKVLSDLAIT+  +F+
Sbjct: 61  WIQRINAAVRPLGMTYSVFINGLAKSGVIVDRKVLSDLAITEPAAFQ 107


>gi|170749558|ref|YP_001755818.1| ribosomal protein L20 [Methylobacterium radiotolerans JCM 2831]
 gi|226730420|sp|B1M6P4|RL20_METRJ RecName: Full=50S ribosomal protein L20
 gi|170656080|gb|ACB25135.1| ribosomal protein L20 [Methylobacterium radiotolerans JCM 2831]
          Length = 125

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 89/106 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGMQYAYRDRKNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQR+NAAVR + L YS+FI+GL K+GIV+DRK LS+LAI +  SF
Sbjct: 61  WIQRLNAAVREHGLTYSRFIDGLAKSGIVVDRKALSELAIHEPASF 106


>gi|294084798|ref|YP_003551558.1| 50S ribosomal protein L20 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664373|gb|ADE39474.1| ribosomal protein L20 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 117

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 70/115 (60%), Positives = 93/115 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + A+H KV+K+AKG+YGRRKNT R A  AVD+++QYAYRDRRV+KR+FR+L
Sbjct: 1   MARVKRGTTTHARHGKVIKAAKGYYGRRKNTFRTATQAVDKARQYAYRDRRVRKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAA R++ + YSQ + GL KAGI +DRK+L+DLA+ +  +F  +VE SR+
Sbjct: 61  WIQRINAAARIHGITYSQMMGGLIKAGIEIDRKMLADLAVNEPAAFTALVERSRA 115


>gi|17988290|ref|NP_540924.1| 50S ribosomal protein L20 [Brucella melitensis bv. 1 str. 16M]
 gi|23502968|ref|NP_699095.1| 50S ribosomal protein L20 [Brucella suis 1330]
 gi|62290960|ref|YP_222753.1| 50S ribosomal protein L20 [Brucella abortus bv. 1 str. 9-941]
 gi|82700871|ref|YP_415445.1| 50S ribosomal protein L20 [Brucella melitensis biovar Abortus 2308]
 gi|148559518|ref|YP_001259919.1| 50S ribosomal protein L20 [Brucella ovis ATCC 25840]
 gi|161620031|ref|YP_001593918.1| 50S ribosomal protein L20 [Brucella canis ATCC 23365]
 gi|163844136|ref|YP_001628540.1| 50S ribosomal protein L20 [Brucella suis ATCC 23445]
 gi|189025174|ref|YP_001935942.1| 50S ribosomal protein L20 [Brucella abortus S19]
 gi|225626493|ref|ZP_03784532.1| ribosomal protein L20 [Brucella ceti str. Cudo]
 gi|225853547|ref|YP_002733780.1| 50S ribosomal protein L20 [Brucella melitensis ATCC 23457]
 gi|237816465|ref|ZP_04595458.1| ribosomal protein L20 [Brucella abortus str. 2308 A]
 gi|254690255|ref|ZP_05153509.1| 50S ribosomal protein L20 [Brucella abortus bv. 6 str. 870]
 gi|254694742|ref|ZP_05156570.1| 50S ribosomal protein L20 [Brucella abortus bv. 3 str. Tulya]
 gi|254696371|ref|ZP_05158199.1| 50S ribosomal protein L20 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700752|ref|ZP_05162580.1| 50S ribosomal protein L20 [Brucella suis bv. 5 str. 513]
 gi|254705124|ref|ZP_05166952.1| 50S ribosomal protein L20 [Brucella suis bv. 3 str. 686]
 gi|254707360|ref|ZP_05169188.1| 50S ribosomal protein L20 [Brucella pinnipedialis M163/99/10]
 gi|254709097|ref|ZP_05170908.1| 50S ribosomal protein L20 [Brucella pinnipedialis B2/94]
 gi|254713477|ref|ZP_05175288.1| 50S ribosomal protein L20 [Brucella ceti M644/93/1]
 gi|254716167|ref|ZP_05177978.1| 50S ribosomal protein L20 [Brucella ceti M13/05/1]
 gi|254718163|ref|ZP_05179974.1| 50S ribosomal protein L20 [Brucella sp. 83/13]
 gi|254731285|ref|ZP_05189863.1| 50S ribosomal protein L20 [Brucella abortus bv. 4 str. 292]
 gi|256030622|ref|ZP_05444236.1| 50S ribosomal protein L20 [Brucella pinnipedialis M292/94/1]
 gi|256045725|ref|ZP_05448603.1| 50S ribosomal protein L20 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112446|ref|ZP_05453367.1| 50S ribosomal protein L20 [Brucella melitensis bv. 3 str. Ether]
 gi|256158621|ref|ZP_05456508.1| 50S ribosomal protein L20 [Brucella ceti M490/95/1]
 gi|256254029|ref|ZP_05459565.1| 50S ribosomal protein L20 [Brucella ceti B1/94]
 gi|256258508|ref|ZP_05464044.1| 50S ribosomal protein L20 [Brucella abortus bv. 9 str. C68]
 gi|256262968|ref|ZP_05465500.1| 50S ribosomal protein L20 [Brucella melitensis bv. 2 str. 63/9]
 gi|256370518|ref|YP_003108029.1| 50S ribosomal protein L20 [Brucella microti CCM 4915]
 gi|260169527|ref|ZP_05756338.1| 50S ribosomal protein L20 [Brucella sp. F5/99]
 gi|260546224|ref|ZP_05821964.1| ribosomal protein L20 [Brucella abortus NCTC 8038]
 gi|260563024|ref|ZP_05833510.1| ribosomal protein L20 [Brucella melitensis bv. 1 str. 16M]
 gi|260567409|ref|ZP_05837879.1| ribosomal protein L20 [Brucella suis bv. 4 str. 40]
 gi|260755794|ref|ZP_05868142.1| 50S ribosomal protein L20 [Brucella abortus bv. 6 str. 870]
 gi|260759017|ref|ZP_05871365.1| 50S ribosomal protein L20 [Brucella abortus bv. 4 str. 292]
 gi|260760742|ref|ZP_05873085.1| 50S ribosomal protein L20 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884818|ref|ZP_05896432.1| 50S ribosomal protein L20 [Brucella abortus bv. 9 str. C68]
 gi|261215069|ref|ZP_05929350.1| 50S ribosomal protein L20 [Brucella abortus bv. 3 str. Tulya]
 gi|261217939|ref|ZP_05932220.1| 50S ribosomal protein L20 [Brucella ceti M13/05/1]
 gi|261221168|ref|ZP_05935449.1| 50S ribosomal protein L20 [Brucella ceti B1/94]
 gi|261314845|ref|ZP_05954042.1| 50S ribosomal protein L20 [Brucella pinnipedialis M163/99/10]
 gi|261316596|ref|ZP_05955793.1| 50S ribosomal protein L20 [Brucella pinnipedialis B2/94]
 gi|261321211|ref|ZP_05960408.1| 50S ribosomal protein L20 [Brucella ceti M644/93/1]
 gi|261751261|ref|ZP_05994970.1| 50S ribosomal protein L20 [Brucella suis bv. 5 str. 513]
 gi|261755826|ref|ZP_05999535.1| 50S ribosomal protein L20 [Brucella suis bv. 3 str. 686]
 gi|261759054|ref|ZP_06002763.1| ribosomal protein L20 [Brucella sp. F5/99]
 gi|265983117|ref|ZP_06095852.1| 50S ribosomal protein L20 [Brucella sp. 83/13]
 gi|265987668|ref|ZP_06100225.1| 50S ribosomal protein L20 [Brucella pinnipedialis M292/94/1]
 gi|265992143|ref|ZP_06104700.1| 50S ribosomal protein L20 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993881|ref|ZP_06106438.1| 50S ribosomal protein L20 [Brucella melitensis bv. 3 str. Ether]
 gi|265997128|ref|ZP_06109685.1| 50S ribosomal protein L20 [Brucella ceti M490/95/1]
 gi|294851346|ref|ZP_06792019.1| 50S ribosomal protein L20 [Brucella sp. NVSL 07-0026]
 gi|297247346|ref|ZP_06931064.1| 50S ribosomal protein L20 [Brucella abortus bv. 5 str. B3196]
 gi|306837677|ref|ZP_07470546.1| ribosomal protein L20 [Brucella sp. NF 2653]
 gi|306842767|ref|ZP_07475409.1| ribosomal protein L20 [Brucella sp. BO2]
 gi|54039124|sp|P66102|RL20_BRUSU RecName: Full=50S ribosomal protein L20
 gi|54041828|sp|P66101|RL20_BRUME RecName: Full=50S ribosomal protein L20
 gi|81309345|sp|Q57AE2|RL20_BRUAB RecName: Full=50S ribosomal protein L20
 gi|109893099|sp|Q2YQV7|RL20_BRUA2 RecName: Full=50S ribosomal protein L20
 gi|166219614|sp|A5VT72|RL20_BRUO2 RecName: Full=50S ribosomal protein L20
 gi|189041850|sp|A9M9V2|RL20_BRUC2 RecName: Full=50S ribosomal protein L20
 gi|189041851|sp|B0CJL8|RL20_BRUSI RecName: Full=50S ribosomal protein L20
 gi|226730363|sp|B2S9B6|RL20_BRUA1 RecName: Full=50S ribosomal protein L20
 gi|254800304|sp|C0RG04|RL20_BRUMB RecName: Full=50S ribosomal protein L20
 gi|17984061|gb|AAL53188.1| lsu ribosomal protein l20p [Brucella melitensis bv. 1 str. 16M]
 gi|23349005|gb|AAN31010.1| ribosomal protein L20 [Brucella suis 1330]
 gi|62197092|gb|AAX75392.1| RplT, ribosomal protein L20 [Brucella abortus bv. 1 str. 9-941]
 gi|82616972|emb|CAJ12080.1| Ribosomal protein L20, bacterial and organelle form:Ribosomal
           protein L20 [Brucella melitensis biovar Abortus 2308]
 gi|148370775|gb|ABQ60754.1| ribosomal protein L20 [Brucella ovis ATCC 25840]
 gi|161336842|gb|ABX63147.1| ribosomal protein L20 [Brucella canis ATCC 23365]
 gi|163674859|gb|ABY38970.1| ribosomal protein L20 [Brucella suis ATCC 23445]
 gi|189020746|gb|ACD73468.1| Ribosomal protein L20 [Brucella abortus S19]
 gi|225618150|gb|EEH15193.1| ribosomal protein L20 [Brucella ceti str. Cudo]
 gi|225641912|gb|ACO01826.1| ribosomal protein L20 [Brucella melitensis ATCC 23457]
 gi|237788532|gb|EEP62747.1| ribosomal protein L20 [Brucella abortus str. 2308 A]
 gi|256000681|gb|ACU49080.1| 50S ribosomal protein L20 [Brucella microti CCM 4915]
 gi|260096331|gb|EEW80207.1| ribosomal protein L20 [Brucella abortus NCTC 8038]
 gi|260153040|gb|EEW88132.1| ribosomal protein L20 [Brucella melitensis bv. 1 str. 16M]
 gi|260156927|gb|EEW92007.1| ribosomal protein L20 [Brucella suis bv. 4 str. 40]
 gi|260669335|gb|EEX56275.1| 50S ribosomal protein L20 [Brucella abortus bv. 4 str. 292]
 gi|260671174|gb|EEX57995.1| 50S ribosomal protein L20 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675902|gb|EEX62723.1| 50S ribosomal protein L20 [Brucella abortus bv. 6 str. 870]
 gi|260874346|gb|EEX81415.1| 50S ribosomal protein L20 [Brucella abortus bv. 9 str. C68]
 gi|260916676|gb|EEX83537.1| 50S ribosomal protein L20 [Brucella abortus bv. 3 str. Tulya]
 gi|260919752|gb|EEX86405.1| 50S ribosomal protein L20 [Brucella ceti B1/94]
 gi|260923028|gb|EEX89596.1| 50S ribosomal protein L20 [Brucella ceti M13/05/1]
 gi|261293901|gb|EEX97397.1| 50S ribosomal protein L20 [Brucella ceti M644/93/1]
 gi|261295819|gb|EEX99315.1| 50S ribosomal protein L20 [Brucella pinnipedialis B2/94]
 gi|261303871|gb|EEY07368.1| 50S ribosomal protein L20 [Brucella pinnipedialis M163/99/10]
 gi|261739038|gb|EEY27034.1| ribosomal protein L20 [Brucella sp. F5/99]
 gi|261741014|gb|EEY28940.1| 50S ribosomal protein L20 [Brucella suis bv. 5 str. 513]
 gi|261745579|gb|EEY33505.1| 50S ribosomal protein L20 [Brucella suis bv. 3 str. 686]
 gi|262551596|gb|EEZ07586.1| 50S ribosomal protein L20 [Brucella ceti M490/95/1]
 gi|262764862|gb|EEZ10783.1| 50S ribosomal protein L20 [Brucella melitensis bv. 3 str. Ether]
 gi|263003209|gb|EEZ15502.1| 50S ribosomal protein L20 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092842|gb|EEZ17017.1| 50S ribosomal protein L20 [Brucella melitensis bv. 2 str. 63/9]
 gi|264659865|gb|EEZ30126.1| 50S ribosomal protein L20 [Brucella pinnipedialis M292/94/1]
 gi|264661709|gb|EEZ31970.1| 50S ribosomal protein L20 [Brucella sp. 83/13]
 gi|294819935|gb|EFG36934.1| 50S ribosomal protein L20 [Brucella sp. NVSL 07-0026]
 gi|297174515|gb|EFH33862.1| 50S ribosomal protein L20 [Brucella abortus bv. 5 str. B3196]
 gi|306287111|gb|EFM58616.1| ribosomal protein L20 [Brucella sp. BO2]
 gi|306407235|gb|EFM63445.1| ribosomal protein L20 [Brucella sp. NF 2653]
 gi|326410119|gb|ADZ67184.1| Ribosomal protein L20 [Brucella melitensis M28]
 gi|326539837|gb|ADZ88052.1| ribosomal protein L20 [Brucella melitensis M5-90]
          Length = 134

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/117 (65%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL  A GF GRRKNTIR AKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLDQAAGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREQGLTYGRFIDGLAKAGIEIDRKVLSDIAIHEPEAFAALVASAKKAL 117


>gi|306843539|ref|ZP_07476140.1| ribosomal protein L20 [Brucella sp. BO1]
 gi|306276230|gb|EFM57930.1| ribosomal protein L20 [Brucella sp. BO1]
          Length = 134

 Score =  153 bits (387), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/117 (65%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL  A GF GRRKNTIR AKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLDQAAGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREQGLTYGRFIDGLAKAGIEIDRKVLSDIAIHEPEAFTALVASAKKAL 117


>gi|154250675|ref|YP_001411499.1| 50S ribosomal protein L20 [Parvibaculum lavamentivorans DS-1]
 gi|171769552|sp|A7HPK9|RL20_PARL1 RecName: Full=50S ribosomal protein L20
 gi|154154625|gb|ABS61842.1| ribosomal protein L20 [Parvibaculum lavamentivorans DS-1]
          Length = 118

 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 96/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+H+K++K AKG+YGRRKN  R A  AV+++ QYAYRDRR +KR+FR+L
Sbjct: 1   MSRVKRGVTAHARHRKIIKKAKGYYGRRKNAFRTANQAVEKAGQYAYRDRRTRKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR + L YS+FI+GL KAGI +DRKVLSD+AI + ++FK +VE +++ L
Sbjct: 61  WIQRINAGVREHGLTYSRFIDGLAKAGIEVDRKVLSDIAIHEPEAFKALVEQAQAAL 117


>gi|254455319|ref|ZP_05068748.1| ribosomal protein L20 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082321|gb|EDZ59747.1| ribosomal protein L20 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 118

 Score =  153 bits (386), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+ KG +GRRKNTIR AK A++++ QYAYRDRR KKRDF++L
Sbjct: 1   MARVKRGVTSKAKHKKVLKAVKGQWGRRKNTIRVAKQAMEKAMQYAYRDRRNKKRDFKAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   L YS+FINGL K G+ +DRK+L+++A    ++FK IV+ ++S L
Sbjct: 61  WIQRINAGVRAEGLTYSKFINGLSKCGVTIDRKILAEIAYDSPEAFKTIVQKAQSAL 117


>gi|299133288|ref|ZP_07026483.1| ribosomal protein L20 [Afipia sp. 1NLS2]
 gi|298593425|gb|EFI53625.1| ribosomal protein L20 [Afipia sp. 1NLS2]
          Length = 119

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 92/107 (85%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV K+A+GF GRRKNTIRAAKAAVD++ QYA+  R++KKR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVYKAAEGFRGRRKNTIRAAKAAVDKAGQYAFVGRKLKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WIQRINAAVR + L YS+FINGL K+G+V+DRKVLSDLAI +  +F+
Sbjct: 61  WIQRINAAVRPFGLTYSRFINGLAKSGVVVDRKVLSDLAIHEPAAFQ 107


>gi|13474219|ref|NP_105787.1| 50S ribosomal protein L20 [Mesorhizobium loti MAFF303099]
 gi|260463245|ref|ZP_05811447.1| ribosomal protein L20 [Mesorhizobium opportunistum WSM2075]
 gi|20978642|sp|Q98CP8|RL20_RHILO RecName: Full=50S ribosomal protein L20
 gi|14024971|dbj|BAB51573.1| ribosomal protein L20 [Mesorhizobium loti MAFF303099]
 gi|259031095|gb|EEW32369.1| ribosomal protein L20 [Mesorhizobium opportunistum WSM2075]
          Length = 133

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/106 (68%), Positives = 88/106 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKGFYGRRKNTIR AK AV++S QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAA   + L Y +FI+GL+KAGI +DRK+LSD+AI +  +F
Sbjct: 61  WIQRINAATHEHGLTYGRFIDGLNKAGIEIDRKILSDMAIHEPQAF 106


>gi|256060084|ref|ZP_05450266.1| 50S ribosomal protein L20 [Brucella neotomae 5K33]
 gi|261324059|ref|ZP_05963256.1| 50S ribosomal protein L20 [Brucella neotomae 5K33]
 gi|261300039|gb|EEY03536.1| 50S ribosomal protein L20 [Brucella neotomae 5K33]
          Length = 134

 Score =  152 bits (384), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 77/117 (65%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL  A GF GRRKNTIR AKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLDQAAGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREQGLTYGRFIDGLAKAGIEIDRKVLSDIAIHEPEAFAVLVASAKKAL 117


>gi|115522525|ref|YP_779436.1| 50S ribosomal protein L20 [Rhodopseudomonas palustris BisA53]
 gi|122297813|sp|Q07UC8|RL20_RHOP5 RecName: Full=50S ribosomal protein L20
 gi|115516472|gb|ABJ04456.1| LSU ribosomal protein L20P [Rhodopseudomonas palustris BisA53]
          Length = 119

 Score =  152 bits (384), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV K+AKGF GRRKNTIRAAKAAVD++ QYA+RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVYKAAKGFRGRRKNTIRAAKAAVDKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WIQRINAAVR   + YS FINGL K+G+++DRKVLSDLAI +  +F+
Sbjct: 61  WIQRINAAVRPLGMTYSVFINGLAKSGVIVDRKVLSDLAIHEPVAFQ 107


>gi|90421972|ref|YP_530342.1| 50S ribosomal protein L20 [Rhodopseudomonas palustris BisB18]
 gi|109893145|sp|Q21C63|RL20_RHOPB RecName: Full=50S ribosomal protein L20
 gi|90103986|gb|ABD86023.1| LSU ribosomal protein L20P [Rhodopseudomonas palustris BisB18]
          Length = 119

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/106 (70%), Positives = 88/106 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV K AKGF GRRKNTIR AKAAVD++ QYA+RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVYKLAKGFRGRRKNTIRTAKAAVDKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAAVR   + YS FINGL K+G+++DRKVLSDLAIT+  +F
Sbjct: 61  WIQRINAAVRPLGMTYSVFINGLAKSGVMVDRKVLSDLAITEPAAF 106


>gi|262276752|ref|ZP_06054545.1| ribosomal protein L20 [alpha proteobacterium HIMB114]
 gi|262223855|gb|EEY74314.1| ribosomal protein L20 [alpha proteobacterium HIMB114]
          Length = 118

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 76/117 (64%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  S AKHKKVLK+AKG++GRRKNTIR AK AV+++ QYAYRDRR  KR+FRSL
Sbjct: 1   MARVKRGKTSKAKHKKVLKAAKGYWGRRKNTIRVAKQAVEKAMQYAYRDRRRNKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   L YS+FINGL K+ I +DRKVL+D+A    ++FK IV+  +S L
Sbjct: 61  WIQRINAGVRAEGLTYSKFINGLTKSKINIDRKVLADIAYNNPETFKSIVKKVQSHL 117


>gi|319780186|ref|YP_004139662.1| ribosomal protein L20 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166074|gb|ADV09612.1| ribosomal protein L20 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 133

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 72/106 (67%), Positives = 88/106 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKGFYGRRKNTIR AK AV++S QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAA   + L Y +FI+GL+K+GI +DRK+LSD+AI +  +F
Sbjct: 61  WIQRINAATHEHGLTYGRFIDGLNKSGIEIDRKILSDMAIHEPQAF 106


>gi|39933118|ref|NP_945394.1| 50S ribosomal protein L20 [Rhodopseudomonas palustris CGA009]
 gi|192288472|ref|YP_001989077.1| 50S ribosomal protein L20 [Rhodopseudomonas palustris TIE-1]
 gi|316931434|ref|YP_004106416.1| 50S ribosomal protein L20 [Rhodopseudomonas palustris DX-1]
 gi|60390470|sp|Q6NDR6|RL20_RHOPA RecName: Full=50S ribosomal protein L20; AltName: Full=RRP-L20
 gi|226730444|sp|B3Q5X2|RL20_RHOPT RecName: Full=50S ribosomal protein L20
 gi|39652743|emb|CAE25482.1| ribosomal protein L20 [Rhodopseudomonas palustris CGA009]
 gi|192282221|gb|ACE98601.1| ribosomal protein L20 [Rhodopseudomonas palustris TIE-1]
 gi|315599148|gb|ADU41683.1| ribosomal protein L20 [Rhodopseudomonas palustris DX-1]
          Length = 119

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 89/107 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV K AKG+ GRRKNTIR AKAAVD++ QYA+RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVYKLAKGYRGRRKNTIRTAKAAVDKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WIQR+NAAVR + + YS FINGL K+GIV+DRKVLSDLAI +  +F+
Sbjct: 61  WIQRLNAAVRPFGMTYSVFINGLSKSGIVVDRKVLSDLAINEPAAFQ 107


>gi|71083147|ref|YP_265866.1| 50S ribosomal protein L20 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91762422|ref|ZP_01264387.1| 50S ribosomal protein L20 [Candidatus Pelagibacter ubique HTCC1002]
 gi|109893133|sp|Q4FNH6|RL20_PELUB RecName: Full=50S ribosomal protein L20
 gi|71062260|gb|AAZ21263.1| 50S ribosomal protein L20 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91718224|gb|EAS84874.1| 50S ribosomal protein L20 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 118

 Score =  150 bits (380), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+ KG +GRRK+TIR AK A++++ QYAYRDRR KKR+F+SL
Sbjct: 1   MARVKRGVTSHAKHKKVLKAVKGQWGRRKSTIRVAKQAMEKAMQYAYRDRRTKKREFKSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   + YS+FINGL K GI LDRK+L+++A    ++FK IV+ ++S L
Sbjct: 61  WIQRINAGVRSEGITYSKFINGLTKCGIKLDRKILAEIAYDSPEAFKTIVQKAQSAL 117


>gi|300021910|ref|YP_003754521.1| ribosomal protein L20 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523731|gb|ADJ22200.1| ribosomal protein L20 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 133

 Score =  149 bits (375), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/106 (67%), Positives = 87/106 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV+K+AKG+YGRRKNTIR AK AV+++QQYAYRDR+ +KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVIKAAKGYYGRRKNTIRVAKQAVEKAQQYAYRDRKRRKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAAVR + L Y +FINGL   GI +DRKVLSD+AI     F
Sbjct: 61  WIQRINAAVREHGLTYGRFINGLTNLGIEVDRKVLSDIAINDPAGF 106


>gi|83949944|ref|ZP_00958677.1| ribosomal protein L20 [Roseovarius nubinhibens ISM]
 gi|83837843|gb|EAP77139.1| ribosomal protein L20 [Roseovarius nubinhibens ISM]
          Length = 121

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRKNT R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKNTFRVATQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + D+F  IV+ +++ L
Sbjct: 61  WIQRINAAVRAHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPDAFGAIVDQAKAAL 119


>gi|260427841|ref|ZP_05781820.1| ribosomal protein L20 [Citreicella sp. SE45]
 gi|260422333|gb|EEX15584.1| ribosomal protein L20 [Citreicella sp. SE45]
          Length = 121

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+HKKVL  AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MARVKGGTVTHARHKKVLDQAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL KAGI +DRKVL+DLA+ + ++F  IVE ++  L
Sbjct: 61  WIQRINAAVRAHDEALTYSKFINGLTKAGIEVDRKVLADLAVHEPEAFGAIVEQAKGAL 119


>gi|302381454|ref|YP_003817277.1| ribosomal protein L20 [Brevundimonas subvibrioides ATCC 15264]
 gi|302192082|gb|ADK99653.1| ribosomal protein L20 [Brevundimonas subvibrioides ATCC 15264]
          Length = 117

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 84/100 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVVS A+HKKVL+ AKGF GRRKNTIR AKAAVDR+ QYAYRDRR+ KR+FR+L
Sbjct: 1   MARVKRGVVSHARHKKVLEQAKGFSGRRKNTIRTAKAAVDRAGQYAYRDRRINKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           WIQRINAA R     YSQF++GL KAGI LDRKVL+ +A+
Sbjct: 61  WIQRINAAARQEGFTYSQFMHGLSKAGIELDRKVLAAIAM 100


>gi|332188419|ref|ZP_08390143.1| ribosomal protein L20 [Sphingomonas sp. S17]
 gi|332011565|gb|EGI53646.1| ribosomal protein L20 [Sphingomonas sp. S17]
          Length = 121

 Score =  148 bits (373), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 90/117 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR L
Sbjct: 1   MARVKRGTTTKAKHKRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   L YSQF++G   AGI LDRKVL+D+A+ + ++F  IV  +++ L
Sbjct: 61  WIQRINAGVRAEGLTYSQFMHGCKLAGIELDRKVLADIAMHEGEAFSAIVAQAKAAL 117


>gi|85709659|ref|ZP_01040724.1| ribosomal protein L20 [Erythrobacter sp. NAP1]
 gi|85688369|gb|EAQ28373.1| ribosomal protein L20 [Erythrobacter sp. NAP1]
          Length = 119

 Score =  147 bits (372), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGV + AKHK++L  AKG+ GRRKNTIR A+ AV+++ QYAYRDRR+KKR+FR+L
Sbjct: 1   MPRIKRGVTTRAKHKRLLDQAKGYRGRRKNTIRIARQAVEKAGQYAYRDRRIKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L YSQF++G+  AGI LDRKV++DLA+ +  +FK I+  ++  L
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGVKLAGIELDRKVMADLAMNEEAAFKTIIAQAKKAL 117


>gi|103488416|ref|YP_617977.1| 50S ribosomal protein L20 [Sphingopyxis alaskensis RB2256]
 gi|122984715|sp|Q1GNX8|RL20_SPHAL RecName: Full=50S ribosomal protein L20
 gi|98978493|gb|ABF54644.1| LSU ribosomal protein L20P [Sphingopyxis alaskensis RB2256]
          Length = 121

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R+KRG  + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR+L
Sbjct: 1   MSRIKRGTTTRAKHKRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L YSQF++G+  AGI LDRKV++DLA+ +   F  IV  +++ L
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGVKLAGIELDRKVMADLAMNEGGVFTAIVAQAKAAL 117


>gi|94497863|ref|ZP_01304429.1| ribosomal protein L20 [Sphingomonas sp. SKA58]
 gi|94422752|gb|EAT07787.1| ribosomal protein L20 [Sphingomonas sp. SKA58]
          Length = 120

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 69/110 (62%), Positives = 88/110 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR L
Sbjct: 1   MARVKRGVTTKAKHKRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINA VR   L YSQF++GL  AG+ LDRKVL+D+A+ + ++F  I+
Sbjct: 61  WIQRINAGVRAEGLTYSQFMHGLKLAGVELDRKVLADIAMHEGEAFSAII 110


>gi|148555346|ref|YP_001262928.1| 50S ribosomal protein L20 [Sphingomonas wittichii RW1]
 gi|166220788|sp|A5V924|RL20_SPHWW RecName: Full=50S ribosomal protein L20
 gi|148500536|gb|ABQ68790.1| LSU ribosomal protein L20P [Sphingomonas wittichii RW1]
          Length = 125

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKHK++L +AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR+L
Sbjct: 1   MARVKRGTTTHAKHKRILGAAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y  F++GL  AGI LDRKVL+D+A+ + ++F  I+  +++ L
Sbjct: 61  WIQRINAAVRAEGLTYGVFMHGLKLAGIELDRKVLADIAMHEGEAFSGIIAQAKAAL 117


>gi|149913185|ref|ZP_01901719.1| 50S ribosomal protein L20 [Roseobacter sp. AzwK-3b]
 gi|149813591|gb|EDM73417.1| 50S ribosomal protein L20 [Roseobacter sp. AzwK-3b]
          Length = 121

 Score =  147 bits (371), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 97/119 (81%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVVKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL KAG+ +DRKVL+DLA+ +  +F  IV+ ++S L
Sbjct: 61  WIQRINAAVRAHDEGLTYSRFINGLAKAGVEVDRKVLADLAVREPAAFGAIVDQAKSAL 119


>gi|315498801|ref|YP_004087605.1| ribosomal protein l20 [Asticcacaulis excentricus CB 48]
 gi|315416813|gb|ADU13454.1| ribosomal protein L20 [Asticcacaulis excentricus CB 48]
          Length = 119

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 80/93 (86%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVKRGVVS A+HKKVLK AKGFYGRRKNTIR AKAAVD++ QYAYRDRRV KR+FR+L
Sbjct: 1  MARVKRGVVSHARHKKVLKQAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRRVNKRNFRAL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRK 93
          WIQRINAA RV    YSQFI+GL+ AGI LDRK
Sbjct: 61 WIQRINAAARVEGFTYSQFIHGLNLAGIELDRK 93


>gi|83944291|ref|ZP_00956746.1| 50S ribosomal protein L20 [Sulfitobacter sp. EE-36]
 gi|83953332|ref|ZP_00962054.1| 50S ribosomal protein L20 [Sulfitobacter sp. NAS-14.1]
 gi|83842300|gb|EAP81468.1| 50S ribosomal protein L20 [Sulfitobacter sp. NAS-14.1]
 gi|83844835|gb|EAP82717.1| 50S ribosomal protein L20 [Sulfitobacter sp. EE-36]
          Length = 121

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K GVV+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRTKGGVVTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVLSDLAI + ++F  IV+ ++  L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLSDLAINEPEAFGAIVKQAQDAL 119


>gi|114767104|ref|ZP_01445987.1| 50S ribosomal protein L20 [Pelagibaca bermudensis HTCC2601]
 gi|114540757|gb|EAU43823.1| 50S ribosomal protein L20 [Roseovarius sp. HTCC2601]
          Length = 121

 Score =  146 bits (369), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 93/119 (78%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+HKKVL  AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MARVKGGTVTHARHKKVLDQAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL KAGI +DRKVL+DLA+ + ++F  IV+ ++  L
Sbjct: 61  WIQRINAAVRAHDEALTYSKFINGLTKAGIEVDRKVLADLAVHEPEAFGAIVDQAKGAL 119


>gi|149201232|ref|ZP_01878207.1| 50S ribosomal protein L20 [Roseovarius sp. TM1035]
 gi|149145565|gb|EDM33591.1| 50S ribosomal protein L20 [Roseovarius sp. TM1035]
          Length = 121

 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 95/119 (79%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GVV+ A+HKKV+K+AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGVVTHARHKKVIKAAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AG+ +DRKVL+DLA+ +  +F  IVE ++  L
Sbjct: 61  WIQRINAAVRAHDESLTYSRFINGLALAGVEVDRKVLADLAVHEPAAFGAIVEQAKGAL 119


>gi|307293506|ref|ZP_07573350.1| ribosomal protein L20 [Sphingobium chlorophenolicum L-1]
 gi|306879657|gb|EFN10874.1| ribosomal protein L20 [Sphingobium chlorophenolicum L-1]
          Length = 120

 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 68/110 (61%), Positives = 87/110 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR L
Sbjct: 1   MARVKRGTTTKAKHKRILDQAKGYYGRRKNTIRVARQAVEKAGQYAYRDRKVKKRTFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINA VR   L YSQF++GL  AG+ LDRKVL+D+A+ + ++F  I+
Sbjct: 61  WIQRINAGVRAEGLTYSQFMHGLKLAGVELDRKVLADIAMHEGEAFSAII 110


>gi|254488959|ref|ZP_05102164.1| ribosomal protein L20 [Roseobacter sp. GAI101]
 gi|214045828|gb|EEB86466.1| ribosomal protein L20 [Roseobacter sp. GAI101]
          Length = 121

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K GVV+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRTKGGVVTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + +SF  IV+ ++  L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLADLAVNEPESFGAIVKQAQDAL 119


>gi|294013439|ref|YP_003546899.1| ribosomal protein L20 [Sphingobium japonicum UT26S]
 gi|292676769|dbj|BAI98287.1| ribosomal protein L20 [Sphingobium japonicum UT26S]
          Length = 120

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 68/110 (61%), Positives = 87/110 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR L
Sbjct: 1   MARVKRGTTTKAKHKRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINA VR   L YSQF++GL  AG+ LDRKVL+D+A+ + ++F  I+
Sbjct: 61  WIQRINAGVRAEGLTYSQFMHGLKLAGVELDRKVLADIAMHEGEAFSAII 110


>gi|254462592|ref|ZP_05076008.1| ribosomal protein L20 [Rhodobacterales bacterium HTCC2083]
 gi|206679181|gb|EDZ43668.1| ribosomal protein L20 [Rhodobacteraceae bacterium HTCC2083]
          Length = 121

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 95/119 (79%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+H+KV+K+AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR FR+L
Sbjct: 1   MSRVKGGTVTHARHRKVVKAAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVLSDLAI + D+F  +V+ +++ L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLMLAGIEVDRKVLSDLAINEPDAFGAVVDQAKAAL 119


>gi|126728340|ref|ZP_01744156.1| 50S ribosomal protein L20 [Sagittula stellata E-37]
 gi|126711305|gb|EBA10355.1| 50S ribosomal protein L20 [Sagittula stellata E-37]
          Length = 121

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 91/119 (76%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+HKK+   AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR FR+L
Sbjct: 1   MPRVKGGTVTHARHKKITNQAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRQFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR+ D  L YS+FINGL KAGI +DRKVL+DLA+ + D+F  IVE ++  L
Sbjct: 61  WIQRINAAVRLNDETLTYSRFINGLSKAGIEVDRKVLADLAVHEPDAFAAIVEQAKGAL 119


>gi|88810668|ref|ZP_01125925.1| ribosomal protein L20 [Nitrococcus mobilis Nb-231]
 gi|88792298|gb|EAR23408.1| ribosomal protein L20 [Nitrococcus mobilis Nb-231]
          Length = 118

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ ++HKK+L  AKG+YG R+ T RAAK AV R+ QYAYRDRR +KR+FRSL
Sbjct: 1   MARVKRGVIAHSRHKKILGKAKGYYGARRKTFRAAKQAVIRAGQYAYRDRRQRKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R++ L+YS+ I+GLHKAGI +DRKVL+DLA+  +  F  + + +++ L
Sbjct: 61  WIQRINAAARLHGLSYSRLIDGLHKAGIEIDRKVLADLAVHDMAGFAGLADRAKAGL 117


>gi|218529885|ref|YP_002420701.1| 50S ribosomal protein L20 [Methylobacterium chloromethanicum CM4]
 gi|254800328|sp|B7KVA2|RL20_METC4 RecName: Full=50S ribosomal protein L20
 gi|218522188|gb|ACK82773.1| ribosomal protein L20 [Methylobacterium chloromethanicum CM4]
          Length = 121

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 85/102 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WIQR+NAAVR + L YS+FIN L ++GI +DRK LS+LAI +
Sbjct: 61  WIQRLNAAVREHGLTYSRFINALAQSGIEVDRKALSELAIHE 102


>gi|114568683|ref|YP_755363.1| 50S ribosomal protein L20P [Maricaulis maris MCS10]
 gi|122316992|sp|Q0ATG2|RL20_MARMM RecName: Full=50S ribosomal protein L20
 gi|114339145|gb|ABI64425.1| LSU ribosomal protein L20P [Maricaulis maris MCS10]
          Length = 118

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RV  G  ++ +HK V+K AKG+YGRRKNT R A  AV+++ QYAYRDRR KKR+FR+L
Sbjct: 1   MSRVTSGPATAKRHKSVIKKAKGYYGRRKNTFRVAVQAVEKAGQYAYRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R ++++YS F+NGL KAGI +DRKVL+D+A+ + D+FK +V+ +R+ L
Sbjct: 61  WIQRINAGARQHEMSYSVFMNGLTKAGIEVDRKVLADIAMHEPDAFKALVDQARAAL 117


>gi|296284910|ref|ZP_06862908.1| 50S ribosomal protein L20 [Citromicrobium bathyomarinum JL354]
          Length = 119

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGV +  KHK++L  AKG+ GRRKNTIR A+ AV+++ QYAYRDR+VKKR+FR+L
Sbjct: 1   MPRIKRGVTTRQKHKRLLDQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L YSQF++G   AGI LDRKV++DLA+ +  +FK I++ ++  L
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGTKLAGIELDRKVMADLAMNEEAAFKAIIKQAKDAL 117


>gi|149187101|ref|ZP_01865406.1| 50S ribosomal protein L20 [Erythrobacter sp. SD-21]
 gi|148829253|gb|EDL47699.1| 50S ribosomal protein L20 [Erythrobacter sp. SD-21]
          Length = 119

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGV +  KHK++L  AKG+ GRRKNTIR A+ AV+++ QYAYRDR+VKKR+FR+L
Sbjct: 1   MPRIKRGVTTRQKHKRLLDQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L YSQF++G   AGI LDRKV++DLA+ +  +FK I++ ++  L
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGTKLAGIELDRKVMADLAMNEGAAFKAIIDQAKKAL 117


>gi|85375591|ref|YP_459653.1| 50S ribosomal protein L20 [Erythrobacter litoralis HTCC2594]
 gi|122543232|sp|Q2N635|RL20_ERYLH RecName: Full=50S ribosomal protein L20
 gi|84788674|gb|ABC64856.1| ribosomal protein L20 [Erythrobacter litoralis HTCC2594]
          Length = 119

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGV +  KHK++L  AKG+ GRRKNTIR A+ AV+++ QYAYRDR+VKKR FR+L
Sbjct: 1   MPRIKRGVTTRQKHKRLLDQAKGYRGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L YSQF++G+  AGI LDRKV++DLA+ +  +FK +++ +++ L
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGVKLAGIELDRKVMADLAMNEEAAFKSVIDQAKAAL 117


>gi|163738458|ref|ZP_02145873.1| ribosomal protein L20 [Phaeobacter gallaeciensis BS107]
 gi|163742132|ref|ZP_02149520.1| 50S ribosomal protein L20 [Phaeobacter gallaeciensis 2.10]
 gi|161384462|gb|EDQ08843.1| 50S ribosomal protein L20 [Phaeobacter gallaeciensis 2.10]
 gi|161388379|gb|EDQ12733.1| ribosomal protein L20 [Phaeobacter gallaeciensis BS107]
          Length = 121

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTTTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ ++S L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLTLAGIEVDRKVLADLAVHEPEAFGAIVKQAQSAL 119


>gi|254475284|ref|ZP_05088670.1| ribosomal protein L20 [Ruegeria sp. R11]
 gi|214029527|gb|EEB70362.1| ribosomal protein L20 [Ruegeria sp. R11]
          Length = 121

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTTTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV+ ++  L
Sbjct: 61  WIQRINAAVRAHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVKQAQDAL 119


>gi|85706245|ref|ZP_01037340.1| 50S ribosomal protein L20 [Roseovarius sp. 217]
 gi|85669409|gb|EAQ24275.1| 50S ribosomal protein L20 [Roseovarius sp. 217]
          Length = 121

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 95/119 (79%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GVV+ A+HKKV+K+AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGVVTHARHKKVIKAAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AG+ +DRKVL+DLA+ +  +F  IV+ ++  L
Sbjct: 61  WIQRINAAVRAHDESLTYSRFINGLALAGVEVDRKVLADLAVHEPAAFGAIVDQAKGAL 119


>gi|84500415|ref|ZP_00998664.1| 50S ribosomal protein L20 [Oceanicola batsensis HTCC2597]
 gi|84391368|gb|EAQ03700.1| 50S ribosomal protein L20 [Oceanicola batsensis HTCC2597]
          Length = 120

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 94/119 (78%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKVLK+AKG+YGRR  T + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVLKAAKGYYGRRSTTFKVATQAVDKANQYATRDRKARKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + D+F  IV+ +++ L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPDAFGAIVDKAKAAL 119


>gi|99082353|ref|YP_614507.1| 50S ribosomal protein L20 [Ruegeria sp. TM1040]
 gi|122397588|sp|Q1GDM1|RL20_SILST RecName: Full=50S ribosomal protein L20
 gi|99038633|gb|ABF65245.1| LSU ribosomal protein L20P [Ruegeria sp. TM1040]
          Length = 121

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV  ++  L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVRQAQDAL 119


>gi|86140201|ref|ZP_01058763.1| ribosomal protein L20 [Roseobacter sp. MED193]
 gi|85823138|gb|EAQ43351.1| ribosomal protein L20 [Roseobacter sp. MED193]
          Length = 121

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 97/119 (81%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKQRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV  ++S L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVRQAQSAL 119


>gi|117923681|ref|YP_864298.1| 50S ribosomal protein L20P [Magnetococcus sp. MC-1]
 gi|166219658|sp|A0L4J9|RL20_MAGSM RecName: Full=50S ribosomal protein L20
 gi|117607437|gb|ABK42892.1| LSU ribosomal protein L20P [Magnetococcus sp. MC-1]
          Length = 117

 Score =  144 bits (363), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 91/117 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S A+HKKVLK+AKG+ GR  +  R AK  V++  QYAYRDR+  KR+ R L
Sbjct: 1   MPRVKRGVTSQARHKKVLKAAKGYTGRNNSCFRIAKQKVEKGLQYAYRDRKNLKREMRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R++ ++YSQF+NGL+KAGI LDRKVLS+LAI++ +SF  +VE +++ L
Sbjct: 61  WIARINAATRLHGMSYSQFMNGLNKAGIELDRKVLSELAISEPESFGTLVEQAKAAL 117


>gi|260432657|ref|ZP_05786628.1| ribosomal protein L20 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416485|gb|EEX09744.1| ribosomal protein L20 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 121

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 70/112 (62%), Positives = 93/112 (83%), Gaps = 2/112 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVVKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIV 112


>gi|89069712|ref|ZP_01157048.1| 50S ribosomal protein L20 [Oceanicola granulosus HTCC2516]
 gi|89044658|gb|EAR50769.1| 50S ribosomal protein L20 [Oceanicola granulosus HTCC2516]
          Length = 119

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 92/117 (78%), Gaps = 2/117 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVL+ AKG+YGRRKNT + A+ AVD++ QYA RDR  KKR+FRSLWI
Sbjct: 2   RVKGGTVTHRRHKKVLEQAKGYYGRRKNTFKVARQAVDKANQYATRDRHNKKRNFRSLWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           QRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ +R+ L
Sbjct: 62  QRINAAVRAHDESLTYSKFINGLGLAGIEVDRKVLADLAVNEPEAFNGIVDKARAAL 118


>gi|330813585|ref|YP_004357824.1| LSU ribosomal protein L20p [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486680|gb|AEA81085.1| LSU ribosomal protein L20p [Candidatus Pelagibacter sp. IMCC9063]
          Length = 118

 Score =  144 bits (362), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/117 (64%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  S  KHKKV K AKGF GRRKNTIR AK AV++S QYAYRDRR  KR FRSL
Sbjct: 1   MARVKRGQASHQKHKKVFKQAKGFRGRRKNTIRVAKQAVEKSLQYAYRDRRRNKRIFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   L YS+FINGL K+ I +DRKVL+D+A    ++FK IV+  +S L
Sbjct: 61  WIQRINAGVRAEGLTYSKFINGLIKSKIKIDRKVLADIAYHNPETFKSIVKKVQSHL 117


>gi|253996952|ref|YP_003049016.1| 50S ribosomal protein L20 [Methylotenera mobilis JLW8]
 gi|253983631|gb|ACT48489.1| ribosomal protein L20 [Methylotenera mobilis JLW8]
          Length = 119

 Score =  143 bits (361), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 90/117 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVIARARHKKVLKAAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQKKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R + L YS+F+NGL KA I +DRKVL+DLA+    +F K VEL+++ L
Sbjct: 61  WIARINAGSREFGLTYSRFMNGLKKAAIEVDRKVLADLAVFDKAAFAKFVELAKAGL 117


>gi|163757703|ref|ZP_02164792.1| 50S ribosomal protein L20 [Hoeflea phototrophica DFL-43]
 gi|162285205|gb|EDQ35487.1| 50S ribosomal protein L20 [Hoeflea phototrophica DFL-43]
          Length = 133

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 97/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK AKGFYGRRKNTIRAAKAAVD+S QYAYRDR+V+KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKKAKGFYGRRKNTIRAAKAAVDKSMQYAYRDRKVRKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L Y +FI+GL KAGI +DRKVLSD+AI   ++F  +V  ++  L
Sbjct: 61  WIQRINAAVREHGLTYGRFIDGLTKAGIEVDRKVLSDMAIHDAEAFGVLVAAAKKEL 117


>gi|126738876|ref|ZP_01754572.1| 50S ribosomal protein L20 [Roseobacter sp. SK209-2-6]
 gi|126720057|gb|EBA16764.1| 50S ribosomal protein L20 [Roseobacter sp. SK209-2-6]
          Length = 121

 Score =  143 bits (361), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 95/119 (79%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTTTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV  ++  L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVRQAQDAL 119


>gi|114769957|ref|ZP_01447567.1| 50S ribosomal protein L20 [alpha proteobacterium HTCC2255]
 gi|114549662|gb|EAU52544.1| 50S ribosomal protein L20 [alpha proteobacterium HTCC2255]
          Length = 119

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 93/119 (78%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV  G V+ A+HKKV+K+AKG+YG RKN  R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MARVTSGKVTHARHKKVIKAAKGYYGARKNAFRTATQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR+ D  L YS+FING+ KAGI +DRKVL+DLA+ + ++F  IVE +++ L
Sbjct: 61  WIQRINAAVRLNDETLTYSRFINGVQKAGIEVDRKVLADLAVHEPEAFGAIVEQAKAAL 119


>gi|84684099|ref|ZP_01012001.1| 50S ribosomal protein L20 [Maritimibacter alkaliphilus HTCC2654]
 gi|84667852|gb|EAQ14320.1| 50S ribosomal protein L20 [Rhodobacterales bacterium HTCC2654]
          Length = 120

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 91/119 (76%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKVL +AKG+YGRR    + A  AVD++ QYA RDR+ +KR+FRSL
Sbjct: 1   MSRVKGGTTTHARHKKVLDAAKGYYGRRSTNFKTATQAVDKANQYATRDRKNRKRNFRSL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + D+F  IV+ +++ L
Sbjct: 61  WIQRINAAVRAHDEALTYSKFINGLATAGIEVDRKVLADLAVNEPDAFGAIVDKAKAAL 119


>gi|323143352|ref|ZP_08078040.1| ribosomal protein L20 [Succinatimonas hippei YIT 12066]
 gi|322416870|gb|EFY07516.1| ribosomal protein L20 [Succinatimonas hippei YIT 12066]
          Length = 119

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK+AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVTARARHKKVLKAAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFREL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +DL+YSQF+NGL KA I +DRKVLS+LAI    +FK I + +R+ L
Sbjct: 61  WIVRINAAARQHDLSYSQFMNGLKKANIEIDRKVLSELAINDKAAFKAIADQARAAL 117


>gi|259417072|ref|ZP_05740991.1| ribosomal protein L20 [Silicibacter sp. TrichCH4B]
 gi|259345978|gb|EEW57792.1| ribosomal protein L20 [Silicibacter sp. TrichCH4B]
          Length = 121

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV  ++  L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVRQAQDAL 119


>gi|254467286|ref|ZP_05080697.1| ribosomal protein L20 [Rhodobacterales bacterium Y4I]
 gi|206688194|gb|EDZ48676.1| ribosomal protein L20 [Rhodobacterales bacterium Y4I]
          Length = 121

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 94/119 (78%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTTTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV  ++  L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLTLAGIEVDRKVLADLAVHEPEAFGAIVRQAQDAL 119


>gi|159042787|ref|YP_001531581.1| 50S ribosomal protein L20 [Dinoroseobacter shibae DFL 12]
 gi|189041861|sp|A8LLH0|RL20_DINSH RecName: Full=50S ribosomal protein L20
 gi|157910547|gb|ABV91980.1| 50S ribosomal protein L20 [Dinoroseobacter shibae DFL 12]
          Length = 121

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 93/119 (78%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K G V+ A+HKKV  +AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR FR+L
Sbjct: 1   MSRTKGGTVTHARHKKVTDAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRQFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ +++ L
Sbjct: 61  WIQRINAAVRAHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPEAFSAIVDQAKAAL 119


>gi|56698420|ref|YP_168793.1| 50S ribosomal protein L20 [Ruegeria pomeroyi DSS-3]
 gi|81819908|sp|Q5LMG5|RL20_SILPO RecName: Full=50S ribosomal protein L20
 gi|56680157|gb|AAV96823.1| ribosomal protein L20 [Ruegeria pomeroyi DSS-3]
          Length = 121

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 92/112 (82%), Gaps = 2/112 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKVLK+AKG+YGRRK++ + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVLKAAKGYYGRRKSSFKVATQAVDKANQYATRDRKARKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIV 112


>gi|254510129|ref|ZP_05122196.1| ribosomal protein L20 [Rhodobacteraceae bacterium KLH11]
 gi|221533840|gb|EEE36828.1| ribosomal protein L20 [Rhodobacteraceae bacterium KLH11]
          Length = 121

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 93/112 (83%), Gaps = 2/112 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIV 112


>gi|326386438|ref|ZP_08208061.1| 50S ribosomal protein L20 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209099|gb|EGD59893.1| 50S ribosomal protein L20 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 120

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 87/110 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R+KRG  + AKHK++L +AKG+ GRRKNTIR A+ AV+++ QYAYRDR++KKR+FR+L
Sbjct: 1   MSRIKRGTTTRAKHKRILDAAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKIKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR   L YSQFI+G   AGI LDRK L+DLA+ +   F  I+
Sbjct: 61  WIQRINAAVRAEGLTYSQFIHGTKLAGIELDRKSLADLAMNEGGVFTAII 110


>gi|110678354|ref|YP_681361.1| 50S ribosomal protein L20 [Roseobacter denitrificans OCh 114]
 gi|123362196|sp|Q16BG8|RL20_ROSDO RecName: Full=50S ribosomal protein L20
 gi|109454470|gb|ABG30675.1| ribosomal protein L20 [Roseobacter denitrificans OCh 114]
          Length = 121

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRTKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV+ ++  L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVKQAQDAL 119


>gi|121605744|ref|YP_983073.1| 50S ribosomal protein L20 [Polaromonas naphthalenivorans CJ2]
 gi|166219675|sp|A1VR74|RL20_POLNA RecName: Full=50S ribosomal protein L20
 gi|120594713|gb|ABM38152.1| LSU ribosomal protein L20P [Polaromonas naphthalenivorans CJ2]
          Length = 119

 Score =  141 bits (356), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/118 (62%), Positives = 87/118 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKEAVMKAGQYAYRDRRNKKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R + L YSQF NGL KAGI +DRKVLSD+AI    +F  IVE ++++L+
Sbjct: 61  WIARINAASRSFGLTYSQFANGLKKAGIEIDRKVLSDMAIHDSAAFGAIVEQAKAKLV 118


>gi|163744828|ref|ZP_02152188.1| 50S ribosomal protein L20 [Oceanibulbus indolifex HEL-45]
 gi|161381646|gb|EDQ06055.1| 50S ribosomal protein L20 [Oceanibulbus indolifex HEL-45]
          Length = 121

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 94/119 (78%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKK++K+AKG+YGRRKN  + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKIIKAAKGYYGRRKNVFKVATQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ ++  L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPEAFGAIVKQAQDAL 119


>gi|91787978|ref|YP_548930.1| 50S ribosomal protein L20 [Polaromonas sp. JS666]
 gi|123355763|sp|Q12BR0|RL20_POLSJ RecName: Full=50S ribosomal protein L20
 gi|91697203|gb|ABE44032.1| LSU ribosomal protein L20P [Polaromonas sp. JS666]
          Length = 119

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKEAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + + YSQF NGL KAGI +DRKVLSD+AI    +F  IVE  +++L
Sbjct: 61  WIARINAASRSFGMTYSQFANGLKKAGIEIDRKVLSDMAIHDSAAFGAIVEQVKAKL 117


>gi|23015135|ref|ZP_00054920.1| COG0292: Ribosomal protein L20 [Magnetospirillum magnetotacticum
           MS-1]
 gi|83313482|ref|YP_423746.1| 50S ribosomal protein L20 [Magnetospirillum magneticum AMB-1]
 gi|109893120|sp|Q2VYY8|RL20_MAGMM RecName: Full=50S ribosomal protein L20
 gi|82948323|dbj|BAE53187.1| Ribosomal protein L20 [Magnetospirillum magneticum AMB-1]
          Length = 118

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 89/117 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ GR     R A   V+++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTTHARHKKILKLAKGYRGRSSTCFRVAIQKVEKALRYAYRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R Y L YS+F++GL KAGI LDRKVLSD+AI + D+FK +VE +++ L
Sbjct: 61  WIQRINAGSRAYGLPYSRFMDGLKKAGIALDRKVLSDIAIREPDAFKSLVEKAQAAL 117


>gi|163732661|ref|ZP_02140106.1| 50S ribosomal protein L20 [Roseobacter litoralis Och 149]
 gi|161394021|gb|EDQ18345.1| 50S ribosomal protein L20 [Roseobacter litoralis Och 149]
          Length = 121

 Score =  141 bits (355), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 95/119 (79%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRTKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ ++  L
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPEAFGAIVKQAQDAL 119


>gi|91776352|ref|YP_546108.1| 50S ribosomal protein L20 [Methylobacillus flagellatus KT]
 gi|122399616|sp|Q1GZS0|RL20_METFK RecName: Full=50S ribosomal protein L20
 gi|91710339|gb|ABE50267.1| LSU ribosomal protein L20P [Methylobacillus flagellatus KT]
          Length = 120

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVL +AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVIARARHKKVLNAAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R Y L YS+FINGL K+ + +DRKVL+DLA+    +F K  EL++S L
Sbjct: 61  WIARINAGAREYGLTYSRFINGLKKSAVEVDRKVLADLAVFDKQAFAKFAELAKSGL 117


>gi|144899425|emb|CAM76289.1| 50S ribosomal protein L20 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 118

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKGF GR     R A   V+++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTTHARHKKILKLAKGFRGRSSTCFRVAIEKVEKALRYAYRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R Y + YS+F+NGL KAGIVLDRKVL+D+A  + +SFK +V+ + + L
Sbjct: 61  WIQRINAGTRQYGMPYSRFMNGLKKAGIVLDRKVLADIAAREPESFKSLVQKAEAAL 117


>gi|87198710|ref|YP_495967.1| 50S ribosomal protein L20 [Novosphingobium aromaticivorans DSM
           12444]
 gi|109893130|sp|Q2GAJ0|RL20_NOVAD RecName: Full=50S ribosomal protein L20
 gi|87134391|gb|ABD25133.1| LSU ribosomal protein L20P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 120

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 86/110 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R+KRGV + AKHK++L  AKG+ GRRKNTIR A+ AV+++ QYAYRDR+VKKR FR+L
Sbjct: 1   MSRIKRGVTTRAKHKRILDQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR   L YSQFI+G   AGI LDRK ++DLA+ +   F  ++
Sbjct: 61  WIQRINAAVRAEGLTYSQFIHGAKLAGIELDRKAMADLAMNEGAIFNAVI 110


>gi|118595086|ref|ZP_01552433.1| 50S ribosomal protein L20 [Methylophilales bacterium HTCC2181]
 gi|118440864|gb|EAV47491.1| 50S ribosomal protein L20 [Methylophilales bacterium HTCC2181]
          Length = 120

 Score =  140 bits (354), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL +AKGF GRRKN  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARAKHKKVLVAAKGFRGRRKNVYRVAKQAVMKAGQYAYRDRRQKKRVFRVL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R + L YS+F+NGL KA + +DRKVL+D+A+    +F+K VEL+++ L
Sbjct: 61  WIARINAGAREFGLTYSRFMNGLKKASVEVDRKVLADMAVFDKPAFEKFVELAKNNL 117


>gi|56552411|ref|YP_163250.1| 50S ribosomal protein L20 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761546|ref|ZP_04759633.1| ribosomal protein L20 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260753911|ref|YP_003226804.1| 50S ribosomal protein L20 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|81820863|sp|Q5NMC1|RL20_ZYMMO RecName: Full=50S ribosomal protein L20
 gi|56543985|gb|AAV90139.1| ribosomal protein L20 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373854|gb|EER63387.1| ribosomal protein L20 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258553274|gb|ACV76220.1| ribosomal protein L20 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 125

 Score =  140 bits (353), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKH ++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR+L
Sbjct: 1   MARVKRGTTTRAKHNRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR   L Y  F+ GL  AG+ LDRKVL+DLA+ +  +F  I+   +S L
Sbjct: 61  WIQRINAAVRAEGLTYGVFMYGLKLAGLDLDRKVLADLAMNESAAFGAIIAQVKSAL 117


>gi|114319926|ref|YP_741609.1| 50S ribosomal protein L20P [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312211|sp|Q0AAL8|RL20_ALHEH RecName: Full=50S ribosomal protein L20
 gi|114226320|gb|ABI56119.1| LSU ribosomal protein L20P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 119

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKH KVLK AKG+YG R+ + R A+ AV +S QYAYRDRR +KR FR+L
Sbjct: 1   MSRVKRGVTARAKHNKVLKKAKGYYGARRKSFRIARQAVIKSGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R + L+YS+FINGL +AG+ LDRKVL+DLA+    +F  + E +R  L
Sbjct: 61  WIQRINAGARQHGLSYSRFINGLQQAGVDLDRKVLADLAVNDKAAFGALAEKAREAL 117


>gi|297538935|ref|YP_003674704.1| 50S ribosomal protein L20 [Methylotenera sp. 301]
 gi|297258282|gb|ADI30127.1| ribosomal protein L20 [Methylotenera sp. 301]
          Length = 119

 Score =  139 bits (351), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 89/119 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVIARARHKKVLKAAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQKKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L YS+F+NGL  A I +DRKVL+DLA+    +F K VE++++ L V
Sbjct: 61  WIARINAGARELGLTYSRFMNGLKIASIEVDRKVLADLAVFDKAAFAKFVEMAKTALAV 119


>gi|307545107|ref|YP_003897586.1| 50S ribosomal protein L20 [Halomonas elongata DSM 2581]
 gi|307217131|emb|CBV42401.1| 50S ribosomal protein L20 [Halomonas elongata DSM 2581]
          Length = 117

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 88/115 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MTRVKRGVVARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINA  R + L+YS+F+ GL KAGI +DRKVL+DLA+ +  +F  IVE +++
Sbjct: 61  WIQRINAGARQHGLSYSRFVGGLKKAGIEIDRKVLADLAVNEKAAFAAIVEKAKA 115


>gi|253998432|ref|YP_003050495.1| 50S ribosomal protein L20 [Methylovorus sp. SIP3-4]
 gi|313200507|ref|YP_004039165.1| 50S ribosomal protein L20 [Methylovorus sp. MP688]
 gi|253985111|gb|ACT49968.1| ribosomal protein L20 [Methylovorus sp. SIP3-4]
 gi|312439823|gb|ADQ83929.1| ribosomal protein L20 [Methylovorus sp. MP688]
          Length = 120

 Score =  139 bits (351), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVL +AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVIARARHKKVLDAAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R Y L YS+FINGL K+ I +DRKVL+DLA+    +F K  EL++S L
Sbjct: 61  WIARINAGAREYGLTYSRFINGLKKSAIEVDRKVLADLAVFDKVAFAKFAELAKSGL 117


>gi|260219595|emb|CBA26440.1| 50S ribosomal protein L20 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 119

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKEAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NGL KA I +DRKVLSD+AI  + +F  IVE  +++L
Sbjct: 61  WIARINAAARQCGLTYSQFANGLKKANIEIDRKVLSDIAIHDMAAFAGIVEQVKAKL 117


>gi|149926880|ref|ZP_01915139.1| ribosomal protein L20 [Limnobacter sp. MED105]
 gi|149824432|gb|EDM83650.1| ribosomal protein L20 [Limnobacter sp. MED105]
          Length = 118

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 84/115 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKGF GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAQAKGFRGRRNNVFRVAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAAVR + + YS FINGL KA I LDRKVL+DLA+T   +F  IV   R+
Sbjct: 61  WITRINAAVREHGMTYSVFINGLKKAAIGLDRKVLADLAVTDKAAFAAIVGQVRA 115


>gi|114776993|ref|ZP_01452013.1| 50S ribosomal protein L20 [Mariprofundus ferrooxydans PV-1]
 gi|114552514|gb|EAU54974.1| 50S ribosomal protein L20 [Mariprofundus ferrooxydans PV-1]
          Length = 118

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV + A+HK V+K+AKG+ GRRK+  R A  AVD+++QYAYRDR+VKKRDFRSL
Sbjct: 1   MPRVKSGVQAHARHKSVIKAAKGYRGRRKSCFRVATQAVDKARQYAYRDRKVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA +   L+YS+F++GL  AGI LDRKVL+D+A+   + F K+VE +R+++
Sbjct: 61  WIIRINAAAKSNGLSYSRFMHGLTLAGIDLDRKVLADIAVRDAEGFAKLVETARTQI 117


>gi|289208100|ref|YP_003460166.1| ribosomal protein L20 [Thioalkalivibrio sp. K90mix]
 gi|288943731|gb|ADC71430.1| ribosomal protein L20 [Thioalkalivibrio sp. K90mix]
          Length = 119

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG RKN  R A  AV ++ QYAYRDRR KKR FRSL
Sbjct: 1   MPRVKRGVTAHARHKKVLKQAKGYYGARKNVFRVANQAVIKAGQYAYRDRRQKKRQFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +DL+YS+ + GL KA I +DRK L+DLA+  L +F KI + +++ L
Sbjct: 61  WIVRINAAARQFDLSYSRLMAGLKKAEIEIDRKTLADLAVHDLTAFGKIADKAKAAL 117


>gi|167626329|ref|YP_001676829.1| 50S ribosomal protein L20 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241668762|ref|ZP_04756340.1| 50S ribosomal protein L20 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877293|ref|ZP_05250003.1| 50S ribosomal protein L20 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189041864|sp|B0TY86|RL20_FRAP2 RecName: Full=50S ribosomal protein L20
 gi|167596330|gb|ABZ86328.1| ribosomal protein L20 [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|254843314|gb|EET21728.1| 50S ribosomal protein L20 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 118

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KAG+ LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKAGVELDRKALAELAVYNKDAF 106


>gi|254468984|ref|ZP_05082390.1| ribosomal protein L20 [beta proteobacterium KB13]
 gi|207087794|gb|EDZ65077.1| ribosomal protein L20 [beta proteobacterium KB13]
          Length = 119

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL +AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARAKHKKVLDAAKGYRGRRKNVFRVAKEAVMKAGQYAYRDRRQKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R + L YS+ INGL KA + +DRKVL+DLA+    +F+K  EL++S +
Sbjct: 61  WIARINAGAREFGLTYSRLINGLKKASVEVDRKVLADLAVFDKAAFEKYAELAKSNI 117


>gi|189183696|ref|YP_001937481.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Ikeda]
 gi|226730431|sp|B3CRZ0|RL20_ORITI RecName: Full=50S ribosomal protein L20
 gi|189180467|dbj|BAG40247.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Ikeda]
          Length = 121

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R + G V+  +HKK+LK AKG+ GR KN  R A   V+++ QY+YRDRR +KR FR+L
Sbjct: 1   MSRARSGKVNKNRHKKILKLAKGYRGRAKNCFRIAIQKVEKALQYSYRDRRNRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR YD+ YSQFINGL +A I +DRKV++DLA+   DSF  +VEL++  L
Sbjct: 61  WIQRINAAVRQYDITYSQFINGLKQANITVDRKVMADLAVHNADSFVHLVELTKKSL 117


>gi|83944915|ref|ZP_00957281.1| 50S ribosomal protein L20 [Oceanicaulis alexandrii HTCC2633]
 gi|83851697|gb|EAP89552.1| 50S ribosomal protein L20 [Oceanicaulis alexandrii HTCC2633]
          Length = 119

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV  G    A+ KK++  AKG+YGRRKNT R A  AV+++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVSSGPARHARKKKIISQAKGYYGRRKNTFRTANQAVEKAGQYAYRDRRAKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+ D  Y++F++GL+KAGI LDRKVL+D+A+ + ++F  +V  ++  L
Sbjct: 61  WIQRINAAARLNDFTYARFMDGLNKAGIELDRKVLADIAVHEPEAFASLVAQAKQAL 117


>gi|121610036|ref|YP_997843.1| 50S ribosomal protein L20 [Verminephrobacter eiseniae EF01-2]
 gi|166220802|sp|A1WMG8|RL20_VEREI RecName: Full=50S ribosomal protein L20
 gi|121554676|gb|ABM58825.1| LSU ribosomal protein L20P [Verminephrobacter eiseniae EF01-2]
          Length = 119

 Score =  137 bits (346), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  ++RL V
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKAAIEIDRKMLADLAVHDKAAFGSIVEQVKARLAV 119


>gi|332529092|ref|ZP_08405056.1| 50S ribosomal protein L20 [Hylemonella gracilis ATCC 19624]
 gi|332041315|gb|EGI77677.1| 50S ribosomal protein L20 [Hylemonella gracilis ATCC 19624]
          Length = 119

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLNLAKGFRGRRGNVFRIAKEAVMKAGQYAYRDRRAKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NGL KA I +DRKVL+D+A+  + +F  IVE  +++L
Sbjct: 61  WIARINAAARQCGLTYSQFANGLKKAQIEIDRKVLADIAVNDMAAFAGIVEKVKAKL 117


>gi|237653683|ref|YP_002889997.1| 50S ribosomal protein L20 [Thauera sp. MZ1T]
 gi|237624930|gb|ACR01620.1| ribosomal protein L20 [Thauera sp. MZ1T]
          Length = 119

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLSQAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YS F+NGL KA I +DRKVL+DLA+    +F  I E +R++L
Sbjct: 61  WIARINAAARELGLTYSVFMNGLKKAAIEIDRKVLADLAVFDKPAFAAIAEQARAKL 117


>gi|82701624|ref|YP_411190.1| 50S ribosomal protein L20 [Nitrosospira multiformis ATCC 25196]
 gi|109893127|sp|Q2YBS3|RL20_NITMU RecName: Full=50S ribosomal protein L20
 gi|82409689|gb|ABB73798.1| LSU ribosomal protein L20P [Nitrosospira multiformis ATCC 25196]
          Length = 119

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 88/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR+FR+L
Sbjct: 1   MPRVKRGVTAHARHKKILDLAKGYRGRRKNVYRVAKEAVMKAGQYAYRDRRQKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS F+NGL KA I +DRKVL+DLA+    +F KI E +++ L +
Sbjct: 61  WIARINAAARECGLSYSVFMNGLKKAEIEVDRKVLADLAVFDKPAFAKIAEQAKASLAI 119


>gi|254438636|ref|ZP_05052130.1| ribosomal protein L20 [Octadecabacter antarcticus 307]
 gi|254451519|ref|ZP_05064956.1| ribosomal protein L20 [Octadecabacter antarcticus 238]
 gi|198254082|gb|EDY78396.1| ribosomal protein L20 [Octadecabacter antarcticus 307]
 gi|198265925|gb|EDY90195.1| ribosomal protein L20 [Octadecabacter antarcticus 238]
          Length = 119

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 90/117 (76%), Gaps = 2/117 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKV  +AKG+YGRR NT + A+ AVD++ QYA RDR  +KR+FR+LWI
Sbjct: 2   RVKGGTVTHRRHKKVTDAAKGYYGRRSNTFKVARQAVDKANQYATRDRHNRKRNFRALWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           QRINAAVR  D  L YS+FINGL+ AGI +DRKVL+DLA+ + D+F  IVE ++S +
Sbjct: 62  QRINAAVRSIDETLTYSRFINGLNLAGIEVDRKVLADLAVHEPDAFGAIVEKAKSAM 118


>gi|254292432|ref|YP_003058455.1| ribosomal protein L20 [Hirschia baltica ATCC 49814]
 gi|254040963|gb|ACT57758.1| ribosomal protein L20 [Hirschia baltica ATCC 49814]
          Length = 120

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/113 (61%), Positives = 87/113 (76%), Gaps = 2/113 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R +  V + A+HKKV+K+AKG+YGRRKNT R A++AV ++ QYAY  R+VKKR FRSL
Sbjct: 1   MARARGKVPAHARHKKVIKAAKGYYGRRKNTFRTAQSAVMKAGQYAYVGRKVKKRAFRSL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAAVR  D   NYS FING+ KAGI +DRKVLSDLAI +  +FK + +
Sbjct: 61  WIQRINAAVREIDPNTNYSTFINGITKAGIQIDRKVLSDLAIKEPAAFKAVFD 113


>gi|118497778|ref|YP_898828.1| 50S ribosomal protein L20 [Francisella tularensis subsp. novicida
           U112]
 gi|194323750|ref|ZP_03057526.1| ribosomal protein L20 [Francisella tularensis subsp. novicida FTE]
 gi|208779841|ref|ZP_03247185.1| ribosomal protein L20 [Francisella novicida FTG]
 gi|166219645|sp|A0Q759|RL20_FRATN RecName: Full=50S ribosomal protein L20
 gi|118423684|gb|ABK90074.1| 50S ribosomal protein L20 [Francisella novicida U112]
 gi|194322114|gb|EDX19596.1| ribosomal protein L20 [Francisella tularensis subsp. novicida FTE]
 gi|208744296|gb|EDZ90596.1| ribosomal protein L20 [Francisella novicida FTG]
          Length = 118

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 83/106 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KAGI LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKAGIELDRKALAELAVYNKDAF 106


>gi|148284326|ref|YP_001248416.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Boryong]
 gi|166219671|sp|A5CCZ4|RL20_ORITB RecName: Full=50S ribosomal protein L20
 gi|146739765|emb|CAM79624.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Boryong]
          Length = 121

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R + G V+  +HKK+LK AKG+ GR KN  R A   V+++ QY+YRDRR +KR FR+L
Sbjct: 1   MSRARSGKVNKNRHKKILKLAKGYRGRAKNCFRIAIQKVEKALQYSYRDRRNRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR YD+ YSQFINGL +A I +DRKV+++LA+   DSF  +VEL++  L
Sbjct: 61  WIQRINAAVRQYDMTYSQFINGLKQANITVDRKVMANLAVHNADSFVHLVELTKKSL 117


>gi|296135848|ref|YP_003643090.1| ribosomal protein L20 [Thiomonas intermedia K12]
 gi|294340013|emb|CAZ88377.1| 50S ribosomal subunit protein L20 [Thiomonas sp. 3As]
 gi|295795970|gb|ADG30760.1| ribosomal protein L20 [Thiomonas intermedia K12]
          Length = 118

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 70/110 (63%), Positives = 83/110 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRRKN  R AK AV ++ QYAYRDRR KKR+FRSL
Sbjct: 1   MPRVKRGVTARARHKKVLDLAKGFRGRRKNVYRIAKEAVMKAGQYAYRDRRAKKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAAVR   + YS F+NG+ KA I +DRKVL+D+A+    +F KIV
Sbjct: 61  WITRINAAVRQSGMTYSVFMNGMKKAQIEIDRKVLADMAVHDAAAFAKIV 110


>gi|304320478|ref|YP_003854121.1| 50S ribosomal protein L20 [Parvularcula bermudensis HTCC2503]
 gi|303299380|gb|ADM08979.1| 50S ribosomal protein L20 [Parvularcula bermudensis HTCC2503]
          Length = 119

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V  A+HKK++  AKG+YG R    R A  AV+++ QYAYRDR+ +KR+FR L
Sbjct: 1   MSRVKTGTVRKARHKKIIGQAKGYYGARHRLFRTANQAVEKAGQYAYRDRKARKREFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS F+NGL KAGI +DRK+L+DLA  + +SF  IVE ++  L
Sbjct: 61  WIQRINAAVREHGLTYSVFMNGLAKAGIEVDRKMLADLAAREPESFAAIVEKAKGAL 117


>gi|134301675|ref|YP_001121643.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|254373135|ref|ZP_04988624.1| 50S ribosomal protein L20 [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254374588|ref|ZP_04990069.1| 50S ribosomal protein L20 [Francisella novicida GA99-3548]
 gi|166219646|sp|A4IX71|RL20_FRATW RecName: Full=50S ribosomal protein L20
 gi|134049452|gb|ABO46523.1| ribosomal protein L20 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151570862|gb|EDN36516.1| 50S ribosomal protein L20 [Francisella novicida GA99-3549]
 gi|151572307|gb|EDN37961.1| 50S ribosomal protein L20 [Francisella novicida GA99-3548]
 gi|332184281|gb|AEE26535.1| LSU ribosomal protein L20p [Francisella cf. novicida 3523]
 gi|332678494|gb|AEE87623.1| LSU ribosomal protein L20p [Francisella cf. novicida Fx1]
          Length = 118

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KAG+ LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKAGVELDRKALAELAVYNKDAF 106


>gi|34496806|ref|NP_901021.1| 50S ribosomal protein L20 [Chromobacterium violaceum ATCC 12472]
 gi|39931752|sp|Q7NYC3|RL20_CHRVO RecName: Full=50S ribosomal protein L20
 gi|34102661|gb|AAQ59026.1| 50S ribosomal protein L20 [Chromobacterium violaceum ATCC 12472]
          Length = 119

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKILALAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YS+F+NGL KA I +DRKVL+DLA+    +F +IVE +++ L
Sbjct: 61  WIARINAAARENGLPYSKFMNGLKKAAIEIDRKVLADLAVFDKPAFAQIVEKAKASL 117


>gi|325982722|ref|YP_004295124.1| 50S ribosomal protein L20 [Nitrosomonas sp. AL212]
 gi|325532241|gb|ADZ26962.1| ribosomal protein L20 [Nitrosomonas sp. AL212]
          Length = 119

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKILDLAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS F+NGL KA I +DRKVL+DLA+    +F+KIVE +++ L
Sbjct: 61  WIARINAAARECGLSYSVFMNGLKKASIEVDRKVLADLAVFDKSAFEKIVEQAKASL 117


>gi|187931724|ref|YP_001891709.1| 50S ribosomal protein L20 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|226730402|sp|B2SGS0|RL20_FRATM RecName: Full=50S ribosomal protein L20
 gi|187712633|gb|ACD30930.1| 50S ribosomal protein L20 [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 121

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KAG+ LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKAGVELDRKALAELAVYNKDAF 106


>gi|301629971|ref|XP_002944105.1| PREDICTED: 50S ribosomal protein L20-like [Xenopus (Silurana)
           tropicalis]
          Length = 119

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVYRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  ++RL
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKAAIEIDRKMLADLAVHDKAAFGSIVEQVKARL 117


>gi|89900133|ref|YP_522604.1| 50S ribosomal protein L20 [Rhodoferax ferrireducens T118]
 gi|109893143|sp|Q21YT0|RL20_RHOFD RecName: Full=50S ribosomal protein L20
 gi|89344870|gb|ABD69073.1| LSU ribosomal protein L20P [Rhodoferax ferrireducens T118]
          Length = 119

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVYRVAKEAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   + YSQF NGL KA I +DRKVLSD+A+  + +F  IV+  +++L
Sbjct: 61  WIARINAAARQCGMTYSQFANGLKKANIEIDRKVLSDIAVHDMAAFASIVDQVKAKL 117


>gi|91784425|ref|YP_559631.1| 50S ribosomal protein L20 [Burkholderia xenovorans LB400]
 gi|115351415|ref|YP_773254.1| 50S ribosomal protein L20 [Burkholderia ambifaria AMMD]
 gi|170695987|ref|ZP_02887125.1| ribosomal protein L20 [Burkholderia graminis C4D1M]
 gi|170701129|ref|ZP_02892103.1| ribosomal protein L20 [Burkholderia ambifaria IOP40-10]
 gi|171318445|ref|ZP_02907600.1| ribosomal protein L20 [Burkholderia ambifaria MEX-5]
 gi|172060454|ref|YP_001808106.1| 50S ribosomal protein L20 [Burkholderia ambifaria MC40-6]
 gi|187924729|ref|YP_001896371.1| 50S ribosomal protein L20 [Burkholderia phytofirmans PsJN]
 gi|209516672|ref|ZP_03265525.1| ribosomal protein L20 [Burkholderia sp. H160]
 gi|295677045|ref|YP_003605569.1| ribosomal protein L20 [Burkholderia sp. CCGE1002]
 gi|296163124|ref|ZP_06845895.1| ribosomal protein L20 [Burkholderia sp. Ch1-1]
 gi|307730399|ref|YP_003907623.1| 50S ribosomal protein L20 [Burkholderia sp. CCGE1003]
 gi|323526733|ref|YP_004228886.1| 50S ribosomal protein L20 [Burkholderia sp. CCGE1001]
 gi|122323388|sp|Q0BG03|RL20_BURCM RecName: Full=50S ribosomal protein L20
 gi|123168270|sp|Q13WG0|RL20_BURXL RecName: Full=50S ribosomal protein L20
 gi|226730364|sp|B1YP16|RL20_BURA4 RecName: Full=50S ribosomal protein L20
 gi|226730369|sp|B2SZF9|RL20_BURPP RecName: Full=50S ribosomal protein L20
 gi|91688379|gb|ABE31579.1| LSU ribosomal protein L20P [Burkholderia xenovorans LB400]
 gi|115281403|gb|ABI86920.1| LSU ribosomal protein L20P [Burkholderia ambifaria AMMD]
 gi|170133951|gb|EDT02305.1| ribosomal protein L20 [Burkholderia ambifaria IOP40-10]
 gi|170139067|gb|EDT07257.1| ribosomal protein L20 [Burkholderia graminis C4D1M]
 gi|171096359|gb|EDT41261.1| ribosomal protein L20 [Burkholderia ambifaria MEX-5]
 gi|171992971|gb|ACB63890.1| ribosomal protein L20 [Burkholderia ambifaria MC40-6]
 gi|187715923|gb|ACD17147.1| ribosomal protein L20 [Burkholderia phytofirmans PsJN]
 gi|209502947|gb|EEA02950.1| ribosomal protein L20 [Burkholderia sp. H160]
 gi|295436888|gb|ADG16058.1| ribosomal protein L20 [Burkholderia sp. CCGE1002]
 gi|295886626|gb|EFG66473.1| ribosomal protein L20 [Burkholderia sp. Ch1-1]
 gi|307584934|gb|ADN58332.1| ribosomal protein L20 [Burkholderia sp. CCGE1003]
 gi|323383735|gb|ADX55826.1| ribosomal protein L20 [Burkholderia sp. CCGE1001]
          Length = 119

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++K AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKIIKLAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAAVR +D+ YS FINGL KA I LDRKVL+D+A+    +F  IV+
Sbjct: 61  WITRINAAVRQHDMTYSVFINGLKKASIELDRKVLADMAVFDKAAFAAIVQ 111


>gi|254796601|ref|YP_003081437.1| ribosomal protein L20 [Neorickettsia risticii str. Illinois]
 gi|254589848|gb|ACT69210.1| ribosomal protein L20 [Neorickettsia risticii str. Illinois]
          Length = 117

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 90/117 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV    +HKKV+K AKGF+GR KN  R A   +++S QYAYRDR+V+KRDFRSL
Sbjct: 1   MARVKRGVQVRQRHKKVIKQAKGFHGRSKNCYRIALRRLEKSWQYAYRDRKVRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS F+ GL  AGI ++RKVLS+LAI+Q  +F +IV+ +++ L
Sbjct: 61  WIQRINAAVRSFGLVYSVFMKGLKAAGIDVNRKVLSELAISQPSAFGEIVDKAKAAL 117


>gi|119897373|ref|YP_932586.1| 50S ribosomal protein L20 [Azoarcus sp. BH72]
 gi|166219605|sp|A1K4E4|RL20_AZOSB RecName: Full=50S ribosomal protein L20
 gi|119669786|emb|CAL93699.1| 50S ribosomal protein L20 [Azoarcus sp. BH72]
          Length = 119

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLDQAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YS F+NGL KA + +DRKVL+DLA+    +F  + E +R++L
Sbjct: 61  WIARINAAARELGLTYSTFMNGLKKAAVEVDRKVLADLAVFDKPAFAALAEQARAKL 117


>gi|319794588|ref|YP_004156228.1| ribosomal protein l20 [Variovorax paradoxus EPS]
 gi|315597051|gb|ADU38117.1| ribosomal protein L20 [Variovorax paradoxus EPS]
          Length = 119

 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRVAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NG+ KAGI +DRK+L+D+A+    +F  IVE  +++L
Sbjct: 61  WIARINAASRELGLTYSQFANGIRKAGIEIDRKMLADIAVHDKAAFAGIVEQVKAKL 117


>gi|224826511|ref|ZP_03699612.1| ribosomal protein L20 [Lutiella nitroferrum 2002]
 gi|224601112|gb|EEG07294.1| ribosomal protein L20 [Lutiella nitroferrum 2002]
          Length = 118

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKILALAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL KA I +DRKVL+DLA+    +F +IVE +++ L
Sbjct: 61  WIARINAGARELGLSYSKFMNGLKKAAIEIDRKVLADLAVFDKPAFAQIVEKAKASL 117


>gi|255263270|ref|ZP_05342612.1| ribosomal protein L20 [Thalassiobium sp. R2A62]
 gi|255105605|gb|EET48279.1| ribosomal protein L20 [Thalassiobium sp. R2A62]
          Length = 119

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 88/117 (75%), Gaps = 2/117 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKK+   AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+LWI
Sbjct: 2   RVKSGPVTHRRHKKITDQAKGYYGRRKNTFKVATQAVDKANQYATRDRKNRKRNFRALWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           QRINAAVR  D  L YS+FINGL  AGI +DRKVL+DLA+ + D+F  IV  +++ L
Sbjct: 62  QRINAAVRSVDETLTYSKFINGLALAGIEVDRKVLADLAVNEPDAFGAIVSQAKAAL 118


>gi|89052942|ref|YP_508393.1| 50S ribosomal protein L20 [Jannaschia sp. CCS1]
 gi|109893118|sp|Q28V94|RL20_JANSC RecName: Full=50S ribosomal protein L20
 gi|88862491|gb|ABD53368.1| LSU ribosomal protein L20P [Jannaschia sp. CCS1]
          Length = 119

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (74%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K G V+  +HKKV+ +AKG+YG R    R A  AVD++ QYA RDR+ +KR FR+L
Sbjct: 1   MSRTKGGTVTHRRHKKVIDAAKGYYGARSTNFRTATQAVDKANQYATRDRKNRKRQFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL KAGI +DRKVL+DLA+ + D+F  IV+ +++ L
Sbjct: 61  WIQRINAAVRQHDEALTYSRFINGLAKAGIEVDRKVLADLAVHEPDAFSAIVDQAKAAL 119


>gi|92115707|ref|YP_575436.1| 50S ribosomal protein L20 [Nitrobacter hamburgensis X14]
 gi|122418957|sp|Q1QS21|RL20_NITHX RecName: Full=50S ribosomal protein L20
 gi|91798601|gb|ABE60976.1| LSU ribosomal protein L20P [Nitrobacter hamburgensis X14]
          Length = 119

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 87/107 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV K  KGF GRRKNTIRAAKAA D++ QYA+RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVYKITKGFSGRRKNTIRAAKAAADKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WIQR+NAAVR + + YS FINGL K+GI +DRKVLSDLAI +  +F+
Sbjct: 61  WIQRLNAAVRPFGMTYSVFINGLSKSGITVDRKVLSDLAINEPAAFQ 107


>gi|319779413|ref|YP_004130326.1| LSU ribosomal protein L20p [Taylorella equigenitalis MCE9]
 gi|317109437|gb|ADU92183.1| LSU ribosomal protein L20p [Taylorella equigenitalis MCE9]
          Length = 119

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++K AKGF GRR N  R AK AV R+ QYAYRDRR KKR FRSL
Sbjct: 1   MPRVKRGVTARARHKKIIKLAKGFRGRRGNVFRVAKQAVMRAGQYAYRDRRNKKRSFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   + YS FI GL KA I LDRKVL+D+A+     F  IV+ ++  L
Sbjct: 61  WIARINAAVREQGMTYSAFIAGLKKAAISLDRKVLADMAVNDKPGFAVIVKQAKVAL 117


>gi|121594738|ref|YP_986634.1| 50S ribosomal protein L20 [Acidovorax sp. JS42]
 gi|241764281|ref|ZP_04762311.1| ribosomal protein L20 [Acidovorax delafieldii 2AN]
 gi|319763194|ref|YP_004127131.1| ribosomal protein l20 [Alicycliphilus denitrificans BC]
 gi|330825388|ref|YP_004388691.1| 50S ribosomal protein L20 [Alicycliphilus denitrificans K601]
 gi|166219600|sp|A1W8I3|RL20_ACISJ RecName: Full=50S ribosomal protein L20
 gi|120606818|gb|ABM42558.1| LSU ribosomal protein L20P [Acidovorax sp. JS42]
 gi|241366350|gb|EER60880.1| ribosomal protein L20 [Acidovorax delafieldii 2AN]
 gi|317117755|gb|ADV00244.1| ribosomal protein L20 [Alicycliphilus denitrificans BC]
 gi|329310760|gb|AEB85175.1| 50S ribosomal protein L20 [Alicycliphilus denitrificans K601]
          Length = 119

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  +++L
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKASIEIDRKMLADLAVHDKAAFGSIVEQVKAKL 117


>gi|78486005|ref|YP_391930.1| 50S ribosomal protein L20 [Thiomicrospira crunogena XCL-2]
 gi|109893166|sp|Q31F17|RL20_THICR RecName: Full=50S ribosomal protein L20
 gi|78364291|gb|ABB42256.1| LSU ribosomal protein L20P [Thiomicrospira crunogena XCL-2]
          Length = 118

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +H KVLK AKG+YG RK   R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARKRHNKVLKQAKGYYGARKKIFRVAKQAVIKAGQYAYRDRRNKKRQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  + YS+FI+GL+KAG+ +DRKVLSD+A+    +F  IVE +++ L
Sbjct: 61  WIARINAAARLNGMTYSRFISGLNKAGVEVDRKVLSDIAVHDAAAFSAIVEKAKAAL 117


>gi|319943684|ref|ZP_08017965.1| inorganic diphosphatase [Lautropia mirabilis ATCC 51599]
 gi|319742917|gb|EFV95323.1| inorganic diphosphatase [Lautropia mirabilis ATCC 51599]
          Length = 122

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GRRKN  R AK AV R+ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIDQAKGYRGRRKNVYRIAKEAVMRAGQYAYRDRRNRKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR + L YS F++GL KA I LDRKVL++LA+    +F  IVE  +S L
Sbjct: 61  WITRINAAVREHGLTYSVFMSGLLKAEIALDRKVLAELAVNDKPAFSAIVEQVKSTL 117


>gi|239814879|ref|YP_002943789.1| 50S ribosomal protein L20 [Variovorax paradoxus S110]
 gi|259646203|sp|C5CUU5|RL20_VARPS RecName: Full=50S ribosomal protein L20
 gi|239801456|gb|ACS18523.1| ribosomal protein L20 [Variovorax paradoxus S110]
          Length = 119

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NG+ KAGI +DRK+L+D+A+    +F  IVE  +++L
Sbjct: 61  WIARINAASRELGLTYSQFANGIRKAGIEIDRKMLADIAVHDKAAFAGIVEQVKAKL 117


>gi|88608583|ref|YP_506110.1| 50S ribosomal protein L20 [Neorickettsia sennetsu str. Miyayama]
 gi|109893126|sp|Q2GEI6|RL20_NEOSM RecName: Full=50S ribosomal protein L20
 gi|88600752|gb|ABD46220.1| ribosomal protein L20 [Neorickettsia sennetsu str. Miyayama]
          Length = 117

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 89/117 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV    +HKKV+K AKGF+GR KN  R A   +++S QYAYRDR+V+KRDFRSL
Sbjct: 1   MARVKRGVQVRQRHKKVIKQAKGFHGRSKNCYRIALRRLEKSWQYAYRDRKVRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS F+ GL  AG+ ++RKVLS+LAI+Q  +F +IV  +++ L
Sbjct: 61  WIQRINAAVRSFGLVYSVFMKGLKAAGVDVNRKVLSELAISQPSAFGEIVNKAKAAL 117


>gi|114798735|ref|YP_759161.1| 50S ribosomal protein L20 [Hyphomonas neptunium ATCC 15444]
 gi|123129149|sp|Q0C532|RL20_HYPNA RecName: Full=50S ribosomal protein L20
 gi|114738909|gb|ABI77034.1| ribosomal protein L20 [Hyphomonas neptunium ATCC 15444]
          Length = 120

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 90/119 (75%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R +  V + A+HKK++K AKGF GRRKNT   A AAV ++ +YAY  R+VKKR FRSL
Sbjct: 1   MPRSRAKVPAHARHKKIIKQAKGFRGRRKNTFSNAAAAVWKAGEYAYVGRKVKKRSFRSL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR++D  LNYS FINGL KAGI +DRKV++DLA+ + ++F  +V  +++ L
Sbjct: 61  WIQRINAAVRIHDENLNYSTFINGLTKAGIEVDRKVMADLAVREPEAFGALVAQAKAAL 119


>gi|146328998|ref|YP_001209435.1| 50S ribosomal protein L20 [Dichelobacter nodosus VCS1703A]
 gi|166219640|sp|A5EVM2|RL20_DICNV RecName: Full=50S ribosomal protein L20
 gi|146232468|gb|ABQ13446.1| 50S ribosomal protein L20 [Dichelobacter nodosus VCS1703A]
          Length = 119

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK+AKG+Y  R+ T R AK AV ++ QYAYRDR+ KKR FR L
Sbjct: 1   MARVKRGVQAHARHKKVLKAAKGYYSARRKTFRVAKQAVIKAGQYAYRDRKTKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R++ L+YS+FINGL K+GI +DRK+LS+LA+     F  + E +++ L
Sbjct: 61  WIIRINAGARIHGLSYSRFINGLKKSGIAVDRKILSELAVYDKSVFATLAEKAKAAL 117


>gi|121997233|ref|YP_001002020.1| ribosomal protein L20 [Halorhodospira halophila SL1]
 gi|166219651|sp|A1WU56|RL20_HALHL RecName: Full=50S ribosomal protein L20
 gi|121588638|gb|ABM61218.1| LSU ribosomal protein L20P [Halorhodospira halophila SL1]
          Length = 119

 Score =  135 bits (339), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKHKKVLK+AKG+YG R +  R A+  V +S QYAY  RR++KR+FRSL
Sbjct: 1   MSRVKRGVTNRAKHKKVLKAAKGYYGMRGSAFRIARQQVIKSGQYAYAHRRLRKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R + L+YS+ +NGL +AGI +DRK L+DLA+ +  SF  + E ++  L
Sbjct: 61  WIQRINAAARQHGLSYSRLMNGLQQAGIEVDRKQLADLAVHEPQSFAALAERAQGAL 117


>gi|30248958|ref|NP_841028.1| 50S ribosomal protein L20 [Nitrosomonas europaea ATCC 19718]
 gi|39931890|sp|Q82VV4|RL20_NITEU RecName: Full=50S ribosomal protein L20
 gi|30138575|emb|CAD84866.1| Ribosomal protein L20 [Nitrosomonas europaea ATCC 19718]
          Length = 119

 Score =  135 bits (339), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAKARHKKILKLAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R   + YS F+NG+ KAGI LDRK+L+DLA+    +F+KI  
Sbjct: 61  WIARINAAARELGMTYSTFMNGIRKAGISLDRKILADLAVFDKVAFEKITN 111


>gi|222110649|ref|YP_002552913.1| 50S ribosomal protein l20 [Acidovorax ebreus TPSY]
 gi|254800319|sp|B9MHY1|RL20_DIAST RecName: Full=50S ribosomal protein L20
 gi|221730093|gb|ACM32913.1| ribosomal protein L20 [Acidovorax ebreus TPSY]
          Length = 119

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  +++L
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKASIEVDRKMLADLAVHDKAAFGSIVEQVKAKL 117


>gi|75674266|ref|YP_316687.1| 50S ribosomal protein L20 [Nitrobacter winogradskyi Nb-255]
 gi|85714129|ref|ZP_01045118.1| 50S ribosomal protein L20 [Nitrobacter sp. Nb-311A]
 gi|109893129|sp|Q3SWK6|RL20_NITWN RecName: Full=50S ribosomal protein L20
 gi|74419136|gb|ABA03335.1| LSU ribosomal protein L20P [Nitrobacter winogradskyi Nb-255]
 gi|85699255|gb|EAQ37123.1| 50S ribosomal protein L20 [Nitrobacter sp. Nb-311A]
          Length = 119

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 88/107 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV K  KGF GRRKNTIRAAKAA D++ QYA+RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVYKVTKGFSGRRKNTIRAAKAAADKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WIQR+NAAVR + + YS+FI+GL K+GI +DRKVLSDLAI +  +F+
Sbjct: 61  WIQRLNAAVRPFGMTYSRFIDGLSKSGITVDRKVLSDLAINEPAAFQ 107


>gi|56707931|ref|YP_169827.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110670402|ref|YP_666959.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|224457011|ref|ZP_03665484.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254370419|ref|ZP_04986424.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874736|ref|ZP_05247446.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|81820784|sp|Q5NGL5|RL20_FRATT RecName: Full=50S ribosomal protein L20
 gi|123169438|sp|Q14I17|RL20_FRAT1 RecName: Full=50S ribosomal protein L20
 gi|56604423|emb|CAG45453.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110320735|emb|CAL08836.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|151568662|gb|EDN34316.1| hypothetical protein FTBG_00184 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840735|gb|EET19171.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159114|gb|ADA78505.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 118

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+K G+ LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKVGVELDRKALAELAVYNKDAF 106


>gi|255019926|ref|ZP_05292000.1| LSU ribosomal protein L20p [Acidithiobacillus caldus ATCC 51756]
 gi|254970585|gb|EET28073.1| LSU ribosomal protein L20p [Acidithiobacillus caldus ATCC 51756]
          Length = 121

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 87/115 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF G+RK+  R A  AV ++  Y YRDRR KKRDFRSL
Sbjct: 1   MPRVKRGVTAHARHKKVLDRAKGFRGQRKSNYRIAHQAVMKALTYEYRDRRTKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R   ++YS+F+NGL +AG+ LDRKVL+D+A+   ++F ++VEL++ 
Sbjct: 61  WIVRINAAARAEGMSYSRFMNGLLRAGVQLDRKVLADIAVRDKEAFSRLVELAKE 115


>gi|300311297|ref|YP_003775389.1| 50S ribosomal protein L20 [Herbaspirillum seropedicae SmR1]
 gi|300074082|gb|ADJ63481.1| 50S ribosomal subunit L20 protein [Herbaspirillum seropedicae SmR1]
          Length = 120

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 82/111 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGYRGRRKNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R + + YS F+NGL KA I LDRKVL+D+A+T   +F  IV 
Sbjct: 61  WIARINAAARSHGVTYSVFMNGLKKAAIELDRKVLADMAVTDKAAFAAIVN 111


>gi|257064215|ref|YP_003143887.1| LSU ribosomal protein L20P [Slackia heliotrinireducens DSM 20476]
 gi|256791868|gb|ACV22538.1| LSU ribosomal protein L20P [Slackia heliotrinireducens DSM 20476]
          Length = 117

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK AKG+YG +  + RAAK  V  S QYAYRDRR KKR+ R L
Sbjct: 1   MPRVKRAVHAHKKRRVVLKRAKGYYGAKSRSYRAAKEQVQHSLQYAYRDRRNKKREIRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YS+F+NGL KAG+ LDRKVLSD+AIT  D+F ++V+++++ L
Sbjct: 61  WITRINAACRINDMSYSRFMNGLKKAGVELDRKVLSDMAITDPDAFAQLVQVAKAAL 117


>gi|56475895|ref|YP_157484.1| 50S ribosomal protein L20 [Aromatoleum aromaticum EbN1]
 gi|81821210|sp|Q5P7X8|RL20_AZOSE RecName: Full=50S ribosomal protein L20
 gi|56311938|emb|CAI06583.1| 50S ribosomal protein L20 [Aromatoleum aromaticum EbN1]
          Length = 119

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MSRVKRGVTARARHKKVLDQAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YS F+NGL KA I +DRKVL+DLA+    +F  + + +R++L
Sbjct: 61  WIARINAAAREVGLTYSTFMNGLKKAAIEVDRKVLADLAVFDKPAFAALADQARAKL 117


>gi|114332288|ref|YP_748510.1| 50S ribosomal protein L20 [Nitrosomonas eutropha C91]
 gi|122313051|sp|Q0ADN7|RL20_NITEC RecName: Full=50S ribosomal protein L20
 gi|114309302|gb|ABI60545.1| LSU ribosomal protein L20P [Nitrosomonas eutropha C91]
          Length = 119

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V + A+HKKVLK AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRSVTARARHKKVLKLAKGYRGRRKNIYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   + YS F+NGL K+GI LDRKVL+DLA+    +F+KI    ++ L
Sbjct: 61  WIARINAAVRELGMTYSTFMNGLKKSGIGLDRKVLADLAVFDKAAFEKITNQVKTSL 117


>gi|28869578|ref|NP_792197.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|66045405|ref|YP_235246.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. syringae B728a]
 gi|71735586|ref|YP_274357.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|77458161|ref|YP_347666.1| 50S ribosomal protein L20 [Pseudomonas fluorescens Pf0-1]
 gi|213970492|ref|ZP_03398619.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato T1]
 gi|237801012|ref|ZP_04589473.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|257486169|ref|ZP_05640210.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289623633|ref|ZP_06456587.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647149|ref|ZP_06478492.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|289673301|ref|ZP_06494191.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. syringae FF5]
 gi|298486704|ref|ZP_07004761.1| LSU ribosomal protein L20p [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|301384177|ref|ZP_07232595.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato Max13]
 gi|302062683|ref|ZP_07254224.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato K40]
 gi|302132640|ref|ZP_07258630.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|302187616|ref|ZP_07264289.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. syringae 642]
 gi|330810590|ref|YP_004355052.1| 50S ribosomal protein L20 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|60393651|sp|P0A159|RL20_PSESM RecName: Full=50S ribosomal protein L20
 gi|60393652|sp|P0A160|RL20_PSESY RecName: Full=50S ribosomal protein L20
 gi|81308306|sp|Q4ZUG4|RL20_PSEU2 RecName: Full=50S ribosomal protein L20
 gi|109893135|sp|Q48JS0|RL20_PSE14 RecName: Full=50S ribosomal protein L20
 gi|109893138|sp|Q3KEX9|RL20_PSEPF RecName: Full=50S ribosomal protein L20
 gi|1171434|gb|AAB05016.1| ribosomal protein L20 [Pseudomonas syringae pv. syringae]
 gi|28852820|gb|AAO55892.1| ribosomal protein L20 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|63256112|gb|AAY37208.1| Ribosomal protein L20, bacterial and organelle form [Pseudomonas
           syringae pv. syringae B728a]
 gi|71556139|gb|AAZ35350.1| ribosomal protein L20 [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|77382164|gb|ABA73677.1| 50S ribosomal protein L20 [Pseudomonas fluorescens Pf0-1]
 gi|213924663|gb|EEB58231.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato T1]
 gi|298158787|gb|EFH99850.1| LSU ribosomal protein L20p [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320324305|gb|EFW80384.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320328573|gb|EFW84575.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|327378698|gb|AEA70048.1| 50S ribosomal protein L20 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|330867698|gb|EGH02407.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330876792|gb|EGH10941.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330888319|gb|EGH20980.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. mori str.
           301020]
 gi|330898076|gb|EGH29495.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330943374|gb|EGH45743.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330951869|gb|EGH52129.1| 50S ribosomal protein L20 [Pseudomonas syringae Cit 7]
 gi|330967295|gb|EGH67555.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|330973948|gb|EGH74014.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330989238|gb|EGH87341.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331010499|gb|EGH90555.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331016136|gb|EGH96192.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
 gi|331023869|gb|EGI03926.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 118

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  RV  L+YS+FI GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARVNGLSYSRFIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKATL 117


>gi|302878341|ref|YP_003846905.1| 50S ribosomal protein L20 [Gallionella capsiferriformans ES-2]
 gi|302581130|gb|ADL55141.1| ribosomal protein L20 [Gallionella capsiferriformans ES-2]
          Length = 119

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 70/119 (58%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVVARATHKKLLAKAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQKKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + + YS F+NGL KA I +DRKVLSD+AI    +F++ V  +++ L V
Sbjct: 61  WIARINAAAREFGMPYSVFMNGLKKADIQIDRKVLSDIAIFDKAAFEQFVVQAKASLAV 119


>gi|187478561|ref|YP_786585.1| 50S ribosomal protein L20 [Bordetella avium 197N]
 gi|109893098|sp|Q2KZL8|RL20_BORA1 RecName: Full=50S ribosomal protein L20
 gi|115423147|emb|CAJ49678.1| 50S ribosomal protein L20 [Bordetella avium 197N]
          Length = 119

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 71/117 (60%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   L+YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L
Sbjct: 61  WITRINAAVREQGLSYSVFIAGLKKAAIELDRKVLADLAVRDKAGFAAIVQQAKAAL 117


>gi|146278522|ref|YP_001168681.1| 50S ribosomal protein L20 [Rhodobacter sphaeroides ATCC 17025]
 gi|166220735|sp|A4WVG2|RL20_RHOS5 RecName: Full=50S ribosomal protein L20
 gi|145556763|gb|ABP71376.1| LSU ribosomal protein L20P [Rhodobacter sphaeroides ATCC 17025]
          Length = 120

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 86/108 (79%), Gaps = 2/108 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+H+KV+K+AKG+Y  R    R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKSGKVTHARHRKVIKAAKGYYAARSTNFRTATQAVDKANQYATRDRKARKRNFRAL 60

Query: 61  WIQRINAAVRVYDL--NYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAAVR++DL   YS+FINGL KAGI +DRKVL+DLA+ + ++F
Sbjct: 61  WIQRINAAVRLFDLEMTYSRFINGLAKAGIEVDRKVLADLAVHEPEAF 108


>gi|317403227|gb|EFV83746.1| 50S ribosomal protein L20 [Achromobacter xylosoxidans C54]
          Length = 119

 Score =  134 bits (337), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVISAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR + ++YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L
Sbjct: 61  WITRINAAVREHGVSYSVFIAGLKKAAIELDRKVLADLAVRDKAGFAAIVQQAKAAL 117


>gi|126725097|ref|ZP_01740940.1| 50S ribosomal protein L20 [Rhodobacterales bacterium HTCC2150]
 gi|126706261|gb|EBA05351.1| 50S ribosomal protein L20 [Rhodobacterales bacterium HTCC2150]
          Length = 120

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (74%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RV  G V+ A+HKKV+K+AKG+ GRRKN  R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVTSGKVTHARHKKVIKAAKGYSGRRKNAFRTATQAVDKANQYATRDRKARKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR  D    YS+FINGL  AGI +DRKVL+DLA+ +  +F+ IV  +++ L
Sbjct: 61  WIQRINAGVRSIDAAFTYSRFINGLALAGIEVDRKVLADLAVHEPAAFEAIVNKAKAAL 119


>gi|94499188|ref|ZP_01305726.1| Ribosomal protein L20 [Oceanobacter sp. RED65]
 gi|94428820|gb|EAT13792.1| Ribosomal protein L20 [Oceanobacter sp. RED65]
          Length = 117

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKKVLK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKVLKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+FINGL  A I +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARINGLSYSRFINGLKNASIEIDRKVLADLAVNEKAAFAALVEKAKASL 117


>gi|120611520|ref|YP_971198.1| 50S ribosomal protein L20 [Acidovorax citrulli AAC00-1]
 gi|166219595|sp|A1TR36|RL20_ACIAC RecName: Full=50S ribosomal protein L20
 gi|120589984|gb|ABM33424.1| LSU ribosomal protein L20P [Acidovorax citrulli AAC00-1]
          Length = 120

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  +KGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALSKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  +++L
Sbjct: 61  WIARINAASRELGLTYSQFTNGLKKAAIEIDRKMLADLAVHDKAAFGSIVEQVKAKL 117


>gi|293604703|ref|ZP_06687103.1| 50S ribosomal protein L20 [Achromobacter piechaudii ATCC 43553]
 gi|311105458|ref|YP_003978311.1| 50S ribosomal protein L20 [Achromobacter xylosoxidans A8]
 gi|292816872|gb|EFF75953.1| 50S ribosomal protein L20 [Achromobacter piechaudii ATCC 43553]
 gi|310760147|gb|ADP15596.1| ribosomal protein L20 [Achromobacter xylosoxidans A8]
          Length = 119

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR + ++YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L
Sbjct: 61  WITRINAAVREHGVSYSVFIAGLKKASIELDRKVLADLAVRDKAGFAAIVQQAKAAL 117


>gi|53719555|ref|YP_108541.1| 50S ribosomal protein L20 [Burkholderia pseudomallei K96243]
 gi|53725299|ref|YP_102784.1| 50S ribosomal protein L20 [Burkholderia mallei ATCC 23344]
 gi|76811509|ref|YP_333293.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1710b]
 gi|78066089|ref|YP_368858.1| 50S ribosomal protein L20 [Burkholderia sp. 383]
 gi|83720846|ref|YP_443108.1| 50S ribosomal protein L20 [Burkholderia thailandensis E264]
 gi|107022551|ref|YP_620878.1| 50S ribosomal protein L20 [Burkholderia cenocepacia AU 1054]
 gi|116689500|ref|YP_835123.1| 50S ribosomal protein L20 [Burkholderia cenocepacia HI2424]
 gi|121600171|ref|YP_992863.1| 50S ribosomal protein L20 [Burkholderia mallei SAVP1]
 gi|124383575|ref|YP_001026203.1| 50S ribosomal protein L20 [Burkholderia mallei NCTC 10229]
 gi|126439011|ref|YP_001058755.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 668]
 gi|126448576|ref|YP_001080527.1| 50S ribosomal protein L20 [Burkholderia mallei NCTC 10247]
 gi|126455404|ref|YP_001066008.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1106a]
 gi|134282222|ref|ZP_01768927.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 305]
 gi|134295550|ref|YP_001119285.1| 50S ribosomal protein L20 [Burkholderia vietnamiensis G4]
 gi|161524949|ref|YP_001579961.1| 50S ribosomal protein L20 [Burkholderia multivorans ATCC 17616]
 gi|167587360|ref|ZP_02379748.1| ribosomal protein L20 [Burkholderia ubonensis Bu]
 gi|170732805|ref|YP_001764752.1| 50S ribosomal protein L20 [Burkholderia cenocepacia MC0-3]
 gi|186476313|ref|YP_001857783.1| 50S ribosomal protein L20 [Burkholderia phymatum STM815]
 gi|189350303|ref|YP_001945931.1| 50S ribosomal protein L20 [Burkholderia multivorans ATCC 17616]
 gi|206559850|ref|YP_002230614.1| 50S ribosomal protein L20 [Burkholderia cenocepacia J2315]
 gi|217423695|ref|ZP_03455196.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 576]
 gi|221197736|ref|ZP_03570782.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD2M]
 gi|221204706|ref|ZP_03577723.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD2]
 gi|221214901|ref|ZP_03587869.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD1]
 gi|226199674|ref|ZP_03795227.1| 50S ribosomal protein L20 [Burkholderia pseudomallei Pakistan 9]
 gi|237812019|ref|YP_002896470.1| ribosomal protein L20 [Burkholderia pseudomallei MSHR346]
 gi|238027728|ref|YP_002911959.1| 50S ribosomal protein L20 [Burkholderia glumae BGR1]
 gi|238562602|ref|ZP_00440145.2| 50S ribosomal protein L20 [Burkholderia mallei GB8 horse 4]
 gi|242318100|ref|ZP_04817116.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1106b]
 gi|251767931|ref|ZP_02268877.2| 50S ribosomal protein L20 [Burkholderia mallei PRL-20]
 gi|254178226|ref|ZP_04884881.1| 50S ribosomal protein L20 [Burkholderia mallei ATCC 10399]
 gi|254180001|ref|ZP_04886600.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1655]
 gi|254188585|ref|ZP_04895096.1| 50S ribosomal protein L20 [Burkholderia pseudomallei Pasteur 52237]
 gi|254197460|ref|ZP_04903882.1| 50S ribosomal protein L20 [Burkholderia pseudomallei S13]
 gi|254199736|ref|ZP_04906102.1| 50S ribosomal protein L20 [Burkholderia mallei FMH]
 gi|254206058|ref|ZP_04912410.1| 50S ribosomal protein L20 [Burkholderia mallei JHU]
 gi|254245607|ref|ZP_04938928.1| Ribosomal protein L20 [Burkholderia cenocepacia PC184]
 gi|254260097|ref|ZP_04951151.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1710a]
 gi|254297836|ref|ZP_04965289.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 406e]
 gi|254358429|ref|ZP_04974702.1| 50S ribosomal protein L20 [Burkholderia mallei 2002721280]
 gi|330816672|ref|YP_004360377.1| 50S ribosomal protein L20 [Burkholderia gladioli BSR3]
 gi|60390321|sp|Q62KI5|RL20_BURMA RecName: Full=50S ribosomal protein L20
 gi|60390332|sp|Q63TM5|RL20_BURPS RecName: Full=50S ribosomal protein L20
 gi|109893100|sp|Q3JT10|RL20_BURP1 RecName: Full=50S ribosomal protein L20
 gi|109893101|sp|Q39H52|RL20_BURS3 RecName: Full=50S ribosomal protein L20
 gi|109893102|sp|Q2SVE1|RL20_BURTA RecName: Full=50S ribosomal protein L20
 gi|123371646|sp|Q1BWV0|RL20_BURCA RecName: Full=50S ribosomal protein L20
 gi|166219615|sp|A0K6V3|RL20_BURCH RecName: Full=50S ribosomal protein L20
 gi|166219616|sp|A3MJU1|RL20_BURM7 RecName: Full=50S ribosomal protein L20
 gi|166219617|sp|A2S2N4|RL20_BURM9 RecName: Full=50S ribosomal protein L20
 gi|166219618|sp|A1V3R0|RL20_BURMS RecName: Full=50S ribosomal protein L20
 gi|166219619|sp|A3NUI7|RL20_BURP0 RecName: Full=50S ribosomal protein L20
 gi|166219620|sp|A3N8T4|RL20_BURP6 RecName: Full=50S ribosomal protein L20
 gi|166219621|sp|A4JDU7|RL20_BURVG RecName: Full=50S ribosomal protein L20
 gi|226730365|sp|B1K094|RL20_BURCC RecName: Full=50S ribosomal protein L20
 gi|226730366|sp|B4E7I8|RL20_BURCJ RecName: Full=50S ribosomal protein L20
 gi|226730367|sp|A9ABF6|RL20_BURM1 RecName: Full=50S ribosomal protein L20
 gi|226730368|sp|B2JJJ4|RL20_BURP8 RecName: Full=50S ribosomal protein L20
 gi|52209969|emb|CAH35941.1| 50S ribosomal protein L20 [Burkholderia pseudomallei K96243]
 gi|52428722|gb|AAU49315.1| ribosomal protein L20 [Burkholderia mallei ATCC 23344]
 gi|76580962|gb|ABA50437.1| ribosomal protein L20 [Burkholderia pseudomallei 1710b]
 gi|77966834|gb|ABB08214.1| LSU ribosomal protein L20P [Burkholderia sp. 383]
 gi|83654671|gb|ABC38734.1| ribosomal protein L20 [Burkholderia thailandensis E264]
 gi|105892740|gb|ABF75905.1| LSU ribosomal protein L20P [Burkholderia cenocepacia AU 1054]
 gi|116647589|gb|ABK08230.1| LSU ribosomal protein L20P [Burkholderia cenocepacia HI2424]
 gi|121228981|gb|ABM51499.1| 50S ribosomal protein L20 [Burkholderia mallei SAVP1]
 gi|124291595|gb|ABN00864.1| 50S ribosomal protein L20 [Burkholderia mallei NCTC 10229]
 gi|124870383|gb|EAY62099.1| Ribosomal protein L20 [Burkholderia cenocepacia PC184]
 gi|126218504|gb|ABN82010.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 668]
 gi|126229046|gb|ABN92586.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1106a]
 gi|126241446|gb|ABO04539.1| 50S ribosomal protein L20 [Burkholderia mallei NCTC 10247]
 gi|134138707|gb|ABO54450.1| LSU ribosomal protein L20P [Burkholderia vietnamiensis G4]
 gi|134246260|gb|EBA46349.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 305]
 gi|147749332|gb|EDK56406.1| 50S ribosomal protein L20 [Burkholderia mallei FMH]
 gi|147753501|gb|EDK60566.1| 50S ribosomal protein L20 [Burkholderia mallei JHU]
 gi|148027556|gb|EDK85577.1| 50S ribosomal protein L20 [Burkholderia mallei 2002721280]
 gi|157807770|gb|EDO84940.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 406e]
 gi|157936264|gb|EDO91934.1| 50S ribosomal protein L20 [Burkholderia pseudomallei Pasteur 52237]
 gi|160342378|gb|ABX15464.1| ribosomal protein L20 [Burkholderia multivorans ATCC 17616]
 gi|160699265|gb|EDP89235.1| 50S ribosomal protein L20 [Burkholderia mallei ATCC 10399]
 gi|169654201|gb|EDS86894.1| 50S ribosomal protein L20 [Burkholderia pseudomallei S13]
 gi|169816047|gb|ACA90630.1| ribosomal protein L20 [Burkholderia cenocepacia MC0-3]
 gi|184192772|gb|ACC70737.1| ribosomal protein L20 [Burkholderia phymatum STM815]
 gi|184210541|gb|EDU07584.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1655]
 gi|189334325|dbj|BAG43395.1| large subunit ribosomal protein L20 [Burkholderia multivorans ATCC
           17616]
 gi|198035891|emb|CAR51783.1| 50S ribosomal protein L20 [Burkholderia cenocepacia J2315]
 gi|217393553|gb|EEC33574.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 576]
 gi|221165128|gb|EED97606.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD1]
 gi|221175563|gb|EEE07993.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD2]
 gi|221181668|gb|EEE14069.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD2M]
 gi|225928260|gb|EEH24294.1| 50S ribosomal protein L20 [Burkholderia pseudomallei Pakistan 9]
 gi|237506728|gb|ACQ99046.1| ribosomal protein L20 [Burkholderia pseudomallei MSHR346]
 gi|237876922|gb|ACR29255.1| 50S ribosomal protein L20 [Burkholderia glumae BGR1]
 gi|238522287|gb|EEP85732.1| 50S ribosomal protein L20 [Burkholderia mallei GB8 horse 4]
 gi|242141339|gb|EES27741.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1106b]
 gi|243061338|gb|EES43524.1| 50S ribosomal protein L20 [Burkholderia mallei PRL-20]
 gi|254218786|gb|EET08170.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1710a]
 gi|325528724|gb|EGD05794.1| 50S ribosomal protein L20 [Burkholderia sp. TJI49]
 gi|327369065|gb|AEA60421.1| 50S ribosomal protein L20 [Burkholderia gladioli BSR3]
          Length = 119

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++  AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKIINLAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAAVR +D+ YS FINGL KA I LDRKVL+D+A+    +F  IV+
Sbjct: 61  WITRINAAVRQHDMTYSVFINGLKKASIELDRKVLADMAVFDKAAFAAIVK 111


>gi|33593558|ref|NP_881202.1| 50S ribosomal protein L20 [Bordetella pertussis Tohama I]
 gi|33597178|ref|NP_884821.1| 50S ribosomal protein L20 [Bordetella parapertussis 12822]
 gi|33601022|ref|NP_888582.1| 50S ribosomal protein L20 [Bordetella bronchiseptica RB50]
 gi|39931822|sp|Q7VVR3|RL20_BORPE RecName: Full=50S ribosomal protein L20
 gi|39931837|sp|Q7W7C8|RL20_BORPA RecName: Full=50S ribosomal protein L20
 gi|39931856|sp|Q7WKR6|RL20_BORBR RecName: Full=50S ribosomal protein L20
 gi|33572914|emb|CAE42850.1| 50s ribosomal protein [Bordetella pertussis Tohama I]
 gi|33573605|emb|CAE37889.1| 50s ribosomal protein [Bordetella parapertussis]
 gi|33575457|emb|CAE32535.1| 50s ribosomal protein [Bordetella bronchiseptica RB50]
 gi|332382965|gb|AEE67812.1| 50S ribosomal protein L20 [Bordetella pertussis CS]
          Length = 119

 Score =  133 bits (335), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   ++YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L
Sbjct: 61  WITRINAAVREQGMSYSVFIAGLKKAAIELDRKVLADLAVRDKAGFAAIVQQAKAAL 117


>gi|57238868|ref|YP_180004.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
 gi|58578797|ref|YP_197009.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
 gi|58616856|ref|YP_196055.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Gardel]
 gi|81311348|sp|Q5FH69|RL20_EHRRG RecName: Full=50S ribosomal protein L20
 gi|81819283|sp|Q5HC39|RL20_EHRRW RecName: Full=50S ribosomal protein L20
 gi|57160947|emb|CAH57853.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
 gi|58416468|emb|CAI27581.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Gardel]
 gi|58417423|emb|CAI26627.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
          Length = 123

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K AKG+ GR KN  R A   V+++ QYAYRDRR +KR FRSL
Sbjct: 1   MARVKRGVTTRARHKKVIKLAKGYRGRSKNCYRVALQRVEKALQYAYRDRRNRKRFFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR Y L YS FI GL  A I L+RK+L+D+A+   D+FK+IV+L++  L
Sbjct: 61  WIMRINAAVRQYGLLYSDFIYGLSLANITLNRKILADMAVHNKDNFKQIVDLTKEAL 117


>gi|187929054|ref|YP_001899541.1| 50S ribosomal protein L20 [Ralstonia pickettii 12J]
 gi|309782530|ref|ZP_07677253.1| ribosomal protein L20 [Ralstonia sp. 5_7_47FAA]
 gi|226730440|sp|B2UGJ5|RL20_RALPJ RecName: Full=50S ribosomal protein L20
 gi|187725944|gb|ACD27109.1| ribosomal protein L20 [Ralstonia pickettii 12J]
 gi|308918621|gb|EFP64295.1| ribosomal protein L20 [Ralstonia sp. 5_7_47FAA]
          Length = 118

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKGF GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVISAAKGFRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R + L YS+F+NGL KA I LDRKVLSD+AI    +F  IV 
Sbjct: 61  WIARINAGAREHGLTYSKFMNGLKKASIELDRKVLSDMAIHDKVAFAAIVN 111


>gi|74317028|ref|YP_314768.1| 50S ribosomal protein L20 [Thiobacillus denitrificans ATCC 25259]
 gi|109893167|sp|Q3SK31|RL20_THIDA RecName: Full=50S ribosomal protein L20
 gi|74056523|gb|AAZ96963.1| ribosomal protein L20 [Thiobacillus denitrificans ATCC 25259]
          Length = 119

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A HKK+L +AKG+ GRRKN  R A  AV ++ QY YRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARASHKKILDAAKGYRGRRKNVFRVANEAVMKAGQYQYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L YS F+NGL +A I +DRKVLSD+AI   D+F KIV+  +++L
Sbjct: 61  WIARINAAARQHGLTYSVFMNGLSRAEIGVDRKVLSDIAIFDKDAFAKIVDQVKAKL 117


>gi|288959441|ref|YP_003449782.1| large subunit ribosomal protein L20 [Azospirillum sp. B510]
 gi|288911749|dbj|BAI73238.1| large subunit ribosomal protein L20 [Azospirillum sp. B510]
          Length = 123

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+LK AKG+ GR     R A   V+++ +YAYRDRR KKRDFR L
Sbjct: 1   MARVKRGVTTHARHRKILKLAKGYRGRNSKNFRIAIEKVEKALRYAYRDRRNKKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA VR Y L YS+FING+  AGI +DRKVLSDLA  + ++FK +V+
Sbjct: 61  WIQRINAGVRQYGLTYSRFINGIKLAGIEIDRKVLSDLAAREPEAFKTLVD 111


>gi|89256697|ref|YP_514059.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115315104|ref|YP_763827.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156502857|ref|YP_001428922.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010449|ref|ZP_02275380.1| ribosomal protein L20 [Francisella tularensis subsp. holarctica
           FSC200]
 gi|254368004|ref|ZP_04984024.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           257]
 gi|290954128|ref|ZP_06558749.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295312446|ref|ZP_06803218.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|122324894|sp|Q0BL44|RL20_FRATO RecName: Full=50S ribosomal protein L20
 gi|122500487|sp|Q2A2J3|RL20_FRATH RecName: Full=50S ribosomal protein L20
 gi|166219644|sp|A7NDB3|RL20_FRATF RecName: Full=50S ribosomal protein L20
 gi|89144528|emb|CAJ79843.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115130003|gb|ABI83190.1| ribosomal protein L20 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134253814|gb|EBA52908.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           257]
 gi|156253460|gb|ABU61966.1| ribosomal protein L20 [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 118

 Score =  133 bits (334), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 82/106 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KA + LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKADVELDRKALAELAVYNKDAF 106


>gi|221066197|ref|ZP_03542302.1| ribosomal protein L20 [Comamonas testosteroni KF-1]
 gi|264679163|ref|YP_003279070.1| ribosomal protein L20 [Comamonas testosteroni CNB-2]
 gi|299533559|ref|ZP_07046935.1| 50S ribosomal protein L20 [Comamonas testosteroni S44]
 gi|220711220|gb|EED66588.1| ribosomal protein L20 [Comamonas testosteroni KF-1]
 gi|262209676|gb|ACY33774.1| ribosomal protein L20 [Comamonas testosteroni CNB-2]
 gi|298718465|gb|EFI59446.1| 50S ribosomal protein L20 [Comamonas testosteroni S44]
          Length = 119

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLNLAKGFRGRRGNVFRVAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NGL KA I +DRK+L+D+A+    +F  IV+  +++L
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKAAIEIDRKMLADIAVHDKAAFAAIVDQVKAKL 117


>gi|254369556|ref|ZP_04985567.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           FSC022]
 gi|157122510|gb|EDO66645.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           FSC022]
          Length = 118

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLD 104
           WI RINAA R +D++YSQ INGL+KAG+ LDRK L++LA+   D
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKAGVELDRKALAELAVYNKD 104


>gi|156306347|ref|XP_001617587.1| hypothetical protein NEMVEDRAFT_v1g69888 [Nematostella vectensis]
 gi|156194697|gb|EDO25487.1| predicted protein [Nematostella vectensis]
          Length = 111

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 86/111 (77%), Gaps = 2/111 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GVV+ A+H+KV+K+AKG+Y  R    R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKSGVVTHARHRKVIKAAKGYYAARSTNFRTATQAVDKANQYATRDRKTRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKI 109
           WIQRINAAVR++D    YS+FINGL  +GI +DRKVL+DLA+ + ++F  I
Sbjct: 61  WIQRINAAVRLFDASFTYSRFINGLMLSGIEVDRKVLADLAVHEPEAFNAI 111


>gi|77462308|ref|YP_351812.1| 50S ribosomal protein L20 [Rhodobacter sphaeroides 2.4.1]
 gi|126461184|ref|YP_001042298.1| 50S ribosomal protein L20 [Rhodobacter sphaeroides ATCC 17029]
 gi|221638163|ref|YP_002524425.1| 50S ribosomal protein L20 [Rhodobacter sphaeroides KD131]
 gi|332560190|ref|ZP_08414512.1| 50S ribosomal protein L20 [Rhodobacter sphaeroides WS8N]
 gi|109893147|sp|Q3J5M3|RL20_RHOS4 RecName: Full=50S ribosomal protein L20
 gi|166220734|sp|A3PGR0|RL20_RHOS1 RecName: Full=50S ribosomal protein L20
 gi|254800336|sp|B9KLE1|RL20_RHOSK RecName: Full=50S ribosomal protein L20
 gi|77386726|gb|ABA77911.1| LSU ribosomal protein L20P [Rhodobacter sphaeroides 2.4.1]
 gi|126102848|gb|ABN75526.1| LSU ribosomal protein L20P [Rhodobacter sphaeroides ATCC 17029]
 gi|221158944|gb|ACL99923.1| 50S ribosomal protein L20 [Rhodobacter sphaeroides KD131]
 gi|332277902|gb|EGJ23217.1| 50S ribosomal protein L20 [Rhodobacter sphaeroides WS8N]
          Length = 120

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 85/108 (78%), Gaps = 2/108 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+H+KV+K AKG+Y  R    R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKSGKVTHARHRKVIKQAKGYYAARSTNFRTATQAVDKANQYATRDRKARKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAAVR++D  + YS+FINGL KAGI +DRKVL+DLA+ + ++F
Sbjct: 61  WIQRINAAVRLFDIEMTYSRFINGLSKAGIEVDRKVLADLAVHEPEAF 108


>gi|209965598|ref|YP_002298513.1| 50S ribosomal protein L20 [Rhodospirillum centenum SW]
 gi|226730443|sp|B6IPJ8|RL20_RHOCS RecName: Full=50S ribosomal protein L20
 gi|209959064|gb|ACI99700.1| ribosomal protein L20 [Rhodospirillum centenum SW]
          Length = 119

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/111 (58%), Positives = 84/111 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+ GR     R A   V+++ +YAYRDRR +KRDFR L
Sbjct: 1   MARVKRGVTTHARHKKVLKLAKGYRGRSSKCYRIALERVEKALRYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R++ L YS+F++GL +AGI +DRKVLSD+A  + +SFK +VE
Sbjct: 61  WIQRINAGARLHGLTYSKFMHGLKRAGIEVDRKVLSDIAAREPESFKALVE 111


>gi|328953977|ref|YP_004371311.1| 50S ribosomal protein L20 [Desulfobacca acetoxidans DSM 11109]
 gi|328454301|gb|AEB10130.1| 50S ribosomal protein L20 [Desulfobacca acetoxidans DSM 11109]
          Length = 117

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 90/113 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K AKG+ G R++  R+A+ AVDR+  +AYRDR+V+KR+FR+L
Sbjct: 1   MPRVKRGVRARARHKKVMKLAKGYRGGRRSLYRSAREAVDRALCFAYRDRKVRKREFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI R+NAAVR + L+YS+FI+ L KA I LDRKVL+DLA+   + F +IVEL+
Sbjct: 61  WIVRLNAAVRPFGLSYSRFIHQLDKANIRLDRKVLADLAVYHPEDFSRIVELA 113


>gi|92113925|ref|YP_573853.1| 50S ribosomal protein L20 [Chromohalobacter salexigens DSM 3043]
 gi|122419926|sp|Q1QWK4|RL20_CHRSD RecName: Full=50S ribosomal protein L20
 gi|91797015|gb|ABE59154.1| LSU ribosomal protein L20P [Chromohalobacter salexigens DSM 3043]
          Length = 117

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 87/115 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MTRVKRGVVARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R   L+YS+FI GL K+GI +DRKVL+DLA+ +  +F  IV+ +++
Sbjct: 61  WITRINAASRANGLSYSRFIAGLKKSGIEIDRKVLADLAVHEKAAFAAIVDKAKA 115


>gi|73540972|ref|YP_295492.1| 50S ribosomal protein L20 [Ralstonia eutropha JMP134]
 gi|94310108|ref|YP_583318.1| 50S ribosomal protein L20 [Cupriavidus metallidurans CH34]
 gi|113867360|ref|YP_725849.1| 50S ribosomal protein L20 [Ralstonia eutropha H16]
 gi|194289386|ref|YP_002005293.1| 50S ribosomal protein l20 [Cupriavidus taiwanensis LMG 19424]
 gi|109893141|sp|Q472N5|RL20_RALEJ RecName: Full=50S ribosomal protein L20
 gi|123329355|sp|Q0KBZ0|RL20_RALEH RecName: Full=50S ribosomal protein L20
 gi|166220732|sp|Q1LP77|RL20_RALME RecName: Full=50S ribosomal protein L20
 gi|226730383|sp|B3R4J4|RL20_CUPTR RecName: Full=50S ribosomal protein L20
 gi|72118385|gb|AAZ60648.1| LSU ribosomal protein L20P [Ralstonia eutropha JMP134]
 gi|93353960|gb|ABF08049.1| 50S ribosomal subunit protein L20 [Cupriavidus metallidurans CH34]
 gi|113526136|emb|CAJ92481.1| LSU ribosomal protein L20 [Ralstonia eutropha H16]
 gi|193223221|emb|CAQ69226.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Cupriavidus taiwanensis LMG 19424]
          Length = 118

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 81/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIDAAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R + + YS F+NGL KA I LDRKVLSD+AI    +F  IV 
Sbjct: 61  WIARINAATREHGMTYSVFMNGLKKASIELDRKVLSDMAIHDKPAFAAIVN 111


>gi|325954890|ref|YP_004238550.1| 50S ribosomal protein L20 [Weeksella virosa DSM 16922]
 gi|323437508|gb|ADX67972.1| 50S ribosomal protein L20 [Weeksella virosa DSM 16922]
          Length = 114

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 82/111 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK AKG+YGRRKN    AK AV++  QYAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNSVASRARRKKVLKLAKGYYGRRKNVWTVAKNAVEKGLQYAYRDRRQKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R++ ++YSQF+    KAGI L+RKVL+DLA+   ++FK IVE
Sbjct: 61  WIQRINAGARLHGMSYSQFMGATKKAGIELNRKVLADLAMNNPEAFKAIVE 111


>gi|53805114|ref|YP_113206.1| 50S ribosomal protein L20 [Methylococcus capsulatus str. Bath]
 gi|81823701|sp|Q60AZ1|RL20_METCA RecName: Full=50S ribosomal protein L20
 gi|53758875|gb|AAU93166.1| ribosomal protein L20 [Methylococcus capsulatus str. Bath]
          Length = 115

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 86/115 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARARHKKVLKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINA  R + L+YS+FI+GL KA I +DRKVL+DLA+   D+F ++  +++ 
Sbjct: 61  WITRINAGAREFGLSYSRFISGLKKASIEIDRKVLADLAVRDKDAFAELARIAQG 115


>gi|89094706|ref|ZP_01167642.1| Ribosomal protein L20 [Oceanospirillum sp. MED92]
 gi|89081052|gb|EAR60288.1| Ribosomal protein L20 [Oceanospirillum sp. MED92]
          Length = 118

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKKVLK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKVLKKAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+FI GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARLNGLSYSRFIAGLKKANIEIDRKVLADLAVHEAGAFAAIVEKAKASL 117


>gi|326317190|ref|YP_004234862.1| 50S ribosomal protein L20 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374026|gb|ADX46295.1| ribosomal protein L20 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 120

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  +KGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALSKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  + +L
Sbjct: 61  WIARINAASRELGLTYSQFTNGLKKAAIEIDRKMLADLAVHDKAAFGSIVEQVKVKL 117


>gi|260576212|ref|ZP_05844204.1| ribosomal protein L20 [Rhodobacter sp. SW2]
 gi|259021480|gb|EEW24784.1| ribosomal protein L20 [Rhodobacter sp. SW2]
          Length = 121

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 85/108 (78%), Gaps = 2/108 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GVV+ A+H+KV+K+A G+Y  R    R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKSGVVTHARHRKVIKAAAGYYAARSTNFRTATQAVDKANQYATRDRKTRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAAVR++D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F
Sbjct: 61  WIQRINAAVRLFDPALTYSRFINGLALAGIEVDRKVLADLAVHEPEAF 108


>gi|149194092|ref|ZP_01871190.1| 50S ribosomal protein L20 [Caminibacter mediatlanticus TB-2]
 gi|149136045|gb|EDM24523.1| 50S ribosomal protein L20 [Caminibacter mediatlanticus TB-2]
          Length = 116

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V   +HKK+LK AKGFY  R+   R AK  V+RS  YA+RDR+ KKRDFR LWI
Sbjct: 2   RVKTGTVRRRRHKKILKMAKGFYSGRRKHFRKAKEQVERSLVYAFRDRKQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D++YS+FINGL KAGI LDRK+L+DLA+ + ++F KIV  ++  L
Sbjct: 62  IRINAACRLNDISYSRFINGLKKAGIELDRKILADLAMNEPEAFAKIVNKAKEAL 116


>gi|332284516|ref|YP_004416427.1| 50S ribosomal protein L20 [Pusillimonas sp. T7-7]
 gi|330428469|gb|AEC19803.1| 50S ribosomal protein L20 [Pusillimonas sp. T7-7]
          Length = 119

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K+AKG+ GRR N  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIKAAKGYRGRRGNVFRIAKQAVMKAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS FI G  KA I LDRKVL+D+A+     F  +VE ++S L
Sbjct: 61  WITRINAACRELGVSYSVFIAGTKKASIELDRKVLADMAVNDKAGFAAVVEQAKSAL 117


>gi|152989863|ref|YP_001355585.1| 50S ribosomal protein L20 [Nitratiruptor sp. SB155-2]
 gi|215274802|sp|A6Q169|RL20_NITSB RecName: Full=50S ribosomal protein L20
 gi|151421724|dbj|BAF69228.1| 50S ribosomal protein L20 [Nitratiruptor sp. SB155-2]
          Length = 116

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 87/115 (75%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V   +HKK+LK AKGFY  R+   R AK  ++RS  YAYRDR+ KKR+FR LWI
Sbjct: 2   RVKTGTVRRRRHKKILKQAKGFYSGRRKHFRKAKEQLERSLVYAYRDRKQKKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D++YS+FI+GL KAGI LDRK+L+D+A+ + ++FK +VE +++ L
Sbjct: 62  TRINAACRLNDISYSRFIHGLSKAGIELDRKILADMAMNEPEAFKAVVEKAKAAL 116


>gi|146307007|ref|YP_001187472.1| 50S ribosomal protein L20 [Pseudomonas mendocina ymp]
 gi|166220728|sp|A4XTS4|RL20_PSEMY RecName: Full=50S ribosomal protein L20
 gi|145575208|gb|ABP84740.1| LSU ribosomal protein L20P [Pseudomonas mendocina ymp]
          Length = 118

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARARHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  RV  L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARVNGLSYSRLIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKAVL 117


>gi|160871981|ref|ZP_02062113.1| ribosomal protein L20 [Rickettsiella grylli]
 gi|159120780|gb|EDP46118.1| ribosomal protein L20 [Rickettsiella grylli]
          Length = 118

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK+AKG+ G R   IRAAK AV ++ QYAYRDR+ KKRDFR+L
Sbjct: 1   MPRVKRGVTARARHKKILKAAKGYRGARSRIIRAAKQAVIKAGQYAYRDRKQKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   + YS  I GL+KA I +DRK+L+DLA+T   +F + VE ++  L
Sbjct: 61  WIVRINAAAREQGMRYSHLIAGLNKAEIAVDRKILADLAVTDKAAFAQFVEKAKQAL 117


>gi|241663240|ref|YP_002981600.1| 50S ribosomal protein L20 [Ralstonia pickettii 12D]
 gi|240865267|gb|ACS62928.1| ribosomal protein L20 [Ralstonia pickettii 12D]
          Length = 118

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 81/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVISAAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R + L YS+F+NGL KA I LDRKVLSD+AI    +F  IV 
Sbjct: 61  WIARINAGAREHGLTYSKFMNGLKKASIELDRKVLSDMAIHDKVAFAAIVN 111


>gi|163856954|ref|YP_001631252.1| 50S ribosomal protein L20 [Bordetella petrii DSM 12804]
 gi|226730361|sp|A9IPU1|RL20_BORPD RecName: Full=50S ribosomal protein L20
 gi|163260682|emb|CAP42984.1| 50S ribosomal protein L20 [Bordetella petrii]
          Length = 119

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   ++YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L
Sbjct: 61  WITRINAAVREQGMSYSVFIAGLKKASIDLDRKVLADLAVRDKAGFAAIVQQAKAAL 117


>gi|294141071|ref|YP_003557049.1| 50S ribosomal protein L20 [Shewanella violacea DSS12]
 gi|293327540|dbj|BAJ02271.1| ribosomal protein L20 [Shewanella violacea DSS12]
          Length = 119

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAKQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFTTLVEKAKDAL 117


>gi|326795749|ref|YP_004313569.1| 50S ribosomal protein L20 [Marinomonas mediterranea MMB-1]
 gi|326546513|gb|ADZ91733.1| 50S ribosomal protein L20 [Marinomonas mediterranea MMB-1]
          Length = 118

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVQARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FI GL KA I +DRKVL+DLA+ + + F  IVE +++ L
Sbjct: 61  WIARINAAARINGLSYSRFIAGLKKASIEIDRKVLADLAVYEKEVFAAIVEKAKASL 117


>gi|157375260|ref|YP_001473860.1| 50S ribosomal protein L20 [Shewanella sediminis HAW-EB3]
 gi|189041888|sp|A8FV59|RL20_SHESH RecName: Full=50S ribosomal protein L20
 gi|157317634|gb|ABV36732.1| ribosomal protein L20 [Shewanella sediminis HAW-EB3]
          Length = 119

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAKQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFTTLVEKAKEAL 117


>gi|17546299|ref|NP_519701.1| 50S ribosomal protein L20 [Ralstonia solanacearum GMI1000]
 gi|83748300|ref|ZP_00945325.1| LSU ribosomal protein L20P [Ralstonia solanacearum UW551]
 gi|207724054|ref|YP_002254452.1| 550s ribosomal protein l20 [Ralstonia solanacearum MolK2]
 gi|207742949|ref|YP_002259341.1| 550s ribosomal protein l20 [Ralstonia solanacearum IPO1609]
 gi|300691318|ref|YP_003752313.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Ralstonia solanacearum PSI07]
 gi|300703881|ref|YP_003745483.1| 50S ribosomal protein L20 [Ralstonia solanacearum CFBP2957]
 gi|20978579|sp|Q8XZ26|RL20_RALSO RecName: Full=50S ribosomal protein L20
 gi|17428596|emb|CAD15282.1| probable 550s ribosomal protein l20 [Ralstonia solanacearum
           GMI1000]
 gi|83725032|gb|EAP72185.1| LSU ribosomal protein L20P [Ralstonia solanacearum UW551]
 gi|206589263|emb|CAQ36225.1| 550s ribosomal protein l20 [Ralstonia solanacearum MolK2]
 gi|206594344|emb|CAQ61271.1| 550s ribosomal protein l20 [Ralstonia solanacearum IPO1609]
 gi|299066589|emb|CBJ37779.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Ralstonia solanacearum CMR15]
 gi|299071544|emb|CBJ42868.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Ralstonia solanacearum CFBP2957]
 gi|299078378|emb|CBJ51028.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Ralstonia solanacearum PSI07]
          Length = 118

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 82/111 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIDAAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R + L+YS+F+NGL KA I LDRKVLSD+AI    +F  IV 
Sbjct: 61  WIARINAGAREHGLSYSKFMNGLKKASIELDRKVLSDMAIHDKVAFAAIVN 111


>gi|307822737|ref|ZP_07652968.1| ribosomal protein L20 [Methylobacter tundripaludum SV96]
 gi|307736341|gb|EFO07187.1| ribosomal protein L20 [Methylobacter tundripaludum SV96]
          Length = 120

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 87/115 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R AK AV ++ QYAYRDR+ KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+  ++YS+FINGL KA + +DRKVL+D+A+  + +F +I ++++ 
Sbjct: 61  WIVRINAAARLSGMSYSRFINGLTKANVKIDRKVLADIAVRDIAAFAEIAKIAKE 115


>gi|229591576|ref|YP_002873695.1| 50S ribosomal protein L20 [Pseudomonas fluorescens SBW25]
 gi|312961940|ref|ZP_07776437.1| 50S ribosomal protein L20 [Pseudomonas fluorescens WH6]
 gi|259646195|sp|C3JZN4|RL20_PSEFS RecName: Full=50S ribosomal protein L20
 gi|229363442|emb|CAY50639.1| 50S ribosomal protein L20 [Pseudomonas fluorescens SBW25]
 gi|311283750|gb|EFQ62334.1| 50S ribosomal protein L20 [Pseudomonas fluorescens WH6]
          Length = 118

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  RV  L+YS+FI GL KA I +DRKVL++LA+ +   F  IVE +++ L
Sbjct: 61  WIARINAGARVNGLSYSRFIAGLKKASIEIDRKVLAELAVNEKAVFAAIVEKAKATL 117


>gi|87122881|ref|ZP_01078749.1| Ribosomal protein L20 [Marinomonas sp. MED121]
 gi|86161832|gb|EAQ63129.1| Ribosomal protein L20 [Marinomonas sp. MED121]
          Length = 118

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVQARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+FI GL KA I +DRKVL+DLA+ + + F  IVE +++ L
Sbjct: 61  WIARINAAARINGMSYSRFIAGLKKAAIEIDRKVLADLAVYEKEVFAAIVEKAKASL 117


>gi|15604459|ref|NP_220977.1| 50S ribosomal protein L20 [Rickettsia prowazekii str. Madrid E]
 gi|6225976|sp|Q9ZCV0|RL20_RICPR RecName: Full=50S ribosomal protein L20
 gi|3861153|emb|CAA15053.1| CYANELLE 50S RIBOSOMAL PROTEIN L20 (rplT) [Rickettsia prowazekii]
 gi|292572233|gb|ADE30148.1| 50S ribosomal protein L20 [Rickettsia prowazekii Rp22]
          Length = 117

 Score =  131 bits (330), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  N  R A   V++  QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKKRHKKILKLAKGYRGRANNCFRVAIEKVEKGLQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L KAGI +DRKVL++LA+   D F  IV+ S++ +
Sbjct: 61  WIQRINAAVREHGLIYSQFMGALKKAGINIDRKVLAELAVNNNDGFASIVQQSKAHI 117


>gi|254252555|ref|ZP_04945873.1| Ribosomal protein L20 [Burkholderia dolosa AUO158]
 gi|124895164|gb|EAY69044.1| Ribosomal protein L20 [Burkholderia dolosa AUO158]
          Length = 119

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 83/111 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++  AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKIINLAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAAVR +D+ YS FI+GL KA I LDRKVL+D+A+    +F  IV+
Sbjct: 61  WITRINAAVRQHDMTYSVFISGLKKASIELDRKVLADMAVFDKAAFAAIVK 111


>gi|127512957|ref|YP_001094154.1| 50S ribosomal protein L20 [Shewanella loihica PV-4]
 gi|166220746|sp|A3QEJ7|RL20_SHELP RecName: Full=50S ribosomal protein L20
 gi|126638252|gb|ABO23895.1| LSU ribosomal protein L20P [Shewanella loihica PV-4]
          Length = 119

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAKQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKEAL 117


>gi|237747670|ref|ZP_04578150.1| large subunit ribosomal protein L20 [Oxalobacter formigenes OXCC13]
 gi|229379032|gb|EEO29123.1| large subunit ribosomal protein L20 [Oxalobacter formigenes OXCC13]
          Length = 119

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 81/110 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKK+L  AKGF GRR +  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MSRVKRGVTARARHKKILAEAKGFRGRRSSVFRVAKEAVMKAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAA R   ++YS F+NGL KA I LDRKVL+D+A+    +F  IV
Sbjct: 61  WITRINAATRELGMSYSVFMNGLKKASIELDRKVLADMAVADKPAFAAIV 110


>gi|330503836|ref|YP_004380705.1| 50S ribosomal protein L20 [Pseudomonas mendocina NK-01]
 gi|328918122|gb|AEB58953.1| 50S ribosomal protein L20 [Pseudomonas mendocina NK-01]
          Length = 118

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARARHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARINGLSYSRLIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKAVL 117


>gi|198284329|ref|YP_002220650.1| 50S ribosomal protein L20 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667881|ref|YP_002426990.1| ribosomal protein L20 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226730342|sp|B7J7S7|RL20_ACIF2 RecName: Full=50S ribosomal protein L20
 gi|226730343|sp|B5EN54|RL20_ACIF5 RecName: Full=50S ribosomal protein L20
 gi|198248850|gb|ACH84443.1| ribosomal protein L20 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218520094|gb|ACK80680.1| ribosomal protein L20 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 119

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKGF G+RK+  R A  AV ++  Y YRDRR KKRDFRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLARAKGFRGQRKSNYRIAHQAVMKALTYEYRDRRTKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   + YS+F+NGL +AGI LDRKVL+D+A+    +F ++VE+ + +L
Sbjct: 61  WIVRINAAARSEGVTYSRFMNGLLRAGIQLDRKVLADIAVRDKAAFSRLVEVVKGQL 117


>gi|116515022|ref|YP_802651.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
 gi|122285582|sp|Q057Z1|RL20_BUCCC RecName: Full=50S ribosomal protein L20
 gi|116256876|gb|ABJ90558.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
          Length = 119

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 90/119 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKV+K AKG+YG R    R A  AV +S QY+YRDRR KKRDFR L
Sbjct: 1   MARVKRGVIAHARHKKVIKLAKGYYGARSRVYRVANQAVIKSGQYSYRDRRNKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAV+ Y+L+YS+FI GL  + I ++RK+LS++AI    SFKK+V+ S++ L +
Sbjct: 61  WIIRINAAVKNYNLSYSKFIYGLKLSSININRKILSEIAIFDKISFKKLVDYSKNALSI 119


>gi|237808483|ref|YP_002892923.1| 50S ribosomal protein L20 [Tolumonas auensis DSM 9187]
 gi|259646202|sp|C4LFH0|RL20_TOLAT RecName: Full=50S ribosomal protein L20
 gi|237500744|gb|ACQ93337.1| ribosomal protein L20 [Tolumonas auensis DSM 9187]
          Length = 118

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL +AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLNAAKGYYGARSRIYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FINGL KA I +DRK+LSD+A+    +F  +VE +++ L
Sbjct: 61  WIVRINAAARLNGLSYSRFINGLKKASIEIDRKILSDIAVHDKATFTALVEKAKAAL 117


>gi|330977712|gb|EGH77615.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 118

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  + KK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRQKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  RV  L+YS+FI GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARVNGLSYSRFIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKATL 117


>gi|73666767|ref|YP_302783.1| 50S ribosomal protein L20 [Ehrlichia canis str. Jake]
 gi|109893113|sp|Q3YSX0|RL20_EHRCJ RecName: Full=50S ribosomal protein L20
 gi|72393908|gb|AAZ68185.1| LSU ribosomal protein L20P [Ehrlichia canis str. Jake]
          Length = 124

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K AKG+ GR KN  R A   V+++ QYAYRDRR +KR FRSL
Sbjct: 1   MARVKRGVTTRARHKKVIKLAKGYRGRSKNCYRIALQRVEKALQYAYRDRRNRKRFFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L YS FI+GL  A I L+RKVL+D+A+   D+FK+IV++++  L
Sbjct: 61  WIMRINAAARQHGLLYSDFIHGLSLANITLNRKVLADMAVNNQDNFKQIVDITKEAL 117


>gi|163752534|ref|ZP_02159720.1| 50S ribosomal protein L20 [Shewanella benthica KT99]
 gi|161327589|gb|EDP98787.1| 50S ribosomal protein L20 [Shewanella benthica KT99]
          Length = 119

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRIAKQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFTTLVERAKDAL 117


>gi|322833536|ref|YP_004213563.1| ribosomal protein L20 [Rahnella sp. Y9602]
 gi|321168737|gb|ADW74436.1| ribosomal protein L20 [Rahnella sp. Y9602]
          Length = 118

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R  D++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNDMSYSKFINGLKKASIEIDRKILADIAVFDKVAFSALVEKAKAAL 117


>gi|56460504|ref|YP_155785.1| 50S ribosomal protein L20 [Idiomarina loihiensis L2TR]
 gi|81821732|sp|Q5QYN7|RL20_IDILO RecName: Full=50S ribosomal protein L20
 gi|56179514|gb|AAV82236.1| Ribosomal protein L20 [Idiomarina loihiensis L2TR]
          Length = 117

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+   + F  +VE ++  L
Sbjct: 61  WIVRINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVHDQNGFAALVEKAKGAL 117


>gi|88800314|ref|ZP_01115880.1| Ribosomal protein L20 [Reinekea sp. MED297]
 gi|88776891|gb|EAR08100.1| Ribosomal protein L20 [Reinekea sp. MED297]
          Length = 118

 Score =  131 bits (329), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKKVLK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKVLKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  RV  L+YS+FINGL KA + +DRKVL+D+A+    +F  I E +++ L
Sbjct: 61  WIARINAEARVNGLSYSKFINGLKKADVEIDRKVLADIAVHDKSAFAAIAEQAKASL 117


>gi|171058431|ref|YP_001790780.1| 50S ribosomal protein L20 [Leptothrix cholodnii SP-6]
 gi|226730415|sp|B1XYZ6|RL20_LEPCP RecName: Full=50S ribosomal protein L20
 gi|170775876|gb|ACB34015.1| ribosomal protein L20 [Leptothrix cholodnii SP-6]
          Length = 118

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/117 (61%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRRKN  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRKNVYRIAKQAVMKAGQYAYRDRRAKKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YS+FI GL KA I +DRKVLSD+AI    +F  IV+  +++L
Sbjct: 61  WIARINAASRSLGLTYSKFIAGLKKAQIDIDRKVLSDMAIHDPAAFGSIVDKVKAQL 117


>gi|254515026|ref|ZP_05127087.1| ribosomal protein L20 [gamma proteobacterium NOR5-3]
 gi|219677269|gb|EED33634.1| ribosomal protein L20 [gamma proteobacterium NOR5-3]
          Length = 119

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVVAHRRHKKILKQAKGYYGARSRVFRVAKQAVTKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L YS+ INGL KA I LDR+VL+DLA+    +F  +VE +++ L
Sbjct: 61  WITRINAQSRANGLTYSKLINGLKKANIGLDRRVLADLAVHDKPAFAAVVEQAKAAL 117


>gi|220934625|ref|YP_002513524.1| ribosomal protein L20 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254800349|sp|B8GRI3|RL20_THISH RecName: Full=50S ribosomal protein L20
 gi|219995935|gb|ACL72537.1| ribosomal protein L20 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 119

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 84/109 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG RKN  R A  AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKVLKKAKGYYGARKNVYRVAVQAVTKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKI 109
           WI RINAA R + L+YS+ ++GL+KA + +DRKVL+DLA+  + +F +I
Sbjct: 61  WIVRINAAARQFGLSYSRMMDGLNKANVEIDRKVLADLAVHDITAFGQI 109


>gi|269215919|ref|ZP_06159773.1| ribosomal protein L20 [Slackia exigua ATCC 700122]
 gi|269130178|gb|EEZ61256.1| ribosomal protein L20 [Slackia exigua ATCC 700122]
          Length = 117

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  AKG+YG +  + RAAK  V  S QY YRDRR KKR+ R L
Sbjct: 1   MPRVKRAVNAHKKRRVVLSRAKGYYGAKSRSYRAAKEQVQHSLQYVYRDRRNKKREIRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVLSD+AIT  D+F ++VE+++  L
Sbjct: 61  WITRINAAARISGLSYSKFMNGLKKAGITLDRKVLSDMAITDPDAFAQLVEVAKKAL 117


>gi|146282709|ref|YP_001172862.1| 50S ribosomal protein L20 [Pseudomonas stutzeri A1501]
 gi|166220730|sp|A4VM19|RL20_PSEU5 RecName: Full=50S ribosomal protein L20
 gi|145570914|gb|ABP80020.1| 50S ribosomal protein L20 [Pseudomonas stutzeri A1501]
 gi|327481048|gb|AEA84358.1| 50S ribosomal protein L20 [Pseudomonas stutzeri DSM 4166]
          Length = 118

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  RV  L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARVNGLSYSRLIAGLKKAAIEIDRKVLADLAVNEKAAFAAIVEKAKASL 117


>gi|68171433|ref|ZP_00544823.1| Ribosomal protein L20, bacterial and organelle form [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658511|ref|YP_507021.1| 50S ribosomal protein L20 [Ehrlichia chaffeensis str. Arkansas]
 gi|109893114|sp|Q2GHR2|RL20_EHRCR RecName: Full=50S ribosomal protein L20
 gi|67999153|gb|EAM85813.1| Ribosomal protein L20, bacterial and organelle form [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599968|gb|ABD45437.1| ribosomal protein L20 [Ehrlichia chaffeensis str. Arkansas]
          Length = 124

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K AKG+ GR KN  R A   V+++ QYAYRDRR +KR FRSL
Sbjct: 1   MARVKRGVTTRARHKKVIKLAKGYRGRSKNCYRIALQRVEKALQYAYRDRRNRKRFFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR + L YS FI+GL  A + L+RKVL+D+A+   D FK+IV+L +  L
Sbjct: 61  WIMRINAAVRQHGLLYSDFIHGLSLANVTLNRKVLADMAVNHKDHFKQIVDLIKEAL 117


>gi|90021227|ref|YP_527054.1| 50S ribosomal protein L20 [Saccharophagus degradans 2-40]
 gi|109893149|sp|Q21KD7|RL20_SACD2 RecName: Full=50S ribosomal protein L20
 gi|89950827|gb|ABD80842.1| LSU ribosomal protein L20P [Saccharophagus degradans 2-40]
          Length = 119

 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKKVLK+AKG+YG R    R AK AV ++ QYAYRDRRVKKR+FR+L
Sbjct: 1   MARVKRGVVARRRHKKVLKAAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA I LDR+VL+DLAI    +F  IV  ++  L
Sbjct: 61  WITRINAQSRAEGLSYSRLIAGLKKASIALDRRVLADLAIHDKTAFAAIVAKAQEAL 117


>gi|160900045|ref|YP_001565627.1| 50S ribosomal protein L20 [Delftia acidovorans SPH-1]
 gi|226730386|sp|A9C3D1|RL20_DELAS RecName: Full=50S ribosomal protein L20
 gi|160365629|gb|ABX37242.1| ribosomal protein L20 [Delftia acidovorans SPH-1]
          Length = 119

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  +KGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALSKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRAKKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YSQF NGL KA I +DRK+L+D+A+    +F  IV+  +++L
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKAAIEIDRKMLADIAVHDKAAFSSIVDQVKAKL 117


>gi|90417314|ref|ZP_01225240.1| 50S ribosomal protein L20 [marine gamma proteobacterium HTCC2207]
 gi|90330899|gb|EAS46162.1| 50S ribosomal protein L20 [marine gamma proteobacterium HTCC2207]
          Length = 118

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVEAGRRHKKILKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRAKKRTFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  RV  L YS+ INGL KAGI LDR+VL+DLA+    +F  +V L+++ L
Sbjct: 61  WIARINAQSRVEGLAYSRLINGLSKAGIALDRRVLADLAVHDKAAFGAVVNLAKAAL 117


>gi|88706035|ref|ZP_01103743.1| 50S ribosomal protein L20 [Congregibacter litoralis KT71]
 gi|88699749|gb|EAQ96860.1| 50S ribosomal protein L20 [Congregibacter litoralis KT71]
          Length = 119

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVVAHRRHKKILKQAKGYYGARSRVFRVAKQAVTKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L YS+ INGL KA I LDR+VL+DLA+    +F  +VE +++ L
Sbjct: 61  WITRINAQSRANGLTYSKLINGLKKADIGLDRRVLADLAVHDKPAFAAVVEQAKAAL 117


>gi|84514588|ref|ZP_01001952.1| 50S ribosomal protein L20 [Loktanella vestfoldensis SKA53]
 gi|84511639|gb|EAQ08092.1| 50S ribosomal protein L20 [Loktanella vestfoldensis SKA53]
          Length = 119

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 87/117 (74%), Gaps = 2/117 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVL +AKG+Y RR  T + AK AVD++ QYA RDR  +KR+FR+LWI
Sbjct: 2   RVKGGTVTHRRHKKVLDAAKGYYDRRSKTFKVAKQAVDKANQYATRDRHNRKRNFRALWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           QRINA VR  D  LNYS+FINGL  AGI +DRKVL+DLA+ + ++F  IV  +++ +
Sbjct: 62  QRINAGVRSVDETLNYSKFINGLALAGIEVDRKVLADLAVNEPEAFATIVGQAKAAM 118


>gi|157964750|ref|YP_001499574.1| 50S ribosomal protein L20 [Rickettsia massiliae MTU5]
 gi|166984768|sp|A8F291|RL20_RICM5 RecName: Full=50S ribosomal protein L20
 gi|157844526|gb|ABV85027.1| 50S ribosomal protein L20 [Rickettsia massiliae MTU5]
          Length = 117

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVK G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRVKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR ++L YSQF+  L KAGI ++RKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHELVYSQFMGALKKAGIDINRKVLAELAVNNSDGFVSIVEKAKAHI 117


>gi|109898811|ref|YP_662066.1| 50S ribosomal protein L20 [Pseudoalteromonas atlantica T6c]
 gi|332306907|ref|YP_004434758.1| ribosomal protein L20 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|123064481|sp|Q15SX6|RL20_PSEA6 RecName: Full=50S ribosomal protein L20
 gi|109701092|gb|ABG41012.1| LSU ribosomal protein L20P [Pseudoalteromonas atlantica T6c]
 gi|332174236|gb|AEE23490.1| ribosomal protein L20 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 118

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+   ++F  +V+ ++  L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASVEIDRKILADIAVHDKNAFSALVDAAKGAL 117


>gi|300114471|ref|YP_003761046.1| 50S ribosomal protein L20 [Nitrosococcus watsonii C-113]
 gi|299540408|gb|ADJ28725.1| ribosomal protein L20 [Nitrosococcus watsonii C-113]
          Length = 119

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GRRKN  R A  AV R+ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKVIAQAKGYRGRRKNVYRVANQAVTRASQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ I+GL +A I +DRKVL+DLA+    +F  I E +++ L
Sbjct: 61  WIVRINAAARECGLSYSRLISGLKQAAIEIDRKVLADLAVRDKAAFTTIAEQAKAAL 117


>gi|157803530|ref|YP_001492079.1| 50S ribosomal protein L20 [Rickettsia canadensis str. McKiel]
 gi|166220738|sp|A8EY61|RL20_RICCK RecName: Full=50S ribosomal protein L20
 gi|157784793|gb|ABV73294.1| 50S ribosomal protein L20 [Rickettsia canadensis str. McKiel]
          Length = 117

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A A V+++ QYAYRDRR +KR+FR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIAKVEKALQYAYRDRRNRKRNFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L KAGI +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVRTHGLIYSQFMGTLKKAGIDIDRKVLAELAVNNSDGFASIVEKAKAHI 117


>gi|119505270|ref|ZP_01627345.1| 50S ribosomal protein L20 [marine gamma proteobacterium HTCC2080]
 gi|119458961|gb|EAW40061.1| 50S ribosomal protein L20 [marine gamma proteobacterium HTCC2080]
          Length = 119

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVTARRRHKKILSKAKGYYGARSRVFRVAKQAVTKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L YS+ INGL KA IVLDR+VL+DLA+    +F  +VE +RS L
Sbjct: 61  WITRINAQSRANGLTYSRLINGLKKADIVLDRRVLADLAVHDKAAFAAVVEQARSAL 117


>gi|85711633|ref|ZP_01042690.1| 50S ribosomal protein L20 [Idiomarina baltica OS145]
 gi|85694493|gb|EAQ32434.1| 50S ribosomal protein L20 [Idiomarina baltica OS145]
          Length = 117

 Score =  129 bits (325), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIVRINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVHDQSGFAALVEKAKGAL 117


>gi|312795975|ref|YP_004028897.1| LSU ribosomal protein L20P [Burkholderia rhizoxinica HKI 454]
 gi|312167750|emb|CBW74753.1| LSU ribosomal protein L20P [Burkholderia rhizoxinica HKI 454]
          Length = 119

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 80/110 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++  AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKIINLAKGYRGRRNNVFRIAKQAVMRAGQYAYRDRRNKKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAA R +D+ YS F+NGL KA I LDRKVL+D+A+    +F  IV
Sbjct: 61  WIARINAAARQHDITYSVFMNGLKKASIELDRKVLADMAVFDKAAFAAIV 110


>gi|58038738|ref|YP_190702.1| 50S ribosomal protein L20 [Gluconobacter oxydans 621H]
 gi|81819171|sp|Q5FUA0|RL20_GLUOX RecName: Full=50S ribosomal protein L20
 gi|58001152|gb|AAW60046.1| LSU ribosomal protein L20P [Gluconobacter oxydans 621H]
          Length = 118

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S A+HKKVL+ AKG+ GR     R A   V+++ +YAYRDRR KKRDFR+L
Sbjct: 1   MARVKRGVTSHARHKKVLELAKGYRGRSSTNYRIALERVEKALRYAYRDRRNKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS+FINGL KAGI +DRKVL+ +A     +F +IV+ +++ L
Sbjct: 61  WIQRINAAVREHGLTYSRFINGLDKAGIEIDRKVLAAIAFDDSAAFGEIVKKAQAAL 117


>gi|224372470|ref|YP_002606842.1| 50S ribosomal protein L20 [Nautilia profundicola AmH]
 gi|254800333|sp|B9L884|RL20_NAUPA RecName: Full=50S ribosomal protein L20
 gi|223589353|gb|ACM93089.1| ribosomal protein L20 [Nautilia profundicola AmH]
          Length = 116

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V   +HKK+LK AKGFY  R+   R AK  V+RS  YA+RDR+ KKRDFR LWI
Sbjct: 2   RVKTGTVRRKRHKKILKMAKGFYSGRRKHFRKAKEQVERSLVYAFRDRKQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D++YS+FINGL KA I LDRK+L+DLA+ + + F +IVE +++ L
Sbjct: 62  IRINAACRLNDISYSRFINGLKKANIDLDRKILADLAMNEPEVFAQIVEKAKAAL 116


>gi|206603261|gb|EDZ39741.1| Ribosomal protein L20 [Leptospirillum sp. Group II '5-way CG']
          Length = 118

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 84/111 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G +  A+ KK++  AKGF+G R    R+A+  V++   YAYRDR+VKKR+FRSL
Sbjct: 1   MSRVKGGTIHKARRKKIMDLAKGFWGGRSRLYRSARHTVEKGLTYAYRDRKVKKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+  +NYS+F+ GL K GI LDRK+L+DLA+ Q ++F+++ +
Sbjct: 61  WIQRINAACRMESINYSRFMAGLRKLGIALDRKILADLALNQPETFRELTQ 111


>gi|26989191|ref|NP_744616.1| 50S ribosomal protein L20 [Pseudomonas putida KT2440]
 gi|104781109|ref|YP_607607.1| 50S ribosomal protein L20 [Pseudomonas entomophila L48]
 gi|148548430|ref|YP_001268532.1| 50S ribosomal protein L20 [Pseudomonas putida F1]
 gi|167034474|ref|YP_001669705.1| 50S ribosomal protein L20 [Pseudomonas putida GB-1]
 gi|170721154|ref|YP_001748842.1| 50S ribosomal protein L20 [Pseudomonas putida W619]
 gi|325276809|ref|ZP_08142510.1| 50S ribosomal protein L20 [Pseudomonas sp. TJI-51]
 gi|31563090|sp|Q88K24|RL20_PSEPK RecName: Full=50S ribosomal protein L20
 gi|122403809|sp|Q1IC12|RL20_PSEE4 RecName: Full=50S ribosomal protein L20
 gi|166220729|sp|A5W5D8|RL20_PSEP1 RecName: Full=50S ribosomal protein L20
 gi|189041877|sp|B0KKR5|RL20_PSEPG RecName: Full=50S ribosomal protein L20
 gi|226730439|sp|B1J6U7|RL20_PSEPW RecName: Full=50S ribosomal protein L20
 gi|24984030|gb|AAN68080.1|AE016439_15 ribosomal protein L20 [Pseudomonas putida KT2440]
 gi|95110096|emb|CAK14801.1| 50S ribosomal protein L20, also posttranslational autoregulator
           [Pseudomonas entomophila L48]
 gi|148512488|gb|ABQ79348.1| LSU ribosomal protein L20P [Pseudomonas putida F1]
 gi|166860962|gb|ABY99369.1| ribosomal protein L20 [Pseudomonas putida GB-1]
 gi|169759157|gb|ACA72473.1| ribosomal protein L20 [Pseudomonas putida W619]
 gi|313499443|gb|ADR60809.1| RplT [Pseudomonas putida BIRD-1]
 gi|324098047|gb|EGB96192.1| 50S ribosomal protein L20 [Pseudomonas sp. TJI-51]
          Length = 118

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARTNGLSYSRLIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKAVL 117


>gi|24373855|ref|NP_717898.1| 50S ribosomal protein L20 [Shewanella oneidensis MR-1]
 gi|91793064|ref|YP_562715.1| 50S ribosomal protein L20 [Shewanella denitrificans OS217]
 gi|113970295|ref|YP_734088.1| 50S ribosomal protein L20 [Shewanella sp. MR-4]
 gi|114047514|ref|YP_738064.1| 50S ribosomal protein L20 [Shewanella sp. MR-7]
 gi|117920490|ref|YP_869682.1| 50S ribosomal protein L20 [Shewanella sp. ANA-3]
 gi|120598811|ref|YP_963385.1| 50S ribosomal protein L20 [Shewanella sp. W3-18-1]
 gi|126174368|ref|YP_001050517.1| 50S ribosomal protein L20 [Shewanella baltica OS155]
 gi|146293111|ref|YP_001183535.1| 50S ribosomal protein L20 [Shewanella putrefaciens CN-32]
 gi|153000740|ref|YP_001366421.1| 50S ribosomal protein L20 [Shewanella baltica OS185]
 gi|160875439|ref|YP_001554755.1| 50S ribosomal protein L20 [Shewanella baltica OS195]
 gi|217973359|ref|YP_002358110.1| 50S ribosomal protein L20 [Shewanella baltica OS223]
 gi|304408771|ref|ZP_07390392.1| ribosomal protein L20 [Shewanella baltica OS183]
 gi|307302774|ref|ZP_07582529.1| ribosomal protein L20 [Shewanella baltica BA175]
 gi|31563135|sp|Q8EER6|RL20_SHEON RecName: Full=50S ribosomal protein L20
 gi|122943834|sp|Q0HIT6|RL20_SHESM RecName: Full=50S ribosomal protein L20
 gi|123060977|sp|Q12NI4|RL20_SHEDO RecName: Full=50S ribosomal protein L20
 gi|123131401|sp|Q0HV48|RL20_SHESR RecName: Full=50S ribosomal protein L20
 gi|166220744|sp|A3D4I5|RL20_SHEB5 RecName: Full=50S ribosomal protein L20
 gi|166220745|sp|A6WNG9|RL20_SHEB8 RecName: Full=50S ribosomal protein L20
 gi|166220747|sp|A4Y703|RL20_SHEPC RecName: Full=50S ribosomal protein L20
 gi|166220785|sp|A0KWV7|RL20_SHESA RecName: Full=50S ribosomal protein L20
 gi|166220786|sp|A1RJI6|RL20_SHESW RecName: Full=50S ribosomal protein L20
 gi|189041885|sp|A9L2Q6|RL20_SHEB9 RecName: Full=50S ribosomal protein L20
 gi|254800338|sp|B8EES9|RL20_SHEB2 RecName: Full=50S ribosomal protein L20
 gi|24348262|gb|AAN55342.1|AE015671_9 ribosomal protein L20 [Shewanella oneidensis MR-1]
 gi|91715066|gb|ABE54992.1| LSU ribosomal protein L20P [Shewanella denitrificans OS217]
 gi|113884979|gb|ABI39031.1| LSU ribosomal protein L20P [Shewanella sp. MR-4]
 gi|113888956|gb|ABI43007.1| LSU ribosomal protein L20P [Shewanella sp. MR-7]
 gi|117612822|gb|ABK48276.1| LSU ribosomal protein L20P [Shewanella sp. ANA-3]
 gi|120558904|gb|ABM24831.1| LSU ribosomal protein L20P [Shewanella sp. W3-18-1]
 gi|125997573|gb|ABN61648.1| LSU ribosomal protein L20P [Shewanella baltica OS155]
 gi|145564801|gb|ABP75736.1| LSU ribosomal protein L20P [Shewanella putrefaciens CN-32]
 gi|151365358|gb|ABS08358.1| ribosomal protein L20 [Shewanella baltica OS185]
 gi|160860961|gb|ABX49495.1| ribosomal protein L20 [Shewanella baltica OS195]
 gi|217498494|gb|ACK46687.1| ribosomal protein L20 [Shewanella baltica OS223]
 gi|304352592|gb|EFM16989.1| ribosomal protein L20 [Shewanella baltica OS183]
 gi|306913134|gb|EFN43556.1| ribosomal protein L20 [Shewanella baltica BA175]
 gi|315267629|gb|ADT94482.1| ribosomal protein L20 [Shewanella baltica OS678]
 gi|319426376|gb|ADV54450.1| ribosomal protein L20 [Shewanella putrefaciens 200]
          Length = 118

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKEAL 117


>gi|224417826|ref|ZP_03655832.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
 gi|253827166|ref|ZP_04870051.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
 gi|313141367|ref|ZP_07803560.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
 gi|253510572|gb|EES89231.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
 gi|313130398|gb|EFR48015.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
          Length = 117

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GFY  R    R AK  ++RS  YA+RDR+ KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFYSARHKHFRKAKEQLERSLCYAFRDRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+F+ GL KAGI LDRK+L+D+A+ +  SF KIVE ++  L
Sbjct: 61  WIVRINAACRINAISYSRFMFGLKKAGITLDRKILADIAMNEPQSFTKIVESAKKAL 117


>gi|163801058|ref|ZP_02194958.1| 50S ribosomal protein L20 [Vibrio sp. AND4]
 gi|159175407|gb|EDP60204.1| 50S ribosomal protein L20 [Vibrio sp. AND4]
          Length = 117

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKSAFAVLVEKAKAAL 117


>gi|117618760|ref|YP_856847.1| ribosomal protein L20 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|145298936|ref|YP_001141777.1| 50S ribosomal protein L20 [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|166219602|sp|A0KKP6|RL20_AERHH RecName: Full=50S ribosomal protein L20
 gi|166219603|sp|A4SMA7|RL20_AERS4 RecName: Full=50S ribosomal protein L20
 gi|117560167|gb|ABK37115.1| ribosomal protein L20 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|142851708|gb|ABO90029.1| ribosomal protein L20 [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 118

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K+AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVMKAAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+ INGL KA I +DRK+LSD+A+    +F  +VE +++ L+
Sbjct: 61  WIARINAAARQNGLSYSRLINGLKKASIEIDRKILSDIAVHDKLAFTALVEKAKAALV 118


>gi|303257524|ref|ZP_07343536.1| ribosomal protein L20 [Burkholderiales bacterium 1_1_47]
 gi|331000211|ref|ZP_08323895.1| ribosomal protein L20 [Parasutterella excrementihominis YIT 11859]
 gi|302859494|gb|EFL82573.1| ribosomal protein L20 [Burkholderiales bacterium 1_1_47]
 gi|329572377|gb|EGG54030.1| ribosomal protein L20 [Parasutterella excrementihominis YIT 11859]
          Length = 118

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 76/106 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV   +KGF  RR N  R AK AV R+ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVFALSKGFTLRRNNVYRVAKQAVMRAGQYAYRDRRNKKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINA  R   +NYSQF+NGL KAGI LDRKVLS++AI   + F
Sbjct: 61  WIARINAGARANGMNYSQFMNGLKKAGIELDRKVLSNMAIFDKEGF 106


>gi|260774301|ref|ZP_05883216.1| LSU ribosomal protein L20p [Vibrio metschnikovii CIP 69.14]
 gi|260611262|gb|EEX36466.1| LSU ribosomal protein L20p [Vibrio metschnikovii CIP 69.14]
          Length = 117

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRTKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFSVLVEKAKAAL 117


>gi|119945876|ref|YP_943556.1| ribosomal protein L20 [Psychromonas ingrahamii 37]
 gi|166220731|sp|A1SWU2|RL20_PSYIN RecName: Full=50S ribosomal protein L20
 gi|119864480|gb|ABM03957.1| LSU ribosomal protein L20P [Psychromonas ingrahamii 37]
          Length = 118

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQRKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE+++  L
Sbjct: 61  WITRINAASRISGLSYSRFINGLKKASVEIDRKILADIAVFDKATFAHLVEVAKKAL 117


>gi|170726834|ref|YP_001760860.1| 50S ribosomal protein L20 [Shewanella woodyi ATCC 51908]
 gi|212635270|ref|YP_002311795.1| 50S ribosomal protein L20 [Shewanella piezotolerans WP3]
 gi|226730453|sp|B8CMF1|RL20_SHEPW RecName: Full=50S ribosomal protein L20
 gi|226730454|sp|B1KG58|RL20_SHEWM RecName: Full=50S ribosomal protein L20
 gi|169812181|gb|ACA86765.1| ribosomal protein L20 [Shewanella woodyi ATCC 51908]
 gi|212556754|gb|ACJ29208.1| Ribosomal protein L20 [Shewanella piezotolerans WP3]
          Length = 119

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFTTLVEKAKEAL 117


>gi|90407014|ref|ZP_01215204.1| 50S ribosomal protein L20 [Psychromonas sp. CNPT3]
 gi|90311885|gb|EAS39980.1| 50S ribosomal protein L20 [Psychromonas sp. CNPT3]
          Length = 118

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQRKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE+++  L
Sbjct: 61  WIARINAASRISGLSYSRFINGLKKASVEIDRKILADIAVFDKATFAHLVEVAKKAL 117


>gi|237745473|ref|ZP_04575953.1| large subunit ribosomal protein L20 [Oxalobacter formigenes HOxBLS]
 gi|229376824|gb|EEO26915.1| large subunit ribosomal protein L20 [Oxalobacter formigenes HOxBLS]
          Length = 119

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 81/110 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKK+L  AKG+ GRR +  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MSRVKRGVTARARHKKLLAEAKGYRGRRSSVYRVAKEAVMKAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAA R   ++YS F+NGL KA I LDRKVL+D+A+    +F  IV
Sbjct: 61  WITRINAATRELGMSYSVFMNGLKKAAIELDRKVLADMAVADKPAFAAIV 110


>gi|70729484|ref|YP_259222.1| 50S ribosomal protein L20 [Pseudomonas fluorescens Pf-5]
 gi|7674209|sp|Q9X6E8|RL20_PSEFL RecName: Full=50S ribosomal protein L20
 gi|109893136|sp|Q4KEW1|RL20_PSEF5 RecName: Full=50S ribosomal protein L20
 gi|4972786|gb|AAD34789.1|AF136400_3 ribosomal protein L20 [Pseudomonas fluorescens]
 gi|68343783|gb|AAY91389.1| ribosomal protein L20 [Pseudomonas fluorescens Pf-5]
          Length = 118

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARNNGLSYSRLIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKATL 117


>gi|27365719|ref|NP_761247.1| 50S ribosomal protein L20 [Vibrio vulnificus CMCP6]
 gi|28898056|ref|NP_797661.1| 50S ribosomal protein L20 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37680126|ref|NP_934735.1| 50S ribosomal protein L20 [Vibrio vulnificus YJ016]
 gi|91223966|ref|ZP_01259230.1| 50S ribosomal protein L20 [Vibrio alginolyticus 12G01]
 gi|153835366|ref|ZP_01988033.1| ribosomal protein L20 [Vibrio harveyi HY01]
 gi|153839392|ref|ZP_01992059.1| ribosomal protein L20 [Vibrio parahaemolyticus AQ3810]
 gi|156974367|ref|YP_001445274.1| 50S ribosomal protein L20 [Vibrio harveyi ATCC BAA-1116]
 gi|260366358|ref|ZP_05778797.1| ribosomal protein L20 [Vibrio parahaemolyticus K5030]
 gi|260770316|ref|ZP_05879249.1| LSU ribosomal protein L20p [Vibrio furnissii CIP 102972]
 gi|260878406|ref|ZP_05890761.1| ribosomal protein L20 [Vibrio parahaemolyticus AN-5034]
 gi|260896985|ref|ZP_05905481.1| ribosomal protein L20 [Vibrio parahaemolyticus Peru-466]
 gi|260901784|ref|ZP_05910179.1| ribosomal protein L20 [Vibrio parahaemolyticus AQ4037]
 gi|262394484|ref|YP_003286338.1| 50S ribosomal protein L20p [Vibrio sp. Ex25]
 gi|269963854|ref|ZP_06178166.1| 50S ribosomal protein L20 [Vibrio harveyi 1DA3]
 gi|269966328|ref|ZP_06180415.1| 50S ribosomal protein L20 [Vibrio alginolyticus 40B]
 gi|320156125|ref|YP_004188504.1| 50S ribosomal protein L20p [Vibrio vulnificus MO6-24/O]
 gi|39931706|sp|Q7MK68|RL20_VIBVY RecName: Full=50S ribosomal protein L20
 gi|60393655|sp|P0A481|RL20_VIBPA RecName: Full=50S ribosomal protein L20
 gi|60393656|sp|P0A482|RL20_VIBVU RecName: Full=50S ribosomal protein L20
 gi|166220804|sp|A7N012|RL20_VIBHB RecName: Full=50S ribosomal protein L20
 gi|23452623|gb|AAN33108.1| large subunit ribosomal protein L20 [Vibrio vulnificus]
 gi|27361868|gb|AAO10774.1| ribosomal protein L20 [Vibrio vulnificus CMCP6]
 gi|28806270|dbj|BAC59545.1| large subunit ribosomal protein L20 [Vibrio parahaemolyticus RIMD
           2210633]
 gi|37198872|dbj|BAC94706.1| ribosomal protein L20 [Vibrio vulnificus YJ016]
 gi|91191458|gb|EAS77723.1| 50S ribosomal protein L20 [Vibrio alginolyticus 12G01]
 gi|148868114|gb|EDL67278.1| ribosomal protein L20 [Vibrio harveyi HY01]
 gi|149747087|gb|EDM58075.1| ribosomal protein L20 [Vibrio parahaemolyticus AQ3810]
 gi|156525961|gb|ABU71047.1| hypothetical protein VIBHAR_02082 [Vibrio harveyi ATCC BAA-1116]
 gi|260615654|gb|EEX40840.1| LSU ribosomal protein L20p [Vibrio furnissii CIP 102972]
 gi|262338078|gb|ACY51873.1| LSU ribosomal protein L20p [Vibrio sp. Ex25]
 gi|269829067|gb|EEZ83314.1| 50S ribosomal protein L20 [Vibrio alginolyticus 40B]
 gi|269831341|gb|EEZ85488.1| 50S ribosomal protein L20 [Vibrio harveyi 1DA3]
 gi|308087810|gb|EFO37505.1| ribosomal protein L20 [Vibrio parahaemolyticus Peru-466]
 gi|308091019|gb|EFO40714.1| ribosomal protein L20 [Vibrio parahaemolyticus AN-5034]
 gi|308108153|gb|EFO45693.1| ribosomal protein L20 [Vibrio parahaemolyticus AQ4037]
 gi|308113195|gb|EFO50735.1| ribosomal protein L20 [Vibrio parahaemolyticus K5030]
 gi|315181385|gb|ADT88298.1| 50S ribosomal protein L20 [Vibrio furnissii NCTC 11218]
 gi|319931437|gb|ADV86301.1| LSU ribosomal protein L20p [Vibrio vulnificus MO6-24/O]
 gi|328472986|gb|EGF43834.1| 50S ribosomal protein L20 [Vibrio parahaemolyticus 10329]
          Length = 117

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKAAL 117


>gi|114563196|ref|YP_750709.1| 50S ribosomal protein L20 [Shewanella frigidimarina NCIMB 400]
 gi|122299729|sp|Q082E4|RL20_SHEFN RecName: Full=50S ribosomal protein L20
 gi|114334489|gb|ABI71871.1| LSU ribosomal protein L20P [Shewanella frigidimarina NCIMB 400]
          Length = 119

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKEAL 117


>gi|225848298|ref|YP_002728461.1| 50S ribosomal protein L20 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643070|gb|ACN98120.1| ribosomal protein L20 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 117

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/109 (60%), Positives = 82/109 (75%), Gaps = 1/109 (0%)

Query: 10  SSAKHKK-VLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAA 68
           SS KHKK +LK AKG+YG++  + R AK  V  S  YAYRDRR KKR FRSLWI RINAA
Sbjct: 7   SSKKHKKRILKLAKGYYGQKHRSYRRAKEQVMHSLAYAYRDRRQKKRQFRSLWITRINAA 66

Query: 69  VRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            R+  +NYSQFINGL KAGI LDRK+L+D+A+  + +F K+VE ++S L
Sbjct: 67  ARLNGINYSQFINGLKKAGIELDRKILADMAVNDMQAFAKLVETAKSAL 115


>gi|5825616|gb|AAD53322.1|AF179591_4 ribosomal protein L20 [Vibrio cholerae]
 gi|3095164|gb|AAC38423.1| ribosomal protein L20 [Vibrio cholerae]
          Length = 117

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARPRVYRVAFQAVIKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKGAL 117


>gi|307564473|ref|ZP_07627014.1| 50S ribosomal protein L20 [Prevotella amnii CRIS 21A-A]
 gi|307346833|gb|EFN92129.1| 50S ribosomal protein L20 [Prevotella amnii CRIS 21A-A]
          Length = 114

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  K+LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTKILKKTKGYYGARKNVWTVAKNTYEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+YD++YSQ +  LHK+GI ++RKVL+DLAI   D+FK IV+
Sbjct: 61  WIQRINAAARLYDMSYSQLMGALHKSGIEINRKVLADLAINNQDAFKAIVD 111


>gi|218288920|ref|ZP_03493171.1| ribosomal protein L20 [Alicyclobacillus acidocaldarius LAA1]
 gi|258512134|ref|YP_003185568.1| 50S ribosomal protein L20 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|218241009|gb|EED08186.1| ribosomal protein L20 [Alicyclobacillus acidocaldarius LAA1]
 gi|257478860|gb|ACV59179.1| ribosomal protein L20 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 121

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 89/117 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV+  +HKK+LK A+G++G +    R AK  V +S  YAYRDR+ +KRDFR L
Sbjct: 1   MARVKGGVVTRRRHKKILKLARGYFGSKHTLYRTAKQQVMKSLMYAYRDRKQRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L+YS+F++GL  AG+ ++RK+L+DLA+T  ++F ++V ++R RL
Sbjct: 61  WIQRINAAVRPHGLSYSRFMHGLKLAGVEVNRKMLADLAVTDKEAFSQLVTVARERL 117


>gi|119472426|ref|ZP_01614544.1| 50S ribosomal protein L20 [Alteromonadales bacterium TW-7]
 gi|332534268|ref|ZP_08410112.1| 50S ribosomal protein L20 [Pseudoalteromonas haloplanktis ANT/505]
 gi|119444948|gb|EAW26246.1| 50S ribosomal protein L20 [Alteromonadales bacterium TW-7]
 gi|332036264|gb|EGI72736.1| 50S ribosomal protein L20 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 119

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL K  + +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKTSVEIDRKILADIAVYDQVAFAALVEKAKEGL 117


>gi|329895716|ref|ZP_08271120.1| LSU ribosomal protein L20p [gamma proteobacterium IMCC3088]
 gi|328922192|gb|EGG29547.1| LSU ribosomal protein L20p [gamma proteobacterium IMCC3088]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHRRHKKILKQAKGYYGARSRIFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   + YSQ INGL KA I LDR+VL+DLA+     F  +VE ++S L
Sbjct: 61  WITRINAQSRANGVTYSQLINGLKKANIGLDRRVLADLAVHDKAGFAAVVEQAKSAL 117


>gi|58698330|ref|ZP_00373246.1| ribosomal protein L20 [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|99036098|ref|ZP_01315131.1| hypothetical protein Wendoof_01000021 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|225629870|ref|ZP_03787776.1| ribosomal protein L20 [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225630568|ref|YP_002727359.1| ribosomal protein L20 [Wolbachia sp. wRi]
 gi|254800352|sp|C0R3S6|RL20_WOLWR RecName: Full=50S ribosomal protein L20
 gi|58535154|gb|EAL59237.1| ribosomal protein L20 [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225591278|gb|EEH12412.1| ribosomal protein L20 [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225592549|gb|ACN95568.1| ribosomal protein L20 [Wolbachia sp. wRi]
          Length = 121

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ GR K+  R A   V+++ QYAYRDRR +KRDFRSL
Sbjct: 1   MARVKRGVTTHARHKKILKLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRTRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L Y +F++GL  AGI L+RK+L+++A+   D F K+VE    +L
Sbjct: 61  WIIRINAAAREHGLTYGRFMHGLTLAGIDLNRKILAEMAVNYKDDFAKLVETVSGKL 117


>gi|48474627|sp|Q9ALJ1|RL20_VIBME RecName: Full=50S ribosomal protein L20
 gi|12831415|gb|AAK02073.1| large subunit ribosomal protein L20 [Vibrio metschnikovii]
          Length = 117

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKILKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRTKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFSVLVEKAKAAL 117


>gi|242309946|ref|ZP_04809101.1| 50S ribosomal protein L20 [Helicobacter pullorum MIT 98-5489]
 gi|239523243|gb|EEQ63109.1| 50S ribosomal protein L20 [Helicobacter pullorum MIT 98-5489]
          Length = 117

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKK+LK A+GFY  R    R AK  ++RS  YA+RDR+ KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKILKLARGFYSARHKHFRKAKEQLERSLCYAFRDRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+F+ GL KAGI LDRK+L+D+A+ +  SF KIVE ++  L
Sbjct: 61  WIVRINAACRINAISYSRFMFGLKKAGIALDRKILADIAMNEPQSFAKIVESAKKAL 117


>gi|42520700|ref|NP_966615.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|60390506|sp|Q73GR7|RL20_WOLPM RecName: Full=50S ribosomal protein L20
 gi|42410440|gb|AAS14549.1| ribosomal protein L20 [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 121

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ GR K+  R A   V+++ QYAYRDRR +KRDFRSL
Sbjct: 1   MARVKRGVTTHARHKKILKLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRTRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L Y +F++GL  AGI L+RK+L+++A+   D F K+VE    +L
Sbjct: 61  WIIRINAAAREHGLTYGRFMHGLTLAGIDLNRKILAEMAVNYKDDFAKLVETVSGKL 117


>gi|289449572|ref|YP_003475579.1| 50S ribosomal protein L20 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184119|gb|ADC90544.1| ribosomal protein L20 [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG++G +    + A   V +S  YAYRDR+ KKRDFR L
Sbjct: 1   MARVKRGVAAHARHKKILKMAKGYFGHKSKLFKVANQQVMKSGNYAYRDRKAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ +NG+HKA I LDRK+L++LA++   +F  + E ++  L
Sbjct: 61  WIARINAAARMNGLSYSRLMNGVHKAEIALDRKMLAELAVSDAKAFTAVCEAAKKAL 117


>gi|307069525|ref|YP_003878002.1| 50S ribosomal subunit protein L20 [Candidatus Zinderia insecticola
           CARI]
 gi|306482785|gb|ADM89656.1| 50S ribosomal subunit protein L20 [Candidatus Zinderia insecticola
           CARI]
          Length = 113

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 83/111 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG++S  KHKK+LK  KGF GRRKN  R AK A+ +S QY+YRDR+ KKR FR++
Sbjct: 1   MTRVKRGIISKYKHKKILKFTKGFRGRRKNVFRIAKQALFKSWQYSYRDRKNKKRLFRNI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI+RIN  +  +++ Y+ FIN + K  I+L+RK+LSDLAI     FKK+++
Sbjct: 61  WIKRINIILNKFNIKYNIFINKMKKKNIILNRKILSDLAIKNTHDFKKLIK 111


>gi|34557221|ref|NP_907036.1| 50S ribosomal protein L20 [Wolinella succinogenes DSM 1740]
 gi|39931691|sp|Q7M9L7|RL20_WOLSU RecName: Full=50S ribosomal protein L20
 gi|34482937|emb|CAE09936.1| RIBOSOMAL PROTEIN L20 [Wolinella succinogenes]
          Length = 117

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKRDFRSL
Sbjct: 1   MPRVKTGTVRRQRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ +++YS+F++GL  A I LDRK+L+D+A+ +  +F KIVE ++  L
Sbjct: 61  WITRINAACRINEISYSRFMHGLKLANIELDRKILADMAMNEPANFAKIVEAAKKAL 117


>gi|77164652|ref|YP_343177.1| 50S ribosomal protein L20 [Nitrosococcus oceani ATCC 19707]
 gi|254434859|ref|ZP_05048367.1| ribosomal protein L20 [Nitrosococcus oceani AFC27]
 gi|109893128|sp|Q3JBZ9|RL20_NITOC RecName: Full=50S ribosomal protein L20
 gi|76882966|gb|ABA57647.1| LSU ribosomal protein L20P [Nitrosococcus oceani ATCC 19707]
 gi|207091192|gb|EDZ68463.1| ribosomal protein L20 [Nitrosococcus oceani AFC27]
          Length = 119

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 80/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GRRKN  R A  A+ R+ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKVIAQAKGYRGRRKNVYRVANQAITRASQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R   L+YS+ I+GL +A I +DRKVL+DLA+    +F  I E
Sbjct: 61  WIVRINAAARECGLSYSRLISGLKRAAIEIDRKVLADLAVRDKAAFTTIAE 111


>gi|262091709|gb|ACY25299.1| LSU ribosomal protein L20P [uncultured actinobacterium]
          Length = 118

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  KHK +L+ AKG+YG R  T R+A   V  S QYA+RDRR KK +FRSL
Sbjct: 1   MARVKRAVHARKKHKAILEKAKGYYGDRSRTFRSANEQVLHSGQYAFRDRRAKKGEFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINA  R  D +YS+ I GL KAG+ +DRK+L+DLA+    +F KIVE ++  L+
Sbjct: 61  WIQRINAGCRQNDFSYSRLIAGLTKAGVTVDRKILADLAVHDAAAFAKIVETAKGALV 118


>gi|134095003|ref|YP_001100078.1| 50S ribosomal protein L20 [Herminiimonas arsenicoxydans]
 gi|166219652|sp|A4G616|RL20_HERAR RecName: Full=50S ribosomal protein L20
 gi|133738906|emb|CAL61953.1| 50S ribosomal subunit protein L20 [Herminiimonas arsenicoxydans]
          Length = 119

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRR    R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLDQAKGYRGRRSKVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R + L YS F+NGL +A I LDRKVL+D+A+    +F  IV 
Sbjct: 61  WITRINAASREHGLTYSVFMNGLKRASIELDRKVLADMAVMDKPAFAAIVN 111


>gi|237731272|ref|ZP_04561753.1| 50S ribosomal protein L20 [Citrobacter sp. 30_2]
 gi|283833388|ref|ZP_06353129.1| ribosomal protein L20 [Citrobacter youngae ATCC 29220]
 gi|226906811|gb|EEH92729.1| 50S ribosomal protein L20 [Citrobacter sp. 30_2]
 gi|291071038|gb|EFE09147.1| ribosomal protein L20 [Citrobacter youngae ATCC 29220]
          Length = 118

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAAL 117


>gi|145589017|ref|YP_001155614.1| ribosomal protein L20 [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
 gi|189041875|sp|A4SX36|RL20_POLSQ RecName: Full=50S ribosomal protein L20
 gi|145047423|gb|ABP34050.1| LSU ribosomal protein L20P [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
          Length = 121

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 76/98 (77%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVKRGV + A+HKK+  +A G+ GRRKN  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1  MPRVKRGVTARARHKKITDAATGYRGRRKNVFRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDL 98
          WI RINAAVR +D+ YS F+NG+ KA I LDRKVLSD+
Sbjct: 61 WIARINAAVRQHDMTYSVFMNGMKKAAIELDRKVLSDM 98


>gi|157962081|ref|YP_001502115.1| 50S ribosomal protein L20 [Shewanella pealeana ATCC 700345]
 gi|167623949|ref|YP_001674243.1| 50S ribosomal protein L20 [Shewanella halifaxensis HAW-EB4]
 gi|189041886|sp|B0TT23|RL20_SHEHH RecName: Full=50S ribosomal protein L20
 gi|189041887|sp|A8H4U3|RL20_SHEPA RecName: Full=50S ribosomal protein L20
 gi|157847081|gb|ABV87580.1| ribosomal protein L20 [Shewanella pealeana ATCC 700345]
 gi|167353971|gb|ABZ76584.1| ribosomal protein L20 [Shewanella halifaxensis HAW-EB4]
          Length = 119

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKDAL 117


>gi|258404184|ref|YP_003196926.1| 50S ribosomal protein L20 [Desulfohalobium retbaense DSM 5692]
 gi|257796411|gb|ACV67348.1| ribosomal protein L20 [Desulfohalobium retbaense DSM 5692]
          Length = 117

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 84/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRGV +  +HKK LK AKGF G R    R A+ AV++S  YAYRDRR KKRDFR LWI
Sbjct: 2   RVKRGVTARRRHKKYLKMAKGFRGSRSRLYRTAREAVEKSLCYAYRDRRQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           QRINAA R   ++YS+F++GL K+G+ L+RKVL+DLA+     F K+ EL++ ++
Sbjct: 62  QRINAAARENGMSYSRFMSGLKKSGVELNRKVLADLAVKDKHGFSKVAELAKEKV 116


>gi|319955800|ref|YP_004167063.1| LSU ribosomal protein l20p [Nitratifractor salsuginis DSM 16511]
 gi|319418204|gb|ADV45314.1| LSU ribosomal protein L20P [Nitratifractor salsuginis DSM 16511]
          Length = 118

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 83/115 (72%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G+    +HKK+LK A+GFY  R+   R AK  ++RS  YAYRDRR KKRDFR LWI
Sbjct: 2   RVKNGMTRHRRHKKLLKQARGFYSGRRKHFRKAKEQLERSLVYAYRDRRQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D+NYS+F++GL  AGI LDRKVL+D+A+    +F K+ E S++ L
Sbjct: 62  IRINAAARLNDMNYSRFMHGLKLAGIELDRKVLADMAMNNPAAFSKVAEASKAAL 116


>gi|254491408|ref|ZP_05104587.1| ribosomal protein L20 [Methylophaga thiooxidans DMS010]
 gi|224462886|gb|EEF79156.1| ribosomal protein L20 [Methylophaga thiooxydans DMS010]
          Length = 119

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 78/100 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+YGRRKN  R A  AV ++ QYAYRDRR KKR+FR+L
Sbjct: 1   MPRVKRGVTAHARHKKVLDQAKGYYGRRKNVYRVAVQAVTKAGQYAYRDRRQKKRNFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           WI RINAA R   L+YS+ I+GL KA I +DRKVL+D+A+
Sbjct: 61  WIARINAAARECGLSYSRLIDGLKKASIEIDRKVLADIAV 100


>gi|152991638|ref|YP_001357359.1| 50S ribosomal protein L20 [Sulfurovum sp. NBC37-1]
 gi|215274804|sp|A6Q693|RL20_SULNB RecName: Full=50S ribosomal protein L20
 gi|151423499|dbj|BAF71002.1| 50S ribosomal protein L20 [Sulfurovum sp. NBC37-1]
          Length = 118

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 84/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HK++LK A+GFY  R+   R AK  ++RS  YAYRDRR KKRDFR LWI
Sbjct: 2   RVKTGVVRHRRHKRLLKQARGFYSGRRKHFRKAKEQLERSLVYAYRDRRQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ DLNYS+F++GL  A I LDRK+L+D+A+   +SF KI + S++ L
Sbjct: 62  VRINAAARLNDLNYSRFMHGLKLANIELDRKILADMAMNSPESFTKIADASKAAL 116


>gi|15601055|ref|NP_232686.1| 50S ribosomal protein L20 [Vibrio cholerae O1 biovar eltor str.
           N16961]
 gi|121591863|ref|ZP_01679034.1| ribosomal protein L20 [Vibrio cholerae 2740-80]
 gi|121730163|ref|ZP_01682557.1| ribosomal protein L20 [Vibrio cholerae V52]
 gi|147672501|ref|YP_001215775.1| 50S ribosomal protein L20 [Vibrio cholerae O395]
 gi|153803258|ref|ZP_01957844.1| ribosomal protein L20 [Vibrio cholerae MZO-3]
 gi|153817494|ref|ZP_01970161.1| ribosomal protein L20 [Vibrio cholerae NCTC 8457]
 gi|153824065|ref|ZP_01976732.1| ribosomal protein L20 [Vibrio cholerae B33]
 gi|153827715|ref|ZP_01980382.1| ribosomal protein L20 [Vibrio cholerae MZO-2]
 gi|153829056|ref|ZP_01981723.1| ribosomal protein L20 [Vibrio cholerae 623-39]
 gi|227811913|ref|YP_002811923.1| ribosomal protein L20 [Vibrio cholerae M66-2]
 gi|229506556|ref|ZP_04396065.1| LSU ribosomal protein L20p [Vibrio cholerae BX 330286]
 gi|229510648|ref|ZP_04400128.1| LSU ribosomal protein L20p [Vibrio cholerae B33]
 gi|229514762|ref|ZP_04404223.1| LSU ribosomal protein L20p [Vibrio cholerae TMA 21]
 gi|229517221|ref|ZP_04406666.1| LSU ribosomal protein L20p [Vibrio cholerae RC9]
 gi|229522963|ref|ZP_04412377.1| LSU ribosomal protein L20p [Vibrio cholerae TM 11079-80]
 gi|229526099|ref|ZP_04415503.1| LSU ribosomal protein L20p [Vibrio cholerae bv. albensis VL426]
 gi|229527750|ref|ZP_04417141.1| LSU ribosomal protein L20p [Vibrio cholerae 12129(1)]
 gi|229606035|ref|YP_002876739.1| 50S ribosomal protein L20 [Vibrio cholerae MJ-1236]
 gi|254225617|ref|ZP_04919225.1| ribosomal protein L20 [Vibrio cholerae V51]
 gi|254284962|ref|ZP_04959928.1| ribosomal protein L20 [Vibrio cholerae AM-19226]
 gi|254850511|ref|ZP_05239861.1| 50S ribosomal protein L20 [Vibrio cholerae MO10]
 gi|255745911|ref|ZP_05419858.1| LSU ribosomal protein L20p [Vibrio cholera CIRS 101]
 gi|258623267|ref|ZP_05718274.1| 50S ribosomal protein L20 [Vibrio mimicus VM573]
 gi|258625492|ref|ZP_05720384.1| 50S ribosomal protein L20 [Vibrio mimicus VM603]
 gi|262163532|ref|ZP_06031278.1| LSU ribosomal protein L20p [Vibrio cholerae INDRE 91/1]
 gi|262164338|ref|ZP_06032076.1| LSU ribosomal protein L20p [Vibrio mimicus VM223]
 gi|262168209|ref|ZP_06035907.1| LSU ribosomal protein L20p [Vibrio cholerae RC27]
 gi|262173545|ref|ZP_06041222.1| LSU ribosomal protein L20p [Vibrio mimicus MB-451]
 gi|262403449|ref|ZP_06080007.1| LSU ribosomal protein L20p [Vibrio sp. RC586]
 gi|297579607|ref|ZP_06941534.1| ribosomal protein L20 [Vibrio cholerae RC385]
 gi|60393653|sp|P0A479|RL20_VIBCH RecName: Full=50S ribosomal protein L20
 gi|60393654|sp|P0A480|RL20_VIBMI RecName: Full=50S ribosomal protein L20
 gi|172047340|sp|A5EZ15|RL20_VIBC3 RecName: Full=50S ribosomal protein L20
 gi|254800350|sp|C3LUW1|RL20_VIBCM RecName: Full=50S ribosomal protein L20
 gi|9657687|gb|AAF96198.1| ribosomal protein L20 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|11345547|gb|AAG34727.1| ribosomal protein L20 [Vibrio mimicus]
 gi|121546270|gb|EAX56566.1| ribosomal protein L20 [Vibrio cholerae 2740-80]
 gi|121628082|gb|EAX60622.1| ribosomal protein L20 [Vibrio cholerae V52]
 gi|124121198|gb|EAY39941.1| ribosomal protein L20 [Vibrio cholerae MZO-3]
 gi|125621832|gb|EAZ50158.1| ribosomal protein L20 [Vibrio cholerae V51]
 gi|126511919|gb|EAZ74513.1| ribosomal protein L20 [Vibrio cholerae NCTC 8457]
 gi|126518415|gb|EAZ75638.1| ribosomal protein L20 [Vibrio cholerae B33]
 gi|146314884|gb|ABQ19424.1| ribosomal protein L20 [Vibrio cholerae O395]
 gi|148875485|gb|EDL73620.1| ribosomal protein L20 [Vibrio cholerae 623-39]
 gi|149737810|gb|EDM52715.1| ribosomal protein L20 [Vibrio cholerae MZO-2]
 gi|150424965|gb|EDN16742.1| ribosomal protein L20 [Vibrio cholerae AM-19226]
 gi|227011055|gb|ACP07266.1| ribosomal protein L20 [Vibrio cholerae M66-2]
 gi|227014958|gb|ACP11167.1| ribosomal protein L20 [Vibrio cholerae O395]
 gi|229334112|gb|EEN99597.1| LSU ribosomal protein L20p [Vibrio cholerae 12129(1)]
 gi|229336257|gb|EEO01275.1| LSU ribosomal protein L20p [Vibrio cholerae bv. albensis VL426]
 gi|229340180|gb|EEO05188.1| LSU ribosomal protein L20p [Vibrio cholerae TM 11079-80]
 gi|229345257|gb|EEO10230.1| LSU ribosomal protein L20p [Vibrio cholerae RC9]
 gi|229348742|gb|EEO13700.1| LSU ribosomal protein L20p [Vibrio cholerae TMA 21]
 gi|229353093|gb|EEO18033.1| LSU ribosomal protein L20p [Vibrio cholerae B33]
 gi|229356907|gb|EEO21825.1| LSU ribosomal protein L20p [Vibrio cholerae BX 330286]
 gi|229372521|gb|ACQ62943.1| LSU ribosomal protein L20p [Vibrio cholerae MJ-1236]
 gi|254846216|gb|EET24630.1| 50S ribosomal protein L20 [Vibrio cholerae MO10]
 gi|255735665|gb|EET91063.1| LSU ribosomal protein L20p [Vibrio cholera CIRS 101]
 gi|258582198|gb|EEW07055.1| 50S ribosomal protein L20 [Vibrio mimicus VM603]
 gi|258584453|gb|EEW09195.1| 50S ribosomal protein L20 [Vibrio mimicus VM573]
 gi|261890903|gb|EEY36890.1| LSU ribosomal protein L20p [Vibrio mimicus MB-451]
 gi|262023452|gb|EEY42155.1| LSU ribosomal protein L20p [Vibrio cholerae RC27]
 gi|262026718|gb|EEY45385.1| LSU ribosomal protein L20p [Vibrio mimicus VM223]
 gi|262028099|gb|EEY46758.1| LSU ribosomal protein L20p [Vibrio cholerae INDRE 91/1]
 gi|262349953|gb|EEY99088.1| LSU ribosomal protein L20p [Vibrio sp. RC586]
 gi|297535253|gb|EFH74087.1| ribosomal protein L20 [Vibrio cholerae RC385]
 gi|327485488|gb|AEA79894.1| LSU ribosomal protein L20p [Vibrio cholerae LMA3894-4]
 gi|327485493|gb|AEA79899.1| LSU ribosomal protein L20p [Vibrio cholerae LMA3894-4]
          Length = 117

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKGAL 117


>gi|152980705|ref|YP_001353180.1| 50S ribosomal protein L20 [Janthinobacterium sp. Marseille]
 gi|166219653|sp|A6SY33|RL20_JANMA RecName: Full=50S ribosomal protein L20
 gi|151280782|gb|ABR89192.1| large subunit ribosomal protein L20 [Janthinobacterium sp.
           Marseille]
          Length = 119

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRR    R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLDQAKGYRGRRSKVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R + L YS F+NGL +A I LDRKVL+D+A+    +F  IV 
Sbjct: 61  WITRINAASREHGLTYSVFMNGLKRASIELDRKVLADMAVMDKPAFAAIVN 111


>gi|262275833|ref|ZP_06053642.1| LSU ribosomal protein L20p [Grimontia hollisae CIP 101886]
 gi|262219641|gb|EEY70957.1| LSU ribosomal protein L20p [Grimontia hollisae CIP 101886]
          Length = 117

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASIEIDRKILADIAVFDKVAFSALVEKAKAAL 117


>gi|269102903|ref|ZP_06155600.1| LSU ribosomal protein L20p [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268162801|gb|EEZ41297.1| LSU ribosomal protein L20p [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 117

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASIEIDRKILADIAVFDKATFTVLVEKAKAAL 117


>gi|15597937|ref|NP_251431.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa PAO1]
 gi|116050731|ref|YP_790448.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152989236|ref|YP_001347873.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa PA7]
 gi|218891079|ref|YP_002439945.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa LESB58]
 gi|254235719|ref|ZP_04929042.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa C3719]
 gi|254241194|ref|ZP_04934516.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa 2192]
 gi|296388796|ref|ZP_06878271.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa PAb1]
 gi|14195127|sp|Q9I0A2|RL20_PSEAE RecName: Full=50S ribosomal protein L20
 gi|122259856|sp|Q02NN8|RL20_PSEAB RecName: Full=50S ribosomal protein L20
 gi|166219681|sp|A6V488|RL20_PSEA7 RecName: Full=50S ribosomal protein L20
 gi|226730438|sp|B7V309|RL20_PSEA8 RecName: Full=50S ribosomal protein L20
 gi|9948819|gb|AAG06129.1|AE004702_6 50S ribosomal protein L20 [Pseudomonas aeruginosa PAO1]
 gi|115585952|gb|ABJ11967.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126167650|gb|EAZ53161.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa C3719]
 gi|126194572|gb|EAZ58635.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa 2192]
 gi|150964394|gb|ABR86419.1| ribosomal protein L20 [Pseudomonas aeruginosa PA7]
 gi|218771304|emb|CAW27069.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa LESB58]
          Length = 118

 Score =  128 bits (321), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARQNGLSYSRLIAGLKKAAIEIDRKVLADLAVNEKAAFTAIVEKAKASL 117


>gi|257092828|ref|YP_003166469.1| 50S ribosomal protein L20 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257045352|gb|ACV34540.1| ribosomal protein L20 [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 119

 Score =  127 bits (320), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRR N  R AK AV ++ QYAYRDRR +KR FRSL
Sbjct: 1   MPRVKRGVTAHARHKKILALAKGYRGRRNNVYRVAKQAVMKAGQYAYRDRRQRKRQFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   + YS F+NGL KA + +DRKVL+DLA+    +F  + + ++++L
Sbjct: 61  WIARINAAARELGMKYSTFMNGLKKAQVEVDRKVLADLAVFDKPAFAVLAQQAKAQL 117


>gi|124516420|gb|EAY57928.1| ribosomal protein L20 [Leptospirillum rubarum]
          Length = 118

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 84/111 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G +  ++ KK++  AKGF+G R    R+A+  V++   YAYRDR+VKKR+FRSL
Sbjct: 1   MSRVKGGTIHKSRRKKIMDLAKGFWGGRSRLYRSARHTVEKGLTYAYRDRKVKKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+  +NYS+F+ GL K GI LDRK+L+DLA+ Q ++F+++ +
Sbjct: 61  WIQRINAACRMESINYSRFMAGLKKLGISLDRKILADLALNQPETFRELTQ 111


>gi|49074300|gb|AAT49394.1| PA2741 [synthetic construct]
          Length = 119

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARQNGLSYSRLIAGLKKAAIEIDRKVLADLAVNEKAAFTAIVEKAKASL 117


>gi|332525935|ref|ZP_08402076.1| 50S ribosomal protein L20 [Rubrivivax benzoatilyticus JA2]
 gi|332109486|gb|EGJ10409.1| 50S ribosomal protein L20 [Rubrivivax benzoatilyticus JA2]
          Length = 118

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKGF GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTAHARHKKILALAKGFRGRRKNVFRIAKQAVMKAGQYAYRDRRTRKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   + YS+F+ GL KA I +DRKVL+DLA+    +F  IV   +++L
Sbjct: 61  WIARINAASRELGITYSKFMAGLKKAQIDIDRKVLADLAVKDPAAFGAIVAKVKAQL 117


>gi|311279399|ref|YP_003941630.1| ribosomal protein L20 [Enterobacter cloacae SCF1]
 gi|308748594|gb|ADO48346.1| ribosomal protein L20 [Enterobacter cloacae SCF1]
          Length = 118

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAAL 117


>gi|258542127|ref|YP_003187560.1| 50S ribosomal protein L20 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114122|ref|ZP_08242884.1| 50S ribosomal protein L20 [Acetobacter pomorum DM001]
 gi|256633205|dbj|BAH99180.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636264|dbj|BAI02233.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639317|dbj|BAI05279.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642373|dbj|BAI08328.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645428|dbj|BAI11376.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648481|dbj|BAI14422.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651534|dbj|BAI17468.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654525|dbj|BAI20452.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696198|gb|EGE47877.1| 50S ribosomal protein L20 [Acetobacter pomorum DM001]
          Length = 119

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL+ AKG+ GR     R A   V+++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTTLARHKKVLELAKGYRGRSSTNYRIALERVEKALRYAYRDRRNKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS+FINGL KAGI +DRKVL+ +A     +F +IV+ +++ L
Sbjct: 61  WIQRINAAVREHGLTYSRFINGLDKAGIEIDRKVLAAIAFDDAATFAEIVKKAQAAL 117


>gi|84393196|ref|ZP_00991959.1| 50S ribosomal protein L20 [Vibrio splendidus 12B01]
 gi|86147531|ref|ZP_01065842.1| 50S ribosomal protein L20 [Vibrio sp. MED222]
 gi|148982345|ref|ZP_01816722.1| 50S ribosomal protein L20 [Vibrionales bacterium SWAT-3]
 gi|218709224|ref|YP_002416845.1| 50S ribosomal protein L20 [Vibrio splendidus LGP32]
 gi|254800351|sp|B7VN20|RL20_VIBSL RecName: Full=50S ribosomal protein L20
 gi|84376162|gb|EAP93047.1| 50S ribosomal protein L20 [Vibrio splendidus 12B01]
 gi|85834699|gb|EAQ52846.1| 50S ribosomal protein L20 [Vibrio sp. MED222]
 gi|145960525|gb|EDK25888.1| 50S ribosomal protein L20 [Vibrionales bacterium SWAT-3]
 gi|218322243|emb|CAV18362.1| 50S ribosomal subunit protein L20 [Vibrio splendidus LGP32]
          Length = 117

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKASL 117


>gi|312884191|ref|ZP_07743903.1| 50S ribosomal protein L20 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368239|gb|EFP95779.1| 50S ribosomal protein L20 [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 117

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKTAL 117


>gi|152996607|ref|YP_001341442.1| 50S ribosomal protein L20 [Marinomonas sp. MWYL1]
 gi|189041869|sp|A6VYH8|RL20_MARMS RecName: Full=50S ribosomal protein L20
 gi|150837531|gb|ABR71507.1| ribosomal protein L20 [Marinomonas sp. MWYL1]
          Length = 118

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 81/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QY YRDRR +KR FR+L
Sbjct: 1   MPRVKRGVQARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYQYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+  L+YS+FI GL +A I +DRKVL+DLA+ + + F  IVE
Sbjct: 61  WIARINAAARINGLSYSRFIAGLKQAAIEIDRKVLADLAVYEKEVFAAIVE 111


>gi|59711825|ref|YP_204601.1| 50S ribosomal protein L20 [Vibrio fischeri ES114]
 gi|197334380|ref|YP_002156019.1| ribosomal protein L20 [Vibrio fischeri MJ11]
 gi|81310956|sp|Q5E5I3|RL20_VIBF1 RecName: Full=50S ribosomal protein L20
 gi|226730472|sp|B5FDV4|RL20_VIBFM RecName: Full=50S ribosomal protein L20
 gi|59479926|gb|AAW85713.1| 50S ribosomal subunit protein L20 [Vibrio fischeri ES114]
 gi|197315870|gb|ACH65317.1| ribosomal protein L20 [Vibrio fischeri MJ11]
          Length = 117

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R  +++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNEMSYSRFINGLKKASIEIDRKILADIAVFDKVAFAALVEKAKAAL 117


>gi|262091754|gb|ACY25343.1| LSU ribosomal protein L20P [uncultured actinobacterium]
          Length = 118

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  KHK +L+ AKG+YG R  T R+A   V  S QYA+RDRR +K +FRSL
Sbjct: 1   MARVKRAVHARKKHKAILEKAKGYYGDRSRTFRSANEQVLHSGQYAFRDRRAEKGEFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINA  R  D +YS+ I+GL+KAG+ +DRK+++DLA+    +F K+VE ++  L+
Sbjct: 61  WIQRINAGCRQNDFSYSRLIDGLNKAGVTVDRKIMADLAVHDPAAFTKLVETAKGALV 118


>gi|289523101|ref|ZP_06439955.1| ribosomal protein L20 [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503644|gb|EFD24808.1| ribosomal protein L20 [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 119

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  K  K+ K  KG+YGRRKN  + A+ A+ RS  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGTATKNKRAKLFKLTKGYYGRRKNVFKRAREAMLRSLSYAYRDRRNRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA   VY +NYS FI+GL K+GI ++RK+L++LA++ +++F ++VE ++  L+
Sbjct: 61  WIMRINAGAHVYGMNYSTFISGLRKSGIEINRKMLAELAVSDIEAFGQLVEKAKEALV 118


>gi|294678670|ref|YP_003579285.1| 50S ribosomal protein L20 [Rhodobacter capsulatus SB 1003]
 gi|294477490|gb|ADE86878.1| 50S ribosomal protein L20 [Rhodobacter capsulatus SB 1003]
          Length = 121

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 2/108 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A HKKVLK AKG+Y  R    R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKSGKVTHASHKKVLKKAKGYYSARSRNFRTATQAVDKAMQYATRDRQQRKRNFRAL 60

Query: 61  WIQRINAAVRVYDLN--YSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAAVR  DL   YS+FINGL  AGI +DRKVL+DLA+ + ++F
Sbjct: 61  WIQRINAAVRAIDLEMTYSRFINGLALAGIEVDRKVLADLAVHEPEAF 108


>gi|126667903|ref|ZP_01738868.1| 50S ribosomal protein L20 [Marinobacter sp. ELB17]
 gi|126627563|gb|EAZ98195.1| 50S ribosomal protein L20 [Marinobacter sp. ELB17]
          Length = 117

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKILKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRRNRKRAFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA + +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARANGLSYSRLIAGLKKANVEIDRKVLADLAMNEQQTFAAVVEKAKASL 117


>gi|149191777|ref|ZP_01870015.1| 50S ribosomal protein L20 [Vibrio shilonii AK1]
 gi|260777878|ref|ZP_05886771.1| LSU ribosomal protein L20p [Vibrio coralliilyticus ATCC BAA-450]
 gi|261250896|ref|ZP_05943470.1| LSU ribosomal protein L20p [Vibrio orientalis CIP 102891]
 gi|323493464|ref|ZP_08098586.1| 50S ribosomal protein L20 [Vibrio brasiliensis LMG 20546]
 gi|323499332|ref|ZP_08104309.1| 50S ribosomal protein L20 [Vibrio sinaloensis DSM 21326]
 gi|148834357|gb|EDL51356.1| 50S ribosomal protein L20 [Vibrio shilonii AK1]
 gi|260605891|gb|EEX32176.1| LSU ribosomal protein L20p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260937769|gb|EEX93757.1| LSU ribosomal protein L20p [Vibrio orientalis CIP 102891]
 gi|323312287|gb|EGA65429.1| 50S ribosomal protein L20 [Vibrio brasiliensis LMG 20546]
 gi|323315720|gb|EGA68754.1| 50S ribosomal protein L20 [Vibrio sinaloensis DSM 21326]
          Length = 117

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKAAL 117


>gi|261212789|ref|ZP_05927073.1| LSU ribosomal protein L20p [Vibrio sp. RC341]
 gi|260837854|gb|EEX64531.1| LSU ribosomal protein L20p [Vibrio sp. RC341]
          Length = 117

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKGAL 117


>gi|256822929|ref|YP_003146892.1| 50S ribosomal protein L20 [Kangiella koreensis DSM 16069]
 gi|256796468|gb|ACV27124.1| ribosomal protein L20 [Kangiella koreensis DSM 16069]
          Length = 119

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKILKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  RV+ L+YS+FINGL K+ I +DRK+L++LA+    +F    + ++S L
Sbjct: 61  WIARINAEARVHGLSYSRFINGLKKSNIEVDRKMLAELAVFDKVAFAAFADQAKSVL 117


>gi|197284915|ref|YP_002150787.1| 50S ribosomal protein L20 [Proteus mirabilis HI4320]
 gi|227355318|ref|ZP_03839719.1| 50S ribosomal protein L20 [Proteus mirabilis ATCC 29906]
 gi|226730437|sp|B4ETK9|RL20_PROMH RecName: Full=50S ribosomal protein L20
 gi|194682402|emb|CAR42260.1| 50S ribosomal protein L20 [Proteus mirabilis HI4320]
 gi|227164542|gb|EEI49413.1| 50S ribosomal protein L20 [Proteus mirabilis ATCC 29906]
          Length = 118

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R KRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARAKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLRKASIEIDRKILADIAVFDKAAFAALVEKAKGAL 117


>gi|291614195|ref|YP_003524352.1| ribosomal protein L20 [Sideroxydans lithotrophicus ES-1]
 gi|291584307|gb|ADE11965.1| ribosomal protein L20 [Sideroxydans lithotrophicus ES-1]
          Length = 119

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRR +  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLNLAKGYRGRRNSVYRIAKEAVMKAGQYAYRDRRQRKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   + YS F+NGL KA I +DRKVL+DLA+    +F +IV  +++ L
Sbjct: 61  WIARINAAAREQGMAYSVFMNGLKKAAIEIDRKVLADLAVFDKAAFSQIVAQAKASL 117


>gi|260597640|ref|YP_003210211.1| 50S ribosomal protein L20 [Cronobacter turicensis z3032]
 gi|260216817|emb|CBA30302.1| 50S ribosomal protein L20 [Cronobacter turicensis z3032]
          Length = 118

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVMARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKAAL 117


>gi|226944150|ref|YP_002799223.1| 50S ribosomal protein L20 [Azotobacter vinelandii DJ]
 gi|259646174|sp|C1DF45|RL20_AZOVD RecName: Full=50S ribosomal protein L20
 gi|226719077|gb|ACO78248.1| 50S ribosomal protein L20 [Azotobacter vinelandii DJ]
          Length = 118

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA I +DRKVLSDLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGARQNGLSYSRLIAGLKKATIEIDRKVLSDLAVNEKAAFAAIVEKAKAVL 117


>gi|218886083|ref|YP_002435404.1| 50S ribosomal protein L20 [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|226730389|sp|B8DPM9|RL20_DESVM RecName: Full=50S ribosomal protein L20
 gi|218757037|gb|ACL07936.1| ribosomal protein L20 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 117

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 86/115 (74%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ S  +HKK L +AKGF G R    R A+ AV+RS  YA+RDR+VKKR+FR LWI
Sbjct: 2   RVKRGLASHRRHKKYLDAAKGFRGGRSKLYRTAREAVERSWMYAFRDRKVKKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R++ L+YS+F++GL  AGI L+RKVL+DLA+ + + F K+ +L+ S+L
Sbjct: 62  LRINAGARMHGLSYSKFMHGLTLAGISLNRKVLADLAVREKEDFAKLAQLAASKL 116


>gi|226227282|ref|YP_002761388.1| 50S ribosomal protein L20 [Gemmatimonas aurantiaca T-27]
 gi|259646186|sp|C1A493|RL20_GEMAT RecName: Full=50S ribosomal protein L20
 gi|226090473|dbj|BAH38918.1| 50S ribosomal protein L20 [Gemmatimonas aurantiaca T-27]
          Length = 124

 Score =  127 bits (319), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  VV   + K++LK AKG +G R    +AAK  V+R  +YAYRDR+ KKRDFR L
Sbjct: 1   MPRVKSNVVRLKRKKQILKHAKGAFGGRSKLWKAAKETVERGWRYAYRDRKNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R++D++Y+ FINGLH +GI +DRKVL+DLA+ + ++F  I E ++  L   
Sbjct: 61  WIVRINAAARLHDMSYNAFINGLHASGIEVDRKVLADLAVREPEAFAAIAEQAKKALDAK 120

Query: 121 VAS 123
           VA+
Sbjct: 121 VAA 123


>gi|119774903|ref|YP_927643.1| 50S ribosomal protein L20 [Shewanella amazonensis SB2B]
 gi|166220743|sp|A1S6G7|RL20_SHEAM RecName: Full=50S ribosomal protein L20
 gi|119767403|gb|ABL99973.1| LSU ribosomal protein L20P [Shewanella amazonensis SB2B]
          Length = 119

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKILKLAKGYYGARSRTYRVAVQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKEAL 117


>gi|114328168|ref|YP_745325.1| 50S ribosomal protein L20 [Granulibacter bethesdensis CGDNIH1]
 gi|122326873|sp|Q0BS00|RL20_GRABC RecName: Full=50S ribosomal protein L20
 gi|114316342|gb|ABI62402.1| LSU ribosomal protein L20P [Granulibacter bethesdensis CGDNIH1]
          Length = 119

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 75/95 (78%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVKRGV + A+HKKVLK++KGF+GR     R A   +++S QYAYRDRRVKKRDFR+L
Sbjct: 1  MARVKRGVTTHARHKKVLKASKGFFGRSSTNYRIALERLEKSLQYAYRDRRVKKRDFRAL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVL 95
          WIQRINAAVR + + YS FINGL KA I +DRKVL
Sbjct: 61 WIQRINAAVREHGMTYSVFINGLKKAEIDMDRKVL 95


>gi|192360391|ref|YP_001982987.1| 50S ribosomal protein L20 [Cellvibrio japonicus Ueda107]
 gi|226730370|sp|B3PL13|RL20_CELJU RecName: Full=50S ribosomal protein L20
 gi|190686556|gb|ACE84234.1| ribosomal protein L20 [Cellvibrio japonicus Ueda107]
          Length = 119

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 76/100 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKKVLK+AKG+YG R    R AK AV ++ QYAYRDRRVKKR+FR+L
Sbjct: 1   MARVKRGVEARRRHKKVLKAAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           WI RINA  R   L YSQ I GL KA IVLDR+VL+DLA+
Sbjct: 61  WITRINAQSRAEGLTYSQLIAGLKKASIVLDRRVLADLAV 100


>gi|313107810|ref|ZP_07793984.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa 39016]
 gi|310880486|gb|EFQ39080.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa 39016]
          Length = 118

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARQNGLSYSRLIAGLKKAAIEIDRKVLADLAVNEKAAFTALVEKAKASL 117


>gi|54309337|ref|YP_130357.1| 50S ribosomal protein L20 [Photobacterium profundum SS9]
 gi|60390457|sp|Q6LQ71|RL20_PHOPR RecName: Full=50S ribosomal protein L20
 gi|46913773|emb|CAG20555.1| Putative large subunit ribosomal protein L20 [Photobacterium
           profundum SS9]
          Length = 117

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ INGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGLSYSRLINGLKKASIEIDRKILADIAVFDKATFTVLVEKAKAAL 117


>gi|125973738|ref|YP_001037648.1| 50S ribosomal protein L20P [Clostridium thermocellum ATCC 27405]
 gi|256005540|ref|ZP_05430501.1| ribosomal protein L20 [Clostridium thermocellum DSM 2360]
 gi|281417894|ref|ZP_06248914.1| ribosomal protein L20 [Clostridium thermocellum JW20]
 gi|166219636|sp|A3DES6|RL20_CLOTH RecName: Full=50S ribosomal protein L20
 gi|125713963|gb|ABN52455.1| LSU ribosomal protein L20P [Clostridium thermocellum ATCC 27405]
 gi|255990520|gb|EEU00641.1| ribosomal protein L20 [Clostridium thermocellum DSM 2360]
 gi|281409296|gb|EFB39554.1| ribosomal protein L20 [Clostridium thermocellum JW20]
 gi|316940068|gb|ADU74102.1| ribosomal protein L20 [Clostridium thermocellum DSM 1313]
          Length = 117

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GV + A+HKK+LK AKG++G +    R A  AV +S  YAYRDRR +KRDFR L
Sbjct: 1   MSRVKGGVRTRARHKKILKLAKGYFGAKSKNFRIANQAVMKSLVYAYRDRRARKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+  L+YS+F+NGL K+GI L+RK+L+++A+   ++F ++VE
Sbjct: 61  WITRINAAARMNGLSYSKFMNGLKKSGIALNRKMLAEMAVNDAEAFAQLVE 111


>gi|149374486|ref|ZP_01892260.1| ribosomal protein L20 [Marinobacter algicola DG893]
 gi|149361189|gb|EDM49639.1| ribosomal protein L20 [Marinobacter algicola DG893]
          Length = 117

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVVARRRHKKILSQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA + +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARANGLSYSRLIAGLKKANVEIDRKVLADLAMNEQQAFTAVVEKAKASL 117


>gi|77360342|ref|YP_339917.1| 50S ribosomal protein L20 [Pseudoalteromonas haloplanktis TAC125]
 gi|109893137|sp|Q3IL78|RL20_PSEHT RecName: Full=50S ribosomal protein L20
 gi|76875253|emb|CAI86474.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Pseudoalteromonas haloplanktis TAC125]
          Length = 120

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FI+GL K  + +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFISGLKKTSVEIDRKILADIAVYDQVAFAALVEKAKEGL 117


>gi|285017867|ref|YP_003375578.1| 50s ribosomal protein l20 [Xanthomonas albilineans GPE PC73]
 gi|283473085|emb|CBA15590.1| probable 50s ribosomal protein l20 [Xanthomonas albilineans]
          Length = 119

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKKVL  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKVLNLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L
Sbjct: 61  WITRINAAARINGMSYSRFMNGLLKAGITLDRKVLADIAVHDAQGFAALAEKAKGAL 117


>gi|332701964|ref|ZP_08422052.1| 50S ribosomal protein L20 [Desulfovibrio africanus str. Walvis Bay]
 gi|332552113|gb|EGJ49157.1| 50S ribosomal protein L20 [Desulfovibrio africanus str. Walvis Bay]
          Length = 117

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 87/115 (75%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ S  +HKK LK AKG  G R    R A+ +V+R+  YA+RDR+ KKR+FR LWI
Sbjct: 2   RVKRGLASHRRHKKYLKLAKGHRGARHRLYRVARESVERALAYAFRDRKQKKREFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           QRI A  R Y L+YS+FINGL +AGI ++RK+L+++A+ + DSF K+VEL++S++
Sbjct: 62  QRIGAGARQYGLSYSRFINGLTQAGISINRKMLAEMAVREKDSFAKLVELAKSKV 116


>gi|126733939|ref|ZP_01749686.1| ribosomal protein L20 [Roseobacter sp. CCS2]
 gi|126716805|gb|EBA13669.1| ribosomal protein L20 [Roseobacter sp. CCS2]
          Length = 120

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 84/117 (71%), Gaps = 2/117 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVL  AKG+Y RR  T + A  AVD++ QYA RDR  +KR+FR+LWI
Sbjct: 2   RVKGGTVTHRRHKKVLDQAKGYYDRRSKTFKVAAQAVDKANQYATRDRHNRKRNFRALWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           QRINA VR  D  LNYS+FINGL  AGI +DRKVL+DLA+ + ++F  +V  ++  L
Sbjct: 62  QRINAGVRSVDETLNYSKFINGLTLAGIEVDRKVLADLAVNEPEAFAAVVGKAKDAL 118


>gi|296116373|ref|ZP_06834988.1| 50S ribosomal protein L20 [Gluconacetobacter hansenii ATCC 23769]
 gi|295977073|gb|EFG83836.1| 50S ribosomal protein L20 [Gluconacetobacter hansenii ATCC 23769]
          Length = 118

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S A+HKKVL+ +KG+ GR     R A   ++++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTSHARHKKVLELSKGYRGRSSTNYRIALERLEKALRYAYRDRRNKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS+FINGL KAGI +DRKVL+ +A     +F +IV+ +++ L
Sbjct: 61  WIQRINAAVREHGLTYSRFINGLDKAGIEIDRKVLAAIAFDDAATFAEIVKKAQAAL 117


>gi|260592276|ref|ZP_05857734.1| ribosomal protein L20 [Prevotella veroralis F0319]
 gi|302346320|ref|YP_003814618.1| ribosomal protein L20 [Prevotella melaninogenica ATCC 25845]
 gi|325269096|ref|ZP_08135717.1| 50S ribosomal protein L20 [Prevotella multiformis DSM 16608]
 gi|260535910|gb|EEX18527.1| ribosomal protein L20 [Prevotella veroralis F0319]
 gi|302150914|gb|ADK97175.1| ribosomal protein L20 [Prevotella melaninogenica ATCC 25845]
 gi|324988717|gb|EGC20679.1| 50S ribosomal protein L20 [Prevotella multiformis DSM 16608]
          Length = 114

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKQTKGYYGARKNVWTVAKNTYEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+YD++YSQ +  LHKAGI ++RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAAARLYDMSYSQLMGALHKAGIEINRKVLADLAVNNQEAFKAIVD 111


>gi|226330395|ref|ZP_03805913.1| hypothetical protein PROPEN_04313 [Proteus penneri ATCC 35198]
 gi|225201190|gb|EEG83544.1| hypothetical protein PROPEN_04313 [Proteus penneri ATCC 35198]
          Length = 118

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R KRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARAKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASIEIDRKILADIAVFDKVAFAALVEKAKGAL 117


>gi|303237315|ref|ZP_07323885.1| ribosomal protein L20 [Prevotella disiens FB035-09AN]
 gi|302482702|gb|EFL45727.1| ribosomal protein L20 [Prevotella disiens FB035-09AN]
          Length = 114

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKQTKGYYGARKNVWTVAKNTYEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+YD++YSQ +  LHK+GI ++RKVL+DLA    ++FK IVE
Sbjct: 61  WIQRINAAARLYDMSYSQLMGALHKSGIEINRKVLADLAANNPEAFKAIVE 111


>gi|255994772|ref|ZP_05427907.1| ribosomal protein L20 [Eubacterium saphenum ATCC 49989]
 gi|255993485|gb|EEU03574.1| ribosomal protein L20 [Eubacterium saphenum ATCC 49989]
          Length = 117

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 83/111 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K+GV + A+HKK+LK AKGFYG +KN  RAA  AV R+ + AY+ R+ +KRDFR L
Sbjct: 1   MARIKKGVTAHARHKKILKQAKGFYGTKKNVFRAANTAVMRALREAYKGRKHRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+  L+YS+ INGL K+G+ ++RK+LS+LAI   ++F  + +
Sbjct: 61  WITRINAAARLNGLSYSKLINGLKKSGVEVNRKMLSELAINNKEAFTALCD 111


>gi|46580939|ref|YP_011747.1| 50S ribosomal protein L20 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601760|ref|YP_966160.1| 50S ribosomal protein L20 [Desulfovibrio vulgaris DP4]
 gi|60390489|sp|Q728R8|RL20_DESVH RecName: Full=50S ribosomal protein L20
 gi|166219639|sp|A1VBB7|RL20_DESVV RecName: Full=50S ribosomal protein L20
 gi|46450359|gb|AAS97007.1| ribosomal protein L20 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120561989|gb|ABM27733.1| LSU ribosomal protein L20P [Desulfovibrio vulgaris DP4]
 gi|311234629|gb|ADP87483.1| ribosomal protein L20 [Desulfovibrio vulgaris RCH1]
          Length = 117

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 86/115 (74%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ +  +HKK L  AKG+ G R    R A+ AV+RS  YA+RDR+VKKR+FR LWI
Sbjct: 2   RVKRGLAAHRRHKKYLDMAKGYRGGRSRLYRTAREAVERSLCYAFRDRKVKKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+  L+YS+F++GL  AG+ L+RKVL+DLA+ + D F KI EL++S+L
Sbjct: 62  LRINAAARLNGLSYSKFMHGLTLAGVELNRKVLADLAVREKDDFAKIAELAKSKL 116


>gi|94676716|ref|YP_588907.1| 50S ribosomal protein L20 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|166219610|sp|Q1LT07|RL20_BAUCH RecName: Full=50S ribosomal protein L20
 gi|94219866|gb|ABF14025.1| ribosomal protein L20 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 120

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 65/119 (54%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK A G+YG R    R A  AV ++ QY YRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKLANGYYGARSRVYRVAFQAVLKAGQYCYRDRRCKKRQFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR + + YS F+N L KA I +DRK+L+++AI+   +F  + E ++S L V
Sbjct: 61  WITRINAAVRQHGITYSCFMNSLKKASIHIDRKILAEIAISDKVAFATLAEKAKSILCV 119


>gi|325856622|ref|ZP_08172260.1| ribosomal protein L20 [Prevotella denticola CRIS 18C-A]
 gi|327313431|ref|YP_004328868.1| 50S ribosomal protein L20 [Prevotella denticola F0289]
 gi|325483336|gb|EGC86311.1| ribosomal protein L20 [Prevotella denticola CRIS 18C-A]
 gi|326944020|gb|AEA19905.1| ribosomal protein L20 [Prevotella denticola F0289]
          Length = 114

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKKTKGYYGARKNVWTVAKNTYEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+YD++YSQ +  LHKAGI ++RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAAARLYDMSYSQLMGALHKAGIEINRKVLADLAVNNQEAFKAIVD 111


>gi|67458741|ref|YP_246365.1| 50S ribosomal protein L20 [Rickettsia felis URRWXCal2]
 gi|75536802|sp|Q4UMK8|RL20_RICFE RecName: Full=50S ribosomal protein L20
 gi|67004274|gb|AAY61200.1| 50S ribosomal protein L20 [Rickettsia felis URRWXCal2]
          Length = 117

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L KA I +DRKVL++LA+   D F  I+E +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKAEIDIDRKVLAELAVNNSDGFASIIEQAKAHI 117


>gi|162149043|ref|YP_001603504.1| 50S ribosomal protein L20 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545208|ref|YP_002277437.1| 50S ribosomal protein L20 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189041866|sp|A9H170|RL20_GLUDA RecName: Full=50S ribosomal protein L20
 gi|161787620|emb|CAP57216.1| putative 50S ribosomal protein L20 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532885|gb|ACI52822.1| ribosomal protein L20 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 119

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL+ +KGF GR     R A   ++++ +YAYRDRR KKRDFR+L
Sbjct: 1   MARVKRGVTTHARHKKVLEQSKGFRGRSSTNYRIALERLEKALRYAYRDRRNKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS+FI GL KAGI +DRKVL+ +A     +F +IV+ +++ L
Sbjct: 61  WIQRINAAVREHGLTYSKFIFGLDKAGIEIDRKVLAAIAFDDAATFAEIVKKAQAAL 117


>gi|311693965|gb|ADP96838.1| ribosomal protein L20, bacterial-type [marine bacterium HP15]
          Length = 117

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKILNQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRNRKRAFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA + +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARANGLSYSRLIAGLKKANVEIDRKVLADLAMNEQQAFAAVVEKAKASL 117


>gi|71066551|ref|YP_265278.1| 50S ribosomal protein L20 [Psychrobacter arcticus 273-4]
 gi|93007124|ref|YP_581561.1| 50S ribosomal protein L20 [Psychrobacter cryohalolentis K5]
 gi|109893139|sp|Q4FQ64|RL20_PSYA2 RecName: Full=50S ribosomal protein L20
 gi|109893140|sp|Q1Q8C6|RL20_PSYCK RecName: Full=50S ribosomal protein L20
 gi|71039536|gb|AAZ19844.1| LSU ribosomal protein L20P [Psychrobacter arcticus 273-4]
 gi|92394802|gb|ABE76077.1| LSU ribosomal protein L20P [Psychrobacter cryohalolentis K5]
          Length = 118

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV ++ +HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQANRRHKKILKRAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRNKKRTFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+FING+ KA I +DR+VL+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAGARLNGLSYSRFINGMKKANIAIDRRVLADIAMHDAATFTALVEKAKAEL 117


>gi|110004468|emb|CAK98805.1| 50s ribosomal protein l20 [Spiroplasma citri]
          Length = 119

 Score =  126 bits (317), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KK++K AKG++G +    + AK  V +S  YA+RDR+ +KRDFRSL
Sbjct: 1   MARVKGGSTTRKRRKKIIKEAKGYFGTKSTHYKKAKEQVMKSWSYAFRDRKQRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D++YSQF+NGL+K  I ++RK+LS+LAI   + FK +VE S+  L
Sbjct: 61  WIQRINAAVREHDMSYSQFMNGLNKTNIEVNRKILSELAIHNPNEFKVLVEKSKQAL 117


>gi|157826002|ref|YP_001493722.1| 50S ribosomal protein L20 [Rickettsia akari str. Hartford]
 gi|166220736|sp|A8GP89|RL20_RICAH RecName: Full=50S ribosomal protein L20
 gi|157799960|gb|ABV75214.1| 50S ribosomal protein L20 [Rickettsia akari str. Hartford]
          Length = 117

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +   YSQFI  L KA I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGFVYSQFIGALKKAEIDIDRKVLAELAVNNSDGFASIVEKTKAHI 117


>gi|188577596|ref|YP_001914525.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|226730475|sp|B2SUM0|RL20_XANOP RecName: Full=50S ribosomal protein L20
 gi|188522048|gb|ACD59993.1| ribosomal protein L20 [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 119

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILTLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L
Sbjct: 61  WITRINAAARINGLSYSRFMNGLLKAGITLDRKVLADIAVHDAAGFTALAEKAKGAL 117


>gi|83594851|ref|YP_428603.1| 50S ribosomal protein L20 [Rhodospirillum rubrum ATCC 11170]
 gi|109893146|sp|Q2RNH9|RL20_RHORT RecName: Full=50S ribosomal protein L20
 gi|83577765|gb|ABC24316.1| LSU ribosomal protein L20P [Rhodospirillum rubrum ATCC 11170]
          Length = 125

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R      + A+HKKVL  AKG+ GR     R A   V++  QYAYRDRR KKR+FRSL
Sbjct: 1   MSRATNAKTNHARHKKVLDLAKGYRGRNSTNFRIAIEKVEKGLQYAYRDRRAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R   L YSQFINGL +AGI LDRK+L+DLA+T+  +F  +V  +++ L
Sbjct: 61  WIQRINAGAREQGLTYSQFINGLIRAGIELDRKILADLAVTEPAAFASLVAQAKAAL 117


>gi|51473787|ref|YP_067544.1| 50S ribosomal protein L20 [Rickettsia typhi str. Wilmington]
 gi|60390365|sp|Q68WD0|RL20_RICTY RecName: Full=50S ribosomal protein L20
 gi|51460099|gb|AAU04062.1| 50S ribosomal protein L20 [Rickettsia typhi str. Wilmington]
          Length = 117

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 82/115 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++  YAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKKRHKKILKLAKGYRGRANSCFRVAIEKVEKALLYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAAVR + L YSQF+  L KAGI +DRKVL++LA+   D F  IV+ S++
Sbjct: 61  WIQRINAAVREHGLIYSQFMGALKKAGINIDRKVLAELAVNNNDGFTSIVQQSKA 115


>gi|33301639|sp|Q84BL4|RL20_VIBAN RecName: Full=50S ribosomal protein L20
 gi|28866933|gb|AAM95156.1| large subunit ribosomal protein L20 [Listonella anguillarum]
          Length = 117

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYR RR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRARRTKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKTAL 117


>gi|315126516|ref|YP_004068519.1| 50S ribosomal protein L20 [Pseudoalteromonas sp. SM9913]
 gi|315015030|gb|ADT68368.1| 50S ribosomal protein L20 [Pseudoalteromonas sp. SM9913]
          Length = 120

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL K  + +DRK+L+D+A+    +F  +V  ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKTSVEIDRKILADIAVYDQVAFAALVAKAKEGL 117


>gi|21243322|ref|NP_642904.1| 50S ribosomal protein L20 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|58582807|ref|YP_201823.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|78048348|ref|YP_364523.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|84624681|ref|YP_452053.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166711591|ref|ZP_02242798.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|294626195|ref|ZP_06704801.1| 50S ribosomal protein L20 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294667579|ref|ZP_06732794.1| 50S ribosomal protein L20 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325917700|ref|ZP_08179891.1| LSU ribosomal protein L20P [Xanthomonas vesicatoria ATCC 35937]
 gi|325927166|ref|ZP_08188429.1| LSU ribosomal protein L20P [Xanthomonas perforans 91-118]
 gi|23822043|sp|Q8PJE3|RL20_XANAC RecName: Full=50S ribosomal protein L20
 gi|81311791|sp|Q5GXY3|RL20_XANOR RecName: Full=50S ribosomal protein L20
 gi|109893169|sp|Q3BRU0|RL20_XANC5 RecName: Full=50S ribosomal protein L20
 gi|109893170|sp|Q2P0Z8|RL20_XANOM RecName: Full=50S ribosomal protein L20
 gi|21108864|gb|AAM37440.1| 50S ribosomal protein L20 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|58427401|gb|AAW76438.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|78036778|emb|CAJ24471.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|84368621|dbj|BAE69779.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|292599547|gb|EFF43678.1| 50S ribosomal protein L20 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292602699|gb|EFF46135.1| 50S ribosomal protein L20 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325536094|gb|EGD07899.1| LSU ribosomal protein L20P [Xanthomonas vesicatoria ATCC 35937]
 gi|325542479|gb|EGD13958.1| LSU ribosomal protein L20P [Xanthomonas perforans 91-118]
          Length = 119

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILTLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L
Sbjct: 61  WITRINAAARINGLSYSRFMNGLLKAGITLDRKVLADIAVHDAAGFAALAEKAKGAL 117


>gi|134299472|ref|YP_001112968.1| 50S ribosomal protein L20 [Desulfotomaculum reducens MI-1]
 gi|172044281|sp|A4J4Z0|RL20_DESRM RecName: Full=50S ribosomal protein L20
 gi|134052172|gb|ABO50143.1| LSU ribosomal protein L20P [Desulfotomaculum reducens MI-1]
          Length = 118

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  VVS  +H+K+LK AKG+ G R    R A  AV +   YAYRDRR KKRDFR L
Sbjct: 1   MPRAKSSVVSRNRHRKILKLAKGYRGSRSKLFRVANQAVMKGLFYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FINGL KAG+ ++RK+L+DLA+    +F ++VEL++S+L
Sbjct: 61  WIARINAATRMNGLSYSRFINGLKKAGVEVNRKMLADLAVNDAKAFGQLVELAKSKL 117


>gi|153952172|ref|YP_001397472.1| 50S ribosomal protein L20 [Campylobacter jejuni subsp. doylei
           269.97]
 gi|166219627|sp|A7H1U2|RL20_CAMJD RecName: Full=50S ribosomal protein L20
 gi|152939618|gb|ABS44359.1| ribosomal protein L20 [Campylobacter jejuni subsp. doylei 269.97]
          Length = 117

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 77/103 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   KHKKVLK A+GFY  R+   R AK  ++RS  YAYRDRR KK DFR L
Sbjct: 1   MARVKTGVVRRRKHKKVLKLARGFYSGRRKHFRKAKEQLERSLVYAYRDRRRKKTDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQL 103
           WI RINAA R+ DL+YS+FINGL KAGI LDRK+L+DLA+  +
Sbjct: 61  WIVRINAACRLNDLSYSRFINGLKKAGIELDRKILADLAMNDV 103


>gi|90410624|ref|ZP_01218640.1| 50S ribosomal protein L20 [Photobacterium profundum 3TCK]
 gi|90328865|gb|EAS45149.1| 50S ribosomal protein L20 [Photobacterium profundum 3TCK]
          Length = 117

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+ INGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGMSYSRLINGLKKASIEIDRKILADIAVFDKATFTVLVEKAKAAL 117


>gi|308049560|ref|YP_003913126.1| 50S ribosomal protein L20P [Ferrimonas balearica DSM 9799]
 gi|307631750|gb|ADN76052.1| LSU ribosomal protein L20P [Ferrimonas balearica DSM 9799]
          Length = 119

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVTARARHKKVLKQAKGYYGARSRIYRVAFQAVTKAGQYAYRDRRAKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASVEIDRKILADIAVFDKVVFAALVEKAKEAL 117


>gi|254785574|ref|YP_003073003.1| 50S ribosomal protein L20 [Teredinibacter turnerae T7901]
 gi|259646201|sp|C5BSQ5|RL20_TERTT RecName: Full=50S ribosomal protein L20
 gi|237684714|gb|ACR11978.1| ribosomal protein L20 [Teredinibacter turnerae T7901]
          Length = 119

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+   HKKVLK+AKG+YG R    R AK AV ++ QYAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVVARRSHKKVLKAAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   ++YS+ I GL KA I LDR+VL+DLAI    +F  IV  ++  L
Sbjct: 61  WITRINAQSRAEGMSYSRLIAGLKKAEITLDRRVLADLAIHDKPAFAAIVAKAKDAL 117


>gi|190571067|ref|YP_001975425.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019588|ref|ZP_03335394.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|226730473|sp|B3CLK2|RL20_WOLPP RecName: Full=50S ribosomal protein L20
 gi|190357339|emb|CAQ54770.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995010|gb|EEB55652.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 121

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRG  + A+HKKVLK AKG+ GR KN  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MARIKRGTATHARHKKVLKLAKGYRGRAKNCYRIALQRVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L Y +F++GL   G+ L+RK+L+++A+   D F K++E   S+L
Sbjct: 61  WIIRINAAAREHGLTYGRFMHGLKLVGVDLNRKILAEMAVNHKDDFAKLIETVSSKL 117


>gi|237752908|ref|ZP_04583388.1| 50S ribosomal protein L20 [Helicobacter winghamensis ATCC BAA-430]
 gi|229375175|gb|EEO25266.1| 50S ribosomal protein L20 [Helicobacter winghamensis ATCC BAA-430]
          Length = 117

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/111 (57%), Positives = 81/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GFY  R    R AK  ++RS  YA+RDR+ KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFYSARHKHFRKAKEQLERSLCYAFRDRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+  ++YS+F+ GL KAGI LDRK+L+D+A+ +  +F KIVE
Sbjct: 61  WIVRINAACRINAISYSRFMFGLKKAGITLDRKILADIAMHEPVAFAKIVE 111


>gi|194366575|ref|YP_002029185.1| 50S ribosomal protein L20 [Stenotrophomonas maltophilia R551-3]
 gi|226730458|sp|B4SQH1|RL20_STRM5 RecName: Full=50S ribosomal protein L20
 gi|194349379|gb|ACF52502.1| ribosomal protein L20 [Stenotrophomonas maltophilia R551-3]
          Length = 119

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILDLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L
Sbjct: 61  WITRINAAARINGLSYSRFMNGLLKAGITLDRKVLADIAVHDAAGFTALAEKAKGAL 117


>gi|120554975|ref|YP_959326.1| 50S ribosomal protein L20 [Marinobacter aquaeolei VT8]
 gi|166219659|sp|A1U2C0|RL20_MARAV RecName: Full=50S ribosomal protein L20
 gi|120324824|gb|ABM19139.1| LSU ribosomal protein L20P [Marinobacter aquaeolei VT8]
          Length = 117

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKILNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRRNRKRAFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA + +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARANGLSYSRLIAGLKKANVEIDRKVLADLAMNEQQAFAAVVEKAKASL 117


>gi|331006132|ref|ZP_08329461.1| LSU ribosomal protein L20p [gamma proteobacterium IMCC1989]
 gi|330420056|gb|EGG94393.1| LSU ribosomal protein L20p [gamma proteobacterium IMCC1989]
          Length = 118

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 76/106 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+   HKK+LK AKG+YG R    R AK AV ++ QYAYRDRRVKKR+FR+L
Sbjct: 1   MARVKRGVVARKSHKKILKQAKGYYGARSRIFRVAKQAVIKAGQYAYRDRRVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINA  R   + YSQ I GL KA I LDR+VL+DLA+    +F
Sbjct: 61  WITRINAQSRALGMTYSQLIAGLKKAEIALDRRVLADLAVHDKAAF 106


>gi|258544545|ref|ZP_05704779.1| inorganic diphosphatase [Cardiobacterium hominis ATCC 15826]
 gi|258520176|gb|EEV89035.1| inorganic diphosphatase [Cardiobacterium hominis ATCC 15826]
          Length = 117

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL +AKG+Y  R+   R AK AV ++ QYAYRDR+ +KR FR L
Sbjct: 1   MARVKRGVTARARHKKVLAAAKGYYNARRKVFRIAKQAVIKAGQYAYRDRKARKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R + L+YS+FINGL K+GI +DRK+L++LA+     F  + E +++ L
Sbjct: 61  WIIRINAGARQHGLSYSRFINGLKKSGIAIDRKMLAELAVYNKQVFAVLAEKAKAAL 117


>gi|190575248|ref|YP_001973093.1| 50S ribosomal protein L20 [Stenotrophomonas maltophilia K279a]
 gi|254524211|ref|ZP_05136266.1| ribosomal protein L20 [Stenotrophomonas sp. SKA14]
 gi|226730459|sp|B2FN76|RL20_STRMK RecName: Full=50S ribosomal protein L20
 gi|190013170|emb|CAQ46803.1| putative 50S ribosomal protein L20 [Stenotrophomonas maltophilia
           K279a]
 gi|219721802|gb|EED40327.1| ribosomal protein L20 [Stenotrophomonas sp. SKA14]
          Length = 119

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILDLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L
Sbjct: 61  WITRINAAARINGLSYSRFMNGLLKAGITLDRKVLADIAVHDAAGFAALAEKAKGAL 117


>gi|171463689|ref|YP_001797802.1| ribosomal protein L20 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
 gi|226730434|sp|B1XV11|RL20_POLNS RecName: Full=50S ribosomal protein L20
 gi|171193227|gb|ACB44188.1| ribosomal protein L20 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
          Length = 121

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 75/98 (76%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVKRGV + A+HKK+  +A G+ GRRKN  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1  MPRVKRGVTARARHKKITDAATGYRGRRKNVFRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDL 98
          WI RINAAVR +D+ YS F+NG+ K  I LDRKVLSD+
Sbjct: 61 WIARINAAVRQHDVTYSVFMNGMKKVAIELDRKVLSDM 98


>gi|119476519|ref|ZP_01616870.1| ribosomal protein L20 [marine gamma proteobacterium HTCC2143]
 gi|119450383|gb|EAW31618.1| ribosomal protein L20 [marine gamma proteobacterium HTCC2143]
          Length = 118

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA I LDR+VL+DLA+    +F  +V+L+++ L
Sbjct: 61  WITRINAQSRANGLSYSRLIAGLKKANIGLDRRVLADLAVHDKPAFGAVVDLAKAAL 117


>gi|88859307|ref|ZP_01133947.1| 50S ribosomal protein L20 [Pseudoalteromonas tunicata D2]
 gi|88818324|gb|EAR28139.1| 50S ribosomal protein L20 [Pseudoalteromonas tunicata D2]
          Length = 119

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 79/110 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAA R   L+YS+FINGL K  + +DRK+L+D+A+    +F  +V
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKTSVEIDRKILADIAVYDQVAFAALV 110


>gi|157828789|ref|YP_001495031.1| 50S ribosomal protein L20 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933517|ref|YP_001650306.1| 50S ribosomal protein L20 [Rickettsia rickettsii str. Iowa]
 gi|166220739|sp|A8GSZ8|RL20_RICRS RecName: Full=50S ribosomal protein L20
 gi|189041879|sp|B0BUJ0|RL20_RICRO RecName: Full=50S ribosomal protein L20
 gi|157801270|gb|ABV76523.1| 50S ribosomal protein L20 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908604|gb|ABY72900.1| LSU ribosomal protein L20P [Rickettsia rickettsii str. Iowa]
          Length = 117

 Score =  125 bits (315), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L K  I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKTEIAIDRKVLAELAVNNSDGFVSIVEKAKAHI 117


>gi|292493204|ref|YP_003528643.1| ribosomal protein L20 [Nitrosococcus halophilus Nc4]
 gi|291581799|gb|ADE16256.1| ribosomal protein L20 [Nitrosococcus halophilus Nc4]
          Length = 119

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 76/100 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GRRKN  R A  AV R+ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVISQAKGYRGRRKNVYRVANQAVIRASQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           WI RINAA R   L+YS+ INGL KA I +DRKVL+DLA+
Sbjct: 61  WIVRINAAARECGLSYSRLINGLKKAAIDIDRKVLADLAV 100


>gi|268678726|ref|YP_003303157.1| ribosomal protein L20 [Sulfurospirillum deleyianum DSM 6946]
 gi|268616757|gb|ACZ11122.1| ribosomal protein L20 [Sulfurospirillum deleyianum DSM 6946]
          Length = 117

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKK+LK A+GF+  R+   R AK  ++RS  YA+RDRR KKRDFR L
Sbjct: 1   MARVKTGIVRRRRHKKILKMARGFFSGRRKHFRKAKEQLERSLVYAFRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YS+FIN L+KA I LDRK+L+D+A+   ++F  +V+ +++ L
Sbjct: 61  WITRINAACRLNDISYSRFINALNKANIDLDRKILADMAMNDPEAFATVVKQAKAAL 117


>gi|313205747|ref|YP_004044924.1| LSU ribosomal protein l20p [Riemerella anatipestifer DSM 15868]
 gi|312445063|gb|ADQ81418.1| LSU ribosomal protein L20P [Riemerella anatipestifer DSM 15868]
 gi|315022857|gb|EFT35881.1| LSU ribosomal protein L20p [Riemerella anatipestifer RA-YM]
 gi|325336811|gb|ADZ13085.1| Ribosomal protein L20 [Riemerella anatipestifer RA-GD]
          Length = 114

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKGF+GRRKN    AK AV+++ QYAYR R+ KKR+FRSL
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGFFGRRKNVWTVAKNAVEKAMQYAYRGRKEKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R Y ++YSQF+  L K  I L+RKVL+DLA+   ++FK +V+
Sbjct: 61  WIMRINAGCREYGMSYSQFMGALKKNNIELNRKVLADLAMNHPEAFKAVVD 111


>gi|154147912|ref|YP_001406082.1| 50S ribosomal protein L20 [Campylobacter hominis ATCC BAA-381]
 gi|166219626|sp|A7I0P1|RL20_CAMHC RecName: Full=50S ribosomal protein L20
 gi|153803921|gb|ABS50928.1| ribosomal protein L20 [Campylobacter hominis ATCC BAA-381]
          Length = 117

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 79/110 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GF+  R+   R AK  V+RS  Y+YRDRR KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFFSARRKHFRKAKEQVERSLVYSYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAA R+ D++YS+FIN L KA I LDRKVL+DLA+    +F  IV
Sbjct: 61  WIVRINAACRLNDISYSKFINALKKANIELDRKVLADLAMNDAAAFSAIV 110


>gi|21231895|ref|NP_637812.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767977|ref|YP_242739.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991103|ref|YP_001903113.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. B100]
 gi|23822041|sp|Q8P7Z4|RL20_XANCP RecName: Full=50S ribosomal protein L20
 gi|81306046|sp|Q4UW54|RL20_XANC8 RecName: Full=50S ribosomal protein L20
 gi|226730474|sp|B0RRH2|RL20_XANCB RecName: Full=50S ribosomal protein L20
 gi|21113619|gb|AAM41736.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66573309|gb|AAY48719.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167732863|emb|CAP51057.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris]
          Length = 119

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILTLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NG+ KAGI LDRKVL+D+A+     F  + E ++  L
Sbjct: 61  WITRINAAARINGLSYSRFMNGMLKAGITLDRKVLADIAVHDAAGFAALAEKAKGAL 117


>gi|89074409|ref|ZP_01160891.1| 50S ribosomal protein L20 [Photobacterium sp. SKA34]
 gi|90579638|ref|ZP_01235447.1| 50S ribosomal protein L20 [Vibrio angustum S14]
 gi|330445798|ref|ZP_08309450.1| ribosomal protein L20 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|89049896|gb|EAR55437.1| 50S ribosomal protein L20 [Photobacterium sp. SKA34]
 gi|90439212|gb|EAS64394.1| 50S ribosomal protein L20 [Vibrio angustum S14]
 gi|328489989|dbj|GAA03947.1| ribosomal protein L20 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 117

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+ INGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGMSYSRLINGLKKASIEIDRKILADIAVFDKATFTVLVEKAKAAL 117


>gi|71908287|ref|YP_285874.1| 50S ribosomal protein L20 [Dechloromonas aromatica RCB]
 gi|109893109|sp|Q47CM7|RL20_DECAR RecName: Full=50S ribosomal protein L20
 gi|71847908|gb|AAZ47404.1| LSU ribosomal protein L20P [Dechloromonas aromatica RCB]
          Length = 119

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QY YRDRR +KR FRSL
Sbjct: 1   MPRVKRGVTARARHKKVLVQAKGYRGRRKNVYRIAKQAVMKAGQYQYRDRRQRKRQFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           WI RINAA R   + YS F+NGL KA I +DRKVL+DLA+
Sbjct: 61  WIARINAAARELGMKYSTFMNGLKKANIEVDRKVLADLAV 100


>gi|48474878|sp|Q8RPZ9|RL20_AZOVI RecName: Full=50S ribosomal protein L20
 gi|19386911|gb|AAL87033.1|AF332624_4 ribosomal protein L20 [Azotobacter vinelandii]
          Length = 118

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA I +DRKVLSDLA+ +  +F  IVE +++ L
Sbjct: 61  WIARINAGDRQNGLSYSRLIAGLKKATIEIDRKVLSDLAVNEKAAFAAIVEKAKAVL 117


>gi|29654621|ref|NP_820313.1| 50S ribosomal protein L20 [Coxiella burnetii RSA 493]
 gi|153207450|ref|ZP_01946150.1| ribosomal protein L20 [Coxiella burnetii 'MSU Goat Q177']
 gi|154706682|ref|YP_001424760.1| 50S ribosomal protein L20 [Coxiella burnetii Dugway 5J108-111]
 gi|161830026|ref|YP_001597172.1| 50S ribosomal protein L20 [Coxiella burnetii RSA 331]
 gi|165924061|ref|ZP_02219893.1| ribosomal protein L20 [Coxiella burnetii RSA 334]
 gi|212212296|ref|YP_002303232.1| 50S ribosomal protein L20 [Coxiella burnetii CbuG_Q212]
 gi|212218735|ref|YP_002305522.1| 50S ribosomal protein L20 [Coxiella burnetii CbuK_Q154]
 gi|39931900|sp|Q83C13|RL20_COXBU RecName: Full=50S ribosomal protein L20
 gi|189041858|sp|A9KGB8|RL20_COXBN RecName: Full=50S ribosomal protein L20
 gi|189041859|sp|A9N8K2|RL20_COXBR RecName: Full=50S ribosomal protein L20
 gi|226730381|sp|B6J7X8|RL20_COXB1 RecName: Full=50S ribosomal protein L20
 gi|226730382|sp|B6IZF9|RL20_COXB2 RecName: Full=50S ribosomal protein L20
 gi|29541889|gb|AAO90827.1| LSU ribosomal protein L20P [Coxiella burnetii RSA 493]
 gi|120576581|gb|EAX33205.1| ribosomal protein L20 [Coxiella burnetii 'MSU Goat Q177']
 gi|154355968|gb|ABS77430.1| LSU ribosomal protein L20P [Coxiella burnetii Dugway 5J108-111]
 gi|161761893|gb|ABX77535.1| ribosomal protein L20 [Coxiella burnetii RSA 331]
 gi|165916493|gb|EDR35097.1| ribosomal protein L20 [Coxiella burnetii RSA 334]
 gi|212010706|gb|ACJ18087.1| LSU ribosomal protein L20P [Coxiella burnetii CbuG_Q212]
 gi|212012997|gb|ACJ20377.1| LSU ribosomal protein L20P [Coxiella burnetii CbuK_Q154]
          Length = 119

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+ +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLTKAKGYYGARSRVFRVAKQAVIKAAQYAYRDRKQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L+YS+ INGL KA + +DRK L++LA+    +F K+ E ++  L
Sbjct: 61  WIVRINAAAREHGLSYSRLINGLMKASVAIDRKNLAELAVYDKAAFGKLAEKAKQAL 117


>gi|149371733|ref|ZP_01891149.1| 50S ribosomal protein L20 [unidentified eubacterium SCB49]
 gi|149355360|gb|EDM43920.1| 50S ribosomal protein L20 [unidentified eubacterium SCB49]
          Length = 114

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AVD++  Y+YRDRR KKR FRSL
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGYFGRRKNVWTVAKNAVDKAMSYSYRDRRAKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R + ++YSQF+ G+ K+GI L+RKVL+DLA+   ++F+ IV 
Sbjct: 61  WITRINAGARQHGMSYSQFMGGVKKSGIELNRKVLADLAMNHPEAFEAIVN 111


>gi|157163866|ref|YP_001465938.1| 50S ribosomal protein L20 [Campylobacter concisus 13826]
 gi|166219623|sp|A7ZAY0|RL20_CAMC1 RecName: Full=50S ribosomal protein L20
 gi|112801829|gb|EAT99173.1| ribosomal protein L20 [Campylobacter concisus 13826]
          Length = 118

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GF+  R    R AK  ++RS  YAYRDRR KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFFSARHKHFRKAKEQLERSLVYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YS+FINGL+KA I LDRK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIVRINAACRLNDISYSRFINGLNKANIELDRKILADLAMNDAKAFAALAKQAKDAL 117


>gi|320335391|ref|YP_004172102.1| 50S ribosomal protein L20 [Deinococcus maricopensis DSM 21211]
 gi|319756680|gb|ADV68437.1| 50S ribosomal protein L20 [Deinococcus maricopensis DSM 21211]
          Length = 119

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 80/115 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKKVLK AKGF+G R    + A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MPRVKTGIVRRRRHKKVLKRAKGFWGSRSKQYKNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINA  R++ +NYS FI+GL KAG+ LDRK+L+DLA  + ++F  +VE ++ 
Sbjct: 61  WIQRINAGARLHGMNYSTFISGLKKAGVGLDRKILADLAAREPETFATLVETAKG 115


>gi|288802816|ref|ZP_06408253.1| ribosomal protein L20 [Prevotella melaninogenica D18]
 gi|288334633|gb|EFC73071.1| ribosomal protein L20 [Prevotella melaninogenica D18]
          Length = 114

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKQTKGYYGARKNVWTVAKNTYEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+YD++YSQ +  LHKAGI ++RKVL+DLA    ++FK IV+
Sbjct: 61  WIQRINAAARLYDMSYSQLMGALHKAGIEINRKVLADLAANNQEAFKAIVD 111


>gi|15837342|ref|NP_298030.1| 50S ribosomal protein L20 [Xylella fastidiosa 9a5c]
 gi|14195143|sp|Q9PFD8|RL20_XYLFA RecName: Full=50S ribosomal protein L20
 gi|9105630|gb|AAF83550.1|AE003916_4 50S ribosomal protein L20 [Xylella fastidiosa 9a5c]
          Length = 119

 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILSLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL K GI LDRKVL+D+A+     F  + E ++S L
Sbjct: 61  WIVRINAAARINGLSYSRFMNGLLKCGITLDRKVLADIAVHDPAGFTALAEKAKSIL 117


>gi|218296411|ref|ZP_03497154.1| ribosomal protein L20 [Thermus aquaticus Y51MC23]
 gi|218243205|gb|EED09736.1| ribosomal protein L20 [Thermus aquaticus Y51MC23]
          Length = 118

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 83/115 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K GVV   +HKK+LK AKG++G R  + R A+  +  +  YAYRDR+ +KR+FR L
Sbjct: 1   MPRAKTGVVRRRRHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYRDRKARKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R + LNYS F+NGL KAGI LDRKVL+DLA+ +  +F ++V+ +++
Sbjct: 61  WIVRINAACRQHGLNYSSFMNGLKKAGIELDRKVLADLAVREPQAFAELVQKAKA 115


>gi|78044004|ref|YP_360405.1| 50S ribosomal protein L20 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|109893103|sp|Q3ABS9|RL20_CARHZ RecName: Full=50S ribosomal protein L20
 gi|77996119|gb|ABB15018.1| ribosomal protein L20 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 117

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  VVS  +HKK+LK AKG++G +    R AK  V +S  YAYRDRR +KR+FR L
Sbjct: 1   MPRAKSSVVSRKRHKKILKLAKGYFGAKSKLFRVAKQQVMKSLMYAYRDRRARKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R++ L YS+ +NGL KAG+ ++RK+L+DLA+   ++F ++VE+++  L
Sbjct: 61  WITRINAAARMHGLTYSRMMNGLKKAGVEINRKMLADLAVNDKNAFAELVEIAKKNL 117


>gi|303325496|ref|ZP_07355939.1| ribosomal protein L20 [Desulfovibrio sp. 3_1_syn3]
 gi|302863412|gb|EFL86343.1| ribosomal protein L20 [Desulfovibrio sp. 3_1_syn3]
          Length = 117

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ S  +HKK L +AKGF G R    R A+ AV+RS QYA+  R+ +KRDFR+LWI
Sbjct: 2   RVKRGLASHRRHKKYLSAAKGFRGGRSRLYRTAREAVERSLQYAFVGRKNRKRDFRTLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R+  L+YS+F++GL  AGI L+RKVL+DLA+ Q D F K+VEL+++ L
Sbjct: 62  LRINAGARLSGLSYSRFMHGLKLAGIELNRKVLADLAVYQKDDFAKVVELAKAAL 116


>gi|330994702|ref|ZP_08318625.1| 50S ribosomal protein L20 [Gluconacetobacter sp. SXCC-1]
 gi|329758343|gb|EGG74864.1| 50S ribosomal protein L20 [Gluconacetobacter sp. SXCC-1]
          Length = 115

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (74%)

Query: 4   VKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQ 63
           +KRGV + A+HKKVL+ +KGF GR     R A   +++S QYAYRDRR KKR+FR+LWIQ
Sbjct: 1   MKRGVTTHARHKKVLELSKGFRGRSSTNYRIALERLEKSLQYAYRDRRNKKREFRALWIQ 60

Query: 64  RINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           RINAAVR + L YS+FINGL KAGI +DRKVL+ +A     +F +IV+ +++ L
Sbjct: 61  RINAAVREHGLTYSRFINGLDKAGIEIDRKVLAAIAYDDAATFAEIVKKAQAAL 114


>gi|91205680|ref|YP_538035.1| 50S ribosomal protein L20 [Rickettsia bellii RML369-C]
 gi|157826862|ref|YP_001495926.1| 50S ribosomal protein L20 [Rickettsia bellii OSU 85-389]
 gi|109893148|sp|Q1RI68|RL20_RICBR RecName: Full=50S ribosomal protein L20
 gi|166220737|sp|A8GVL2|RL20_RICB8 RecName: Full=50S ribosomal protein L20
 gi|91069224|gb|ABE04946.1| 50S ribosomal protein L20 [Rickettsia bellii RML369-C]
 gi|157802166|gb|ABV78889.1| 50S ribosomal protein L20 [Rickettsia bellii OSU 85-389]
          Length = 117

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR     R A   V++  QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRASTCFRVAIEKVEKGLQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L KA I +DRKVL++LA+   + F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKAEIDIDRKVLAELAVNNNEEFASIVEQAKAHI 117


>gi|239948220|ref|ZP_04699973.1| ribosomal protein L20 [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922496|gb|EER22520.1| ribosomal protein L20 [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 117

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AK + GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKSYRGRANSCFRIAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQFI  L KA I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFIGALKKAEIDIDRKVLAELAVNNSDGFASIVEQAKAHI 117


>gi|270158048|ref|ZP_06186705.1| 50S ribosomal protein L20 [Legionella longbeachae D-4968]
 gi|289163684|ref|YP_003453822.1| 50S ribosomal protein L20 [Legionella longbeachae NSW150]
 gi|269990073|gb|EEZ96327.1| 50S ribosomal protein L20 [Legionella longbeachae D-4968]
 gi|288856857|emb|CBJ10668.1| 50S ribosomal protein L20 [Legionella longbeachae NSW150]
          Length = 119

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKV+  AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVIAKARHKKVMDQAKGYYGARSRTYRMAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINA  R   L+YS+ I+GL KA I LDRKVL+DLA+    +F
Sbjct: 61  WITRINAQARECGLSYSRLIDGLKKASIELDRKVLADLAVHDKVAF 106


>gi|154174891|ref|YP_001407370.1| 50S ribosomal protein L20 [Campylobacter curvus 525.92]
 gi|166219624|sp|A7GVX8|RL20_CAMC5 RecName: Full=50S ribosomal protein L20
 gi|112802360|gb|EAT99704.1| ribosomal protein L20 [Campylobacter curvus 525.92]
          Length = 118

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GF+  R    R AK  ++RS  YAYRDRR KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFFSARHKHFRKAKEQLERSLVYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ DL+YS+F+NGL KA I LDRK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIVRINAACRLNDLSYSRFMNGLKKANIELDRKILADLAMNDAKAFAALAKQAKDAL 117


>gi|58584914|ref|YP_198487.1| 50S ribosomal protein L20 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|81311613|sp|Q5GRX9|RL20_WOLTR RecName: Full=50S ribosomal protein L20
 gi|58419230|gb|AAW71245.1| Ribosomal protein L20 [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 121

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GR K+  R A   V+++ QYAYRDRR +KRDFRSL
Sbjct: 1   MARVKRGVTTHARHKKILNLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRNRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L Y +F++GL  AG+ L+RK+L+++A+   D F K+ E   S+L
Sbjct: 61  WIIRINAAAREHGLTYGRFMHGLALAGVDLNRKILAEMAVNYKDDFTKLAETVSSKL 117


>gi|189501975|ref|YP_001957692.1| 50S ribosomal protein L20 [Candidatus Amoebophilus asiaticus 5a2]
 gi|226730349|sp|B3ERW1|RL20_AMOA5 RecName: Full=50S ribosomal protein L20
 gi|189497416|gb|ACE05963.1| hypothetical protein Aasi_0562 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 114

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 83/111 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ K+V+K AKG++GRRKN    AK AV+R+ QYAYRDR+ KKR+FR L
Sbjct: 1   MPRSVNAVASRARRKRVIKLAKGYWGRRKNAWTIAKNAVERALQYAYRDRKAKKREFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA ++  L+YSQF+  L  +GI L+RKVL+DLA+   ++FK+I++
Sbjct: 61  WIQRINAAAKMNGLSYSQFMGKLAASGIELNRKVLADLAMNNPEAFKEILK 111


>gi|82523879|emb|CAI78602.1| Ribosomal protein L20 [uncultured delta proteobacterium]
          Length = 115

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V S  + K++LK AKG+ G R   IR A  +V+R+  YAYRDR+ KKRDFR L
Sbjct: 2   MPRVKNAVSSRKRRKRILKLAKGYRGARSKLIRIATESVNRALNYAYRDRKAKKRDFRRL 61

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R+ +++YS+ INGL KA I LDRKVLS+LAI+  + F +IV L+R
Sbjct: 62  WIIRINAAARMNNISYSKLINGLKKANIELDRKVLSELAISDPNGFSEIVALAR 115


>gi|85059399|ref|YP_455101.1| 50S ribosomal protein L20 [Sodalis glossinidius str. 'morsitans']
 gi|109893154|sp|Q2NT29|RL20_SODGM RecName: Full=50S ribosomal protein L20
 gi|84779919|dbj|BAE74696.1| 50S ribosomal protein L20 [Sodalis glossinidius str. 'morsitans']
          Length = 118

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  + + ++  L+
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASIEIDRKILADIAVFDKVAFAALADKAKGDLV 118


>gi|332878708|ref|ZP_08446425.1| ribosomal protein L20 [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332683345|gb|EGJ56225.1| ribosomal protein L20 [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 114

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KK++K AKGF+GRRKN    AK AV+++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRSVNAVARRARRKKIMKQAKGFFGRRKNVWTVAKNAVEKAMQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ L+YSQF+  L  A I L+RKVL+DLA+   ++FK IVE
Sbjct: 61  WIVRINAGARLHGLSYSQFMGKLKAANIELNRKVLADLAMNHAEAFKAIVE 111


>gi|238650657|ref|YP_002916509.1| 50S ribosomal protein L20 [Rickettsia peacockii str. Rustic]
 gi|259646198|sp|C4K1L0|RL20_RICPU RecName: Full=50S ribosomal protein L20
 gi|238624755|gb|ACR47461.1| 50S ribosomal protein L20 [Rickettsia peacockii str. Rustic]
          Length = 117

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKFAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L K  I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKTEIDIDRKVLAELAVNNSDGFVSIVEKAKAHI 117


>gi|15892858|ref|NP_360572.1| 50S ribosomal protein L20 [Rickettsia conorii str. Malish 7]
 gi|34581432|ref|ZP_00142912.1| 50S ribosomal protein L20 [Rickettsia sibirica 246]
 gi|229586952|ref|YP_002845453.1| 50S ribosomal protein L20 [Rickettsia africae ESF-5]
 gi|20139545|sp|Q92H37|RL20_RICCN RecName: Full=50S ribosomal protein L20
 gi|259646197|sp|C3PP50|RL20_RICAE RecName: Full=50S ribosomal protein L20
 gi|15620045|gb|AAL03473.1| 50S ribosomal protein L20 [Rickettsia conorii str. Malish 7]
 gi|28262817|gb|EAA26321.1| 50S ribosomal protein L20 [Rickettsia sibirica 246]
 gi|228022002|gb|ACP53710.1| 50S ribosomal protein L20 [Rickettsia africae ESF-5]
          Length = 117

 Score =  124 bits (311), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L K  I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKTEIDIDRKVLAELAVNNSDGFVSIVEKAKAHI 117


>gi|282859089|ref|ZP_06268220.1| ribosomal protein L20 [Prevotella bivia JCVIHMP010]
 gi|282588119|gb|EFB93293.1| ribosomal protein L20 [Prevotella bivia JCVIHMP010]
          Length = 114

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  K+LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTKILKKTKGYYGARKNVWTVAKNTYEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+YD++YSQ +  LHK GI ++RKVL+DLA    ++FK IV+
Sbjct: 61  WIQRINAAARLYDMSYSQLMGALHKNGIEINRKVLADLAANNQEAFKAIVD 111


>gi|296532252|ref|ZP_06894996.1| 50S ribosomal protein L20 [Roseomonas cervicalis ATCC 49957]
 gi|296267422|gb|EFH13303.1| 50S ribosomal protein L20 [Roseomonas cervicalis ATCC 49957]
          Length = 123

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+ GR     R A   V+++ QYAYRDRRVKKR+FR L
Sbjct: 1   MARVKRGVAAHARHKKVLKLAKGYVGRSSKAYRPALERVEKALQYAYRDRRVKKREFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R + L YS+FI GL  A I LDRKVL+ +A     +F  +VE +++ L
Sbjct: 61  WIQRINAATREHGLTYSKFIAGLKAANIELDRKVLAAIAFEDAAAFGALVEKAKAAL 117


>gi|300726432|ref|ZP_07059880.1| ribosomal protein L20 [Prevotella bryantii B14]
 gi|299776280|gb|EFI72842.1| ribosomal protein L20 [Prevotella bryantii B14]
          Length = 114

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K +LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKNILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+ +++YSQ +  LHKAGI ++RKVL+DLA+   ++FK IVE
Sbjct: 61  WIQRINAAARLENMSYSQLMGALHKAGIEINRKVLADLAMNNPEAFKAIVE 111


>gi|27904625|ref|NP_777751.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|31076929|sp|Q89AV8|RL20_BUCBP RecName: Full=50S ribosomal protein L20
 gi|27904022|gb|AAO26856.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 126

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M  VKRGV++ A+HKKVLK AKG+YG R  T R A+ A+ ++ QY+YRDRR +KR FR L
Sbjct: 1   MAHVKRGVIARARHKKVLKQAKGYYGARSRTYRTARQAIIKAGQYSYRDRRQRKRYFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   ++YS+F+ GL KA I +DRK+LS+LAI    SF  +++ S+  L
Sbjct: 61  WITRINAAVRENQISYSKFMYGLKKASIAVDRKMLSELAIFDNVSFCSLIKSSKDAL 117


>gi|312129889|ref|YP_003997229.1| lsu ribosomal protein l20p [Leadbetterella byssophila DSM 17132]
 gi|311906435|gb|ADQ16876.1| LSU ribosomal protein L20P [Leadbetterella byssophila DSM 17132]
          Length = 114

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK AKG++GRRKN    AK AV++   YAY  R+ KKR+FRSL
Sbjct: 1   MPRSVNHVASRARRKKVLKLAKGYFGRRKNVWTVAKNAVEKGLVYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA VR Y L+YS FIN + KAGI L+RKVL+DLA+   D+FK IVE
Sbjct: 61  WIVRINAGVRPYGLSYSVFINKVQKAGIELNRKVLADLALNHPDAFKAIVE 111


>gi|148654114|ref|YP_001281207.1| 50S ribosomal protein L20 [Psychrobacter sp. PRwf-1]
 gi|172048591|sp|A5WHW6|RL20_PSYWF RecName: Full=50S ribosomal protein L20
 gi|148573198|gb|ABQ95257.1| LSU ribosomal protein L20P [Psychrobacter sp. PRwf-1]
 gi|332975688|gb|EGK12573.1| inorganic pyrophosphatase [Psychrobacter sp. 1501(2011)]
          Length = 118

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV ++ +HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQANRRHKKILKRAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRNKKRTFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+FINGL KA I +DR+VL+D+A+    +F  + E +++ L
Sbjct: 61  WIARINAGARLNGLSYSRFINGLKKANIEIDRRVLADIAMHDAAAFTALTEKAKAAL 117


>gi|319786724|ref|YP_004146199.1| ribosomal protein L20 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465236|gb|ADV26968.1| ribosomal protein L20 [Pseudoxanthomonas suwonensis 11-1]
          Length = 119

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++ QYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILDQAKGYYNARRKVYRVAKQAVIKAGQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KAGI LDRKVL+D+A+     F  + E ++S L
Sbjct: 61  WITRINAAARANGISYSRFINGLLKAGITLDRKVLADIAVHDAAGFTALAEKAKSAL 117


>gi|71275164|ref|ZP_00651451.1| Ribosomal protein L20, bacterial and organelle form [Xylella
           fastidiosa Dixon]
 gi|71898245|ref|ZP_00680419.1| Ribosomal protein L20, bacterial and organelle form [Xylella
           fastidiosa Ann-1]
 gi|170731155|ref|YP_001776588.1| 50S ribosomal protein L20 [Xylella fastidiosa M12]
 gi|226730478|sp|B0U5E0|RL20_XYLFM RecName: Full=50S ribosomal protein L20
 gi|71163973|gb|EAO13688.1| Ribosomal protein L20, bacterial and organelle form [Xylella
           fastidiosa Dixon]
 gi|71731984|gb|EAO34041.1| Ribosomal protein L20, bacterial and organelle form [Xylella
           fastidiosa Ann-1]
 gi|167965948|gb|ACA12958.1| 50S ribosomal protein L20 [Xylella fastidiosa M12]
          Length = 119

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILSLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NG+ K GI LDRK+L+D+A+     F  + E ++S L
Sbjct: 61  WIVRINAAARINGLSYSRFMNGILKCGITLDRKMLADIAVHDPAGFTALAEKAKSML 117


>gi|119385005|ref|YP_916061.1| 50S ribosomal protein L20 [Paracoccus denitrificans PD1222]
 gi|166219673|sp|A1B4C1|RL20_PARDP RecName: Full=50S ribosomal protein L20
 gi|119374772|gb|ABL70365.1| LSU ribosomal protein L20P [Paracoccus denitrificans PD1222]
          Length = 119

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 61/106 (57%), Positives = 79/106 (74%), Gaps = 2/106 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G ++ A+HKKVL +AKG+YG R    R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MARVKSGKITHARHKKVLDAAKGYYGNRSRNFRTATQAVDKANQYATRDRKTRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLD 104
           WIQRINAAVR  D  + YS+FI  L KAGI +DRKVL+DLA+ + +
Sbjct: 61  WIQRINAAVRAVDAEMTYSRFIAALAKAGIEVDRKVLADLAVHEPE 106


>gi|290968294|ref|ZP_06559836.1| ribosomal protein L20 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781653|gb|EFD94239.1| ribosomal protein L20 [Megasphaera genomosp. type_1 str. 28L]
          Length = 116

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 86/116 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K GV + A+HKK++K AKG+ G R    + A  +V ++  YA RDRRVKKR+FR L
Sbjct: 1   MARIKVGVTAHARHKKIIKMAKGYRGTRSRLFKKANESVMKALFYARRDRRVKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA RV+ L+YS+FI GL KAG+ +DRK+L+DLA+    +F K+VE+++++
Sbjct: 61  WIARINAATRVHGLSYSRFICGLTKAGVAVDRKMLADLAVNDAAAFAKLVEVAKAQ 116


>gi|15807000|ref|NP_295727.1| 50S ribosomal protein L20 [Deinococcus radiodurans R1]
 gi|14195154|sp|Q9RSW7|RL20_DEIRA RecName: Full=50S ribosomal protein L20
 gi|28948934|pdb|1NKW|O Chain O, Crystal Structure Of The Large Ribosomal Subunit From
           Deinococcus Radiodurans
 gi|29726802|pdb|1NWX|O Chain O, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Abt-773
 gi|29726833|pdb|1NWY|O Chain O, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Azithromycin
 gi|51247387|pdb|1SM1|O Chain O, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Quinupristin And Dalfopristin
 gi|61680350|pdb|1XBP|O Chain O, Inhibition Of Peptide Bond Formation By Pleuromutilins:
           The Structure Of The 50s Ribosomal Subunit From
           Deinococcus Radiodurans In Complex With Tiamulin
 gi|66361042|pdb|1YL3|1 Chain 1, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. Large Subunit. The Coordinates For The Small
           Subunit Are In The Pdb Entry 1yl4.
 gi|88192277|pdb|2B66|U Chain U, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf1, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400
 gi|88192340|pdb|2B9N|U Chain U, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf2, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400.
 gi|88192395|pdb|2B9P|U Chain U, 50s Ribosomal Subunit From A Crystal Structure Of The
           Ribosome In Complex With Trnas And Mrna With A Stop
           Codon In The A-Site. This File Contains The 50s Subunit
           From A Crystal Structure Of The Ribosome In Complex With
           Trnas And Mrna With A Stop Codon In The A-Site And Is
           Described In Remark 400.
 gi|190613503|pdb|2ZJP|N Chain N, Thiopeptide Antibiotic Nosiheptide Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 gi|190613533|pdb|2ZJQ|N Chain N, Interaction Of L7 With L11 Induced By Microccocin Binding
           To The Deinococcus Radiodurans 50s Subunit
 gi|190613564|pdb|2ZJR|N Chain N, Refined Native Structure Of The Large Ribosomal Subunit
           (50s) From Deinococcus Radiodurans
 gi|190613671|pdb|3CF5|N Chain N, Thiopeptide Antibiotic Thiostrepton Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 gi|203282470|pdb|3DLL|N Chain N, The Oxazolidinone Antibiotics Perturb The Ribosomal
           Peptidyl-Transferase Center And Effect Trna Positioning
 gi|323714554|pdb|3PIO|N Chain N, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
 gi|323714584|pdb|3PIP|N Chain N, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
 gi|6459792|gb|AAF11553.1|AE002038_2 ribosomal protein L20 [Deinococcus radiodurans R1]
          Length = 118

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 80/115 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G+V   +HKKVLK AKGF+G R    R A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MPRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINA  R++ +NYS FINGL +A I L+RKVL+D+A  + ++FK +V+ SR+
Sbjct: 61  WIQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAREPEAFKALVDASRN 115


>gi|86131539|ref|ZP_01050137.1| 50S ribosomal protein L20 [Dokdonia donghaensis MED134]
 gi|85817984|gb|EAQ39152.1| 50S ribosomal protein L20 [Dokdonia donghaensis MED134]
          Length = 114

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKV+K AKG++GRRKN    AK AVD++  YAYRDRR KKR+FRSL
Sbjct: 1   MPRSVNSVAKRARRKKVMKQAKGYFGRRKNVWTVAKNAVDKAMSYAYRDRRQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YSQF+ G+   GI L+RKVL+DLA+   ++F+ I+ 
Sbjct: 61  WITRINAGARMHGMSYSQFMGGVKANGIELNRKVLADLAMNHPEAFEAIIN 111


>gi|323344266|ref|ZP_08084492.1| 50S ribosomal protein L20 [Prevotella oralis ATCC 33269]
 gi|323094995|gb|EFZ37570.1| 50S ribosomal protein L20 [Prevotella oralis ATCC 33269]
          Length = 114

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  KG+YG RKN    AK   ++   YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNHVASKAKRKRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+ D++YSQ +  LHKAGI ++RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAAARLQDMSYSQLMGALHKAGIEINRKVLADLAVNNPEAFKAIVD 111


>gi|110834700|ref|YP_693559.1| 50S ribosomal protein L20 [Alcanivorax borkumensis SK2]
 gi|254429610|ref|ZP_05043317.1| ribosomal protein L20 [Alcanivorax sp. DG881]
 gi|123050398|sp|Q0VNG1|RL20_ALCBS RecName: Full=50S ribosomal protein L20
 gi|110647811|emb|CAL17287.1| 50S ribosomal protein L20 [Alcanivorax borkumensis SK2]
 gi|196195779|gb|EDX90738.1| ribosomal protein L20 [Alcanivorax sp. DG881]
          Length = 119

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R A  AV ++ QYAYRDR+V+KR FR L
Sbjct: 1   MARVKRGVQARRRHKKILKQAKGYYGARSRVFRVAVQAVTKAGQYAYRDRKVRKRQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ INGL KA I +DRKVL+D+A+    +F  + E +++ L
Sbjct: 61  WIVRINAAARLNGLSYSRLINGLKKASIDIDRKVLADIAVRDQATFSALAEKAKASL 117


>gi|213963355|ref|ZP_03391611.1| ribosomal protein L20 [Capnocytophaga sputigena Capno]
 gi|256819832|ref|YP_003141111.1| ribosomal protein L20 [Capnocytophaga ochracea DSM 7271]
 gi|315225231|ref|ZP_07867048.1| 50S ribosomal protein L20 [Capnocytophaga ochracea F0287]
 gi|213954023|gb|EEB65349.1| ribosomal protein L20 [Capnocytophaga sputigena Capno]
 gi|256581415|gb|ACU92550.1| ribosomal protein L20 [Capnocytophaga ochracea DSM 7271]
 gi|314944914|gb|EFS96946.1| 50S ribosomal protein L20 [Capnocytophaga ochracea F0287]
          Length = 114

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KK++K AKGF+GRRKN    AK AV+++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRSVNAVARRARRKKIMKQAKGFFGRRKNVWTVAKNAVEKAMQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ L+YSQF+  L  A I L+RKVL+DLA+   ++FK IVE
Sbjct: 61  WIVRINAGARLHGLSYSQFMGKLKAADIQLNRKVLADLAMNHPEAFKAIVE 111


>gi|325287302|ref|YP_004263092.1| 50S ribosomal protein L20 [Cellulophaga lytica DSM 7489]
 gi|324322756|gb|ADY30221.1| 50S ribosomal protein L20 [Cellulophaga lytica DSM 7489]
          Length = 114

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 80/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV+++ QYAYRDRRVKKR+FR+L
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVEKAMQYAYRDRRVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YSQF+  +    I L+RKVL+DLA+   ++FK IV 
Sbjct: 61  WITRINAGARLHGMSYSQFMGKVKANNIELNRKVLADLAMNHPEAFKAIVN 111


>gi|261855916|ref|YP_003263199.1| ribosomal protein L20 [Halothiobacillus neapolitanus c2]
 gi|261836385|gb|ACX96152.1| ribosomal protein L20 [Halothiobacillus neapolitanus c2]
          Length = 119

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 75/100 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL  AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVNARAKHKKVLDKAKGYYGARSRTFRVAHQAVVKAGQYAYRDRRAKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           WI RINA  R  +L+YS+ + G+HKA I +DRKVL+DLA+
Sbjct: 61  WITRINAEARNNELSYSRLMEGIHKANIEIDRKVLADLAV 100


>gi|332798667|ref|YP_004460166.1| 50S ribosomal protein L20 [Tepidanaerobacter sp. Re1]
 gi|332696402|gb|AEE90859.1| 50S ribosomal protein L20 [Tepidanaerobacter sp. Re1]
          Length = 118

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 85/115 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+GV +  KHKKV+K AKG+ G +    R A  AV ++Q +AYR R++KKRDFR L
Sbjct: 1   MARVKKGVTARKKHKKVIKLAKGYRGSKSKLFRPANQAVLKAQSHAYRGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R   ++YS+FINGL KAG+ ++RK+LS++AI   + F ++V+++++
Sbjct: 61  WIARINAAARSNGISYSKFINGLKKAGVQINRKMLSEMAINDANGFTQLVDIAKA 115


>gi|319942326|ref|ZP_08016641.1| 50S ribosomal protein L20 [Sutterella wadsworthensis 3_1_45B]
 gi|319804199|gb|EFW01099.1| 50S ribosomal protein L20 [Sutterella wadsworthensis 3_1_45B]
          Length = 116

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 76/110 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+   +KG+  RR N  R AK AV R+ QYAYRDRR KK  FR L
Sbjct: 1   MPRVKRGVTARARHKKIFTLSKGYRLRRNNVFRVAKQAVMRAGQYAYRDRRDKKHVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINA  R   L+YS F+NGL KAGI LDRKVL+D+A+   D F  +V
Sbjct: 61  WIARINAGSRANGLSYSVFMNGLKKAGIALDRKVLADMAVNDKDGFAALV 110


>gi|220928738|ref|YP_002505647.1| 50S ribosomal protein L20 [Clostridium cellulolyticum H10]
 gi|254800312|sp|B8I169|RL20_CLOCE RecName: Full=50S ribosomal protein L20
 gi|219999066|gb|ACL75667.1| ribosomal protein L20 [Clostridium cellulolyticum H10]
          Length = 117

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V + A+HKK+LK AKG++G +    R A  AV +S  YAY DRR KKRDFR L
Sbjct: 1   MARVKGAVRTRARHKKILKLAKGYFGAKSKLFRMANQAVMKSLNYAYNDRRAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+  L YS+FI+GL K+GI L+RKVL+DLA+    +F ++ E +++
Sbjct: 61  WIARINAAARINGLTYSRFISGLRKSGIELNRKVLADLAVNDAAAFAQLAETAKA 115


>gi|23099605|ref|NP_693071.1| 50S ribosomal protein L20 [Oceanobacillus iheyensis HTE831]
 gi|31563139|sp|Q8EPF7|RL20_OCEIH RecName: Full=50S ribosomal protein L20
 gi|22777835|dbj|BAC14106.1| 50S ribosomal protein L20 [Oceanobacillus iheyensis HTE831]
          Length = 118

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+VLK AKG+YG ++   + AK  V +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKRVLKLAKGYYGSKRTLFKTAKQQVIKSGQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R++DL+YS+ ++GL  AGI ++RK+LSDLAI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARMHDLSYSKLMHGLKVAGIDINRKMLSDLAISDEKAFAQLVSQAKEAL 117


>gi|331269139|ref|YP_004395631.1| 50S ribosomal protein L20 [Clostridium botulinum BKT015925]
 gi|329125689|gb|AEB75634.1| ribosomal protein L20 [Clostridium botulinum BKT015925]
          Length = 119

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  KHKK+LK AKG+YGRR  T R A   V R+  +AY  R++KKRDFR L
Sbjct: 1   MARVKRAIHARKKHKKILKLAKGYYGRRSRTFRNANETVLRAMNFAYVGRKLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL  AGI ++RK+LS++AI    +F  +VE+++ +L
Sbjct: 61  WIARINAATRMNGLSYSRFMNGLKLAGINMNRKMLSEIAINDEKAFADLVEVAKKQL 117


>gi|296133378|ref|YP_003640625.1| ribosomal protein L20 [Thermincola sp. JR]
 gi|296031956|gb|ADG82724.1| ribosomal protein L20 [Thermincola potens JR]
          Length = 119

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  +HKK+LK AKG+ G +    R A   V +S  YAYRDRR KKR+FR L
Sbjct: 1   MPRVKGGVTTRKRHKKILKLAKGYRGAKSKLFRPANEQVLKSLAYAYRDRRTKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+ INGL KAGI ++RK+L+DLA+    +F K+VE +++++
Sbjct: 61  WIARINAAARINGISYSKLINGLKKAGIEVNRKMLADLAVNDQQAFGKLVEAAKAKV 117


>gi|253682029|ref|ZP_04862826.1| ribosomal protein L20 [Clostridium botulinum D str. 1873]
 gi|253561741|gb|EES91193.1| ribosomal protein L20 [Clostridium botulinum D str. 1873]
          Length = 119

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  KHKK+LK AKG+YGRR  T R A   V R+  +AY  R++KKRDFR L
Sbjct: 1   MARVKRAIHARKKHKKILKLAKGYYGRRSRTFRNANETVLRAMNFAYVGRKLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL  AGI ++RK+LS++AI    +F  +VE+++ +L
Sbjct: 61  WIARINAAARMNGLSYSRFMNGLKLAGINMNRKMLSEIAINDEKAFTDLVEVAKKQL 117


>gi|307721929|ref|YP_003893069.1| 50S ribosomal protein L20P [Sulfurimonas autotrophica DSM 16294]
 gi|306980022|gb|ADN10057.1| LSU ribosomal protein L20P [Sulfurimonas autotrophica DSM 16294]
          Length = 119

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKK+LK AKGFY  R+   R AK  ++RS  YA+RDR+ KKR+FR L
Sbjct: 1   MPRVKTGVVRRRRHKKILKLAKGFYSGRRKHFRKAKEQIERSLMYAFRDRKQKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  +NYS F+NGLHK+GI LDRK+L+D+A+    +F  +V+ S++ L
Sbjct: 61  WIIRINAAARLNGMNYSTFMNGLHKSGIELDRKILADMAMNDAAAFTAVVDASKAAL 117


>gi|326201565|ref|ZP_08191436.1| ribosomal protein L20 [Clostridium papyrosolvens DSM 2782]
 gi|325988165|gb|EGD48990.1| ribosomal protein L20 [Clostridium papyrosolvens DSM 2782]
          Length = 117

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V + A+HKK+LK AKG++G +    R A  AV +S  YA+ DRR KKRDFR L
Sbjct: 1   MARVKGAVRTRARHKKILKLAKGYFGAKSKLYRMANQAVMKSLNYAFNDRRAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+  L+YS+FI+GL K+GI L+RKVL+DLA+    +F K+ E +++
Sbjct: 61  WIARINAAARINGLSYSKFISGLKKSGIELNRKVLADLAVNDAAAFAKLAETAKA 115


>gi|309389090|gb|ADO76970.1| LSU ribosomal protein L20P [Halanaerobium praevalens DSM 2228]
          Length = 119

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  + KKVLK AKG++G R    R A  AV +S  YAYRDRR KKR FR L
Sbjct: 1   MPRVKRGNKARKRRKKVLKMAKGYFGSRSKLYRPANQAVMKSLHYAYRDRRNKKRTFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL +A + +DRK+L+DLA+   D F  +V+L++ +L
Sbjct: 61  WITRINAAARNEGLSYSRFINGLRQANVEIDRKMLADLAVNDSDGFANLVDLAKEKL 117


>gi|52842918|ref|YP_096717.1| 50S ribosomal protein L20 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54295553|ref|YP_127968.1| 50S ribosomal protein L20 [Legionella pneumophila str. Lens]
 gi|54298703|ref|YP_125072.1| 50S ribosomal protein L20 [Legionella pneumophila str. Paris]
 gi|148358551|ref|YP_001249758.1| 50S ribosomal protein L20 [Legionella pneumophila str. Corby]
 gi|296108360|ref|YP_003620061.1| large subunit ribosomal protein L20 [Legionella pneumophila 2300/99
           Alcoy]
 gi|81822306|sp|Q5WT85|RL20_LEGPL RecName: Full=50S ribosomal protein L20
 gi|81822499|sp|Q5X1H6|RL20_LEGPA RecName: Full=50S ribosomal protein L20
 gi|81823336|sp|Q5ZS07|RL20_LEGPH RecName: Full=50S ribosomal protein L20
 gi|166219657|sp|A5IAL2|RL20_LEGPC RecName: Full=50S ribosomal protein L20
 gi|52630029|gb|AAU28770.1| 50S ribosomal protein L20 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53752488|emb|CAH13920.1| 50S ribosomal protein L20 [Legionella pneumophila str. Paris]
 gi|53755385|emb|CAH16881.1| 50S ribosomal protein L20 [Legionella pneumophila str. Lens]
 gi|148280324|gb|ABQ54412.1| 50S ribosomal protein L20 [Legionella pneumophila str. Corby]
 gi|295650262|gb|ADG26109.1| large subunit ribosomal protein L20 [Legionella pneumophila 2300/99
           Alcoy]
 gi|307611589|emb|CBX01271.1| 50S ribosomal protein L20 [Legionella pneumophila 130b]
          Length = 119

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTAKARHKKILDQAKGYYGARSRTYRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINA  R   L+YS+ I+GL KA I LDRK+L+D+A+    +F
Sbjct: 61  WITRINAQARECGLSYSRLIDGLKKASIELDRKILADMAVHDKVAF 106


>gi|325919875|ref|ZP_08181865.1| LSU ribosomal protein L20P [Xanthomonas gardneri ATCC 19865]
 gi|325549659|gb|EGD20523.1| LSU ribosomal protein L20P [Xanthomonas gardneri ATCC 19865]
          Length = 119

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR FR+L
Sbjct: 1   MARVKRGVQARRRHKKILNLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NG+ KAGI LDRKVL+D+A+     F  + E ++  L
Sbjct: 61  WITRINAAARINGLSYSRFMNGMLKAGITLDRKVLADIAVHDAAGFAALAEKAKGAL 117


>gi|157736345|ref|YP_001489028.1| 50S ribosomal protein L20 [Arcobacter butzleri RM4018]
 gi|315635480|ref|ZP_07890746.1| 50S ribosomal protein L20 [Arcobacter butzleri JV22]
 gi|166984656|sp|A8EQY5|RL20_ARCB4 RecName: Full=50S ribosomal protein L20
 gi|157698199|gb|ABV66359.1| 50S ribosomal protein L20 [Arcobacter butzleri RM4018]
 gi|315480238|gb|EFU70905.1| 50S ribosomal protein L20 [Arcobacter butzleri JV22]
          Length = 118

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK+A+GF+  R+   R AK  ++RS  YA+RDRR KKRD R L
Sbjct: 1   MPRVKTGVVRRRRHKKVLKAARGFFSGRRKHFRKAKEQLERSLVYAFRDRRQKKRDIRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D+NYS+F+NGL  +G+ LDRK+L+D+A+    +F  +V  +++ L
Sbjct: 61  WIIRINAACRLNDINYSRFMNGLKLSGLELDRKILADMAMNDSAAFASLVATAKAAL 117


>gi|288940718|ref|YP_003442958.1| 50S ribosomal protein L20 [Allochromatium vinosum DSM 180]
 gi|288896090|gb|ADC61926.1| ribosomal protein L20 [Allochromatium vinosum DSM 180]
          Length = 118

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/99 (60%), Positives = 77/99 (77%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVKRGV + A+HKK+L+ AKG+YG R    R AK AV ++ QYAYRDRR KKR+FR+L
Sbjct: 1  MPRVKRGVTAHARHKKILEEAKGYYGARSKVFRVAKQAVIKAGQYAYRDRRQKKREFRAL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLA 99
          WI RINAA R   L+YS+ I+GL KAG+ +DRK+L+D+A
Sbjct: 61 WIARINAAARDNGLSYSRLIDGLKKAGVEVDRKMLADIA 99


>gi|71894618|ref|YP_278726.1| 50S ribosomal protein L20 [Mycoplasma synoviae 53]
 gi|109893125|sp|Q4A5F6|RL20_MYCS5 RecName: Full=50S ribosomal protein L20
 gi|71851406|gb|AAZ44015.1| 50S ribosomal protein L20 [Mycoplasma synoviae 53]
          Length = 116

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 86/116 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK AV +S  YA+RDR+  KR+FR L
Sbjct: 1   MARVKGGTVTRARRKKWIKLAKGYFGHKSVGYKVAKQAVVKSWTYAFRDRKQVKRNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAAVR + L+YSQFINGL KA ++++RK+LS+LAI Q  +F+K+V+L + +
Sbjct: 61  WIARINAAVRPHGLSYSQFINGLKKAEVLINRKMLSELAINQPQTFEKLVKLVQGK 116


>gi|257459997|ref|ZP_05625101.1| ribosomal protein L20 [Campylobacter gracilis RM3268]
 gi|257442438|gb|EEV17577.1| ribosomal protein L20 [Campylobacter gracilis RM3268]
          Length = 118

 Score =  122 bits (306), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 77/104 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +H KVLK A+GFY  R+   R AK  ++RS  YA+RDRR KKRDFR L
Sbjct: 1   MARVKTGIVRRRRHNKVLKLARGFYSARRKHFRKAKEQLERSLVYAFRDRRAKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLD 104
           WI RINAA R+ D++YS+FINGL KAGI LDRK+L+++A+   +
Sbjct: 61  WIVRINAACRLNDISYSKFINGLRKAGIELDRKILANMAMNDAE 104


>gi|148261905|ref|YP_001236032.1| 50S ribosomal protein L20 [Acidiphilium cryptum JF-5]
 gi|326405409|ref|YP_004285491.1| 50S ribosomal protein L20 [Acidiphilium multivorum AIU301]
 gi|166219599|sp|A5G2N1|RL20_ACICJ RecName: Full=50S ribosomal protein L20
 gi|146403586|gb|ABQ32113.1| LSU ribosomal protein L20P [Acidiphilium cryptum JF-5]
 gi|325052271|dbj|BAJ82609.1| 50S ribosomal protein L20 [Acidiphilium multivorum AIU301]
          Length = 118

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 79/115 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK +KGF GR     R A   ++++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTTHARHKKVLKQSKGFVGRSSTNYRIALERLEKALRYAYRDRRNKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAAVR   + YSQFI  L  A I LDRKVL+ +A      F  IVE +++
Sbjct: 61  WIQRINAAVREQGMTYSQFIAALKAANIELDRKVLAAMAFDDPAGFTAIVEAAKA 115


>gi|28199780|ref|NP_780094.1| 50S ribosomal protein L20 [Xylella fastidiosa Temecula1]
 gi|182682530|ref|YP_001830690.1| 50S ribosomal protein L20 [Xylella fastidiosa M23]
 gi|31563066|sp|Q87AB4|RL20_XYLFT RecName: Full=50S ribosomal protein L20
 gi|226730477|sp|B2I9P5|RL20_XYLF2 RecName: Full=50S ribosomal protein L20
 gi|28057901|gb|AAO29743.1| 50S ribosomal protein L20 [Xylella fastidiosa Temecula1]
 gi|182632640|gb|ACB93416.1| ribosomal protein L20 [Xylella fastidiosa M23]
 gi|307578808|gb|ADN62777.1| 50S ribosomal protein L20 [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 119

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILSLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NG+ K GI LDRK+L+D+A+     F  + E +++ L
Sbjct: 61  WIVRINAAARMNGLSYSRFMNGILKCGITLDRKMLADIAVHDPAGFTALAEKAKTML 117


>gi|323702720|ref|ZP_08114381.1| ribosomal protein L20 [Desulfotomaculum nigrificans DSM 574]
 gi|323532383|gb|EGB22261.1| ribosomal protein L20 [Desulfotomaculum nigrificans DSM 574]
          Length = 118

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  VVS  +H+K+LK AKG+ G R    R A  AV ++  YAYRDRR KKRDFR L
Sbjct: 1   MPRAKSSVVSRNRHRKILKLAKGYRGSRSKLYRVANQAVMKALFYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+FINGL KAG+ ++RK+L+DLA+    +F ++V++++S L
Sbjct: 61  WIARINAAARMNGMSYSKFINGLKKAGVEVNRKMLADLAVNDAQAFSQLVQVAKSNL 117


>gi|329904272|ref|ZP_08273744.1| LSU ribosomal protein L20p [Oxalobacteraceae bacterium IMCC9480]
 gi|327548049|gb|EGF32781.1| LSU ribosomal protein L20p [Oxalobacteraceae bacterium IMCC9480]
          Length = 102

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRR    R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLDQAKGYRGRRSKVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           WI RINAA R + + YS F+NGL +A I LDRKVL+D+A+
Sbjct: 61  WITRINAASREHGMTYSVFMNGLKRASIGLDRKVLADMAV 100


>gi|298530059|ref|ZP_07017461.1| ribosomal protein L20 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509433|gb|EFI33337.1| ribosomal protein L20 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 117

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 83/113 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG  ++ +HKK LK AKG+ G R      AK  V+R+  YAYRDRR KKRDFR LWI
Sbjct: 2   RVKRGKTANKRHKKYLKMAKGYRGSRSRLFYTAKETVERALCYAYRDRRQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
            RINAA R + ++YS+F++GL KAG+ L+RKVL+D+A+ +  +F ++ E++R+
Sbjct: 62  IRINAAAREHGMSYSRFMSGLSKAGVELNRKVLADMAVHEKAAFARLAEMART 114


>gi|124009346|ref|ZP_01694024.1| ribosomal protein L20 [Microscilla marina ATCC 23134]
 gi|123985008|gb|EAY24959.1| ribosomal protein L20 [Microscilla marina ATCC 23134]
          Length = 114

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK++K AKG++GRR N    AK A+++ + YAYRDR+VKKR+FR+L
Sbjct: 1   MPRSVNVVASRRRRKKMMKEAKGYFGRRSNVWTVAKNAIEKGRVYAYRDRKVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R++ L+YSQFI  LH A I L+RKVL+DLA+   ++FK +V+
Sbjct: 61  WIQRINAGARIHGLSYSQFIGKLHAADIELNRKVLADLAMNHPEAFKAVVD 111


>gi|284037107|ref|YP_003387037.1| ribosomal protein L20 [Spirosoma linguale DSM 74]
 gi|283816400|gb|ADB38238.1| ribosomal protein L20 [Spirosoma linguale DSM 74]
          Length = 114

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 80/110 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV++   Y+YRDRR KKRDFR+L
Sbjct: 1   MPRSVNHVASRARRKKVMKLAKGYFGRRKNVWTVAKNAVEKGLGYSYRDRRAKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINA  R++ ++YS F+  ++K+GI L+RKVL+DLA+   ++F  +V
Sbjct: 61  WIQRINAGARIHGMSYSAFMGAINKSGIELNRKVLADLAMNHPEAFAAVV 110


>gi|308183920|ref|YP_003928053.1| 50S ribosomal protein L20 [Helicobacter pylori SJM180]
 gi|308059840|gb|ADO01736.1| 50S ribosomal protein L20 [Helicobacter pylori SJM180]
 gi|317010404|gb|ADU84151.1| 50S ribosomal protein L20 [Helicobacter pylori SouthAfrica7]
 gi|317013547|gb|ADU80983.1| 50S ribosomal protein L20 [Helicobacter pylori Gambia94/24]
          Length = 116

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 81/109 (74%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R++D +YS+F++ L  A I LDRKVL+D+A+  + +FK ++E
Sbjct: 62  VRINAACRMHDTSYSRFMHALKVANIELDRKVLADMAMNDMQAFKSVLE 110


>gi|220903765|ref|YP_002479077.1| 50S ribosomal protein L20 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254800317|sp|B8J4E1|RL20_DESDA RecName: Full=50S ribosomal protein L20
 gi|219868064|gb|ACL48399.1| ribosomal protein L20 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 118

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+    +HKK L +AKGF G R    R A+ AV+RS QYAY  R+++KRDFR+LWI
Sbjct: 2   RVKRGLSGHRRHKKYLTAAKGFRGGRSRLYRTAREAVERSLQYAYVGRKLRKRDFRTLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R+  L+YS+F++GL  AGI L+RKVL+DLA+ + D F KIV+++++ L
Sbjct: 62  LRINAGARLSGLSYSRFMHGLKLAGIELNRKVLADLAVYKKDDFAKIVDMAKAAL 116


>gi|95930293|ref|ZP_01313031.1| ribosomal protein L20 [Desulfuromonas acetoxidans DSM 684]
 gi|95133756|gb|EAT15417.1| ribosomal protein L20 [Desulfuromonas acetoxidans DSM 684]
          Length = 118

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YAYRDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARRRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAYRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   LNYS+ ++GL +A + LDRKVL+++A+T   +F  +VE +++++
Sbjct: 61  WIARINAAARQNGLNYSRLVHGLKQAEVGLDRKVLAEIAVTDPAAFTAVVEKAKAQI 117


>gi|118580720|ref|YP_901970.1| 50S ribosomal protein L20 [Pelobacter propionicus DSM 2379]
 gi|166219674|sp|A1ARE2|RL20_PELPD RecName: Full=50S ribosomal protein L20
 gi|118503430|gb|ABK99912.1| LSU ribosomal protein L20P [Pelobacter propionicus DSM 2379]
          Length = 117

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/115 (54%), Positives = 82/115 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFRSL
Sbjct: 1   MARVKRGFKARRRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+  L+YS+FI GL KA + +DRKVL+D+A++    F +I  ++R+
Sbjct: 61  WITRINAASRLNGLSYSKFIFGLKKANVEIDRKVLADIAVSDPKGFSEIAGVARA 115


>gi|212704418|ref|ZP_03312546.1| hypothetical protein DESPIG_02473 [Desulfovibrio piger ATCC 29098]
 gi|212672139|gb|EEB32622.1| hypothetical protein DESPIG_02473 [Desulfovibrio piger ATCC 29098]
          Length = 116

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ +  +HKK L +AKGF G R    R A+ AV+RS QY++  R+ +KRDFR+LWI
Sbjct: 2   RVKRGLAAHRRHKKYLSAAKGFRGGRSRLYRTAREAVERSLQYSFIGRKHRKRDFRTLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R+  L+YS+ ++GL+KAGI L+RKVL+DLA+   D F K+VE++++ L
Sbjct: 62  LRINAGARLNGLSYSRLMHGLNKAGIALNRKVLADLAVYHKDDFAKVVEMAKAAL 116


>gi|116782437|gb|ABK22506.1| unknown [Picea sitchensis]
          Length = 125

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 77/100 (77%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           ++LK AKGF GR KN IR A+  V+++ QY+YRDRR KKRD R LWIQRINA  R++ +N
Sbjct: 5   QILKLAKGFRGRAKNCIRVARERVEKALQYSYRDRRNKKRDMRGLWIQRINAGTRLHGVN 64

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           Y QFI+GL K  I L+RKVLS+LA+ +  SFK +VE++R+
Sbjct: 65  YGQFIHGLTKENIQLNRKVLSELAMHEPYSFKSLVEIARN 104


>gi|120434966|ref|YP_860652.1| 50S ribosomal protein L20 [Gramella forsetii KT0803]
 gi|166219648|sp|A0LYZ0|RL20_GRAFK RecName: Full=50S ribosomal protein L20
 gi|117577116|emb|CAL65585.1| 50S ribosomal protein L20 [Gramella forsetii KT0803]
          Length = 114

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AVD++  YAYRDR+ KKR+FRSL
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGYFGRRKNVWTVAKNAVDKAMLYAYRDRKAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R   L+YSQF+  L  + I L+RKVL+DLA+   ++FK IVE
Sbjct: 61  WIMRINAAARQEGLSYSQFMGKLKTSDIGLNRKVLADLAMNSPEAFKAIVE 111


>gi|297623449|ref|YP_003704883.1| 50S ribosomal protein L20 [Truepera radiovictrix DSM 17093]
 gi|297164629|gb|ADI14340.1| ribosomal protein L20 [Truepera radiovictrix DSM 17093]
          Length = 116

 Score =  121 bits (304), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 81/115 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G V   KHKKVLK AKGF+G R  + R A+  +  +  Y YRDRR KK DFR L
Sbjct: 1   MPRAKTGTVRRQKHKKVLKRAKGFWGLRSRSFRIAQQTLLNAADYEYRDRRDKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R   L+YS F++GL KAG+ ++RK+L+DLA+   D+FK++VE++++
Sbjct: 61  WIARINAAARQEGLSYSVFVSGLRKAGVEINRKILADLAVQHPDAFKRLVEIAKA 115


>gi|209695236|ref|YP_002263165.1| 50S ribosomal protein L20 [Aliivibrio salmonicida LFI1238]
 gi|226730347|sp|B6EN31|RL20_ALISL RecName: Full=50S ribosomal protein L20
 gi|208009188|emb|CAQ79442.1| 50S ribosomal protein L20 [Aliivibrio salmonicida LFI1238]
          Length = 117

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAV 100


>gi|330719621|gb|EGG98191.1| LSU ribosomal protein L20p [gamma proteobacterium IMCC2047]
          Length = 119

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/102 (58%), Positives = 77/102 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV ++ +HKKVLK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTANKRHKKVLKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  ++YS+ I GL KA I +DRK+L+DLA+ +
Sbjct: 61  WIARINAAARINGISYSRLIAGLKKASIEIDRKMLADLAVQE 102


>gi|317179512|dbj|BAJ57300.1| 50S ribosomal protein L20 [Helicobacter pylori F30]
          Length = 116

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 84/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+++ +YS+F++ L  AG+ LDRKVL+D+A+  + +F+ ++E  +  L
Sbjct: 62  VRINAACRMHNTSYSRFMHALKVAGVELDRKVLADMAMNDMQAFESVLESMKEHL 116


>gi|261838992|gb|ACX98757.1| 50S ribosomal protein L20 [Helicobacter pylori 52]
          Length = 116

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 81/109 (74%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS F++ L  AG+ LDRKVL+D+A+  + +F+ ++E
Sbjct: 62  VRINAACRMHNTSYSHFMHALKVAGVELDRKVLADMAMNDMQAFESVLE 110


>gi|118474595|ref|YP_891323.1| 50S ribosomal protein L20 [Campylobacter fetus subsp. fetus 82-40]
 gi|166219625|sp|A0RM90|RL20_CAMFF RecName: Full=50S ribosomal protein L20
 gi|118413821|gb|ABK82241.1| ribosomal protein L20 [Campylobacter fetus subsp. fetus 82-40]
          Length = 117

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 75/101 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GFY  R    R AK  ++RS  YA+RDRR KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFYSARHKHFRKAKEQLERSLVYAFRDRRAKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+ D++YS+F+NGL KA I LDRKVL++LA+ 
Sbjct: 61  WIIRINAACRLNDISYSRFMNGLKKANIALDRKVLANLAMN 101


>gi|317008798|gb|ADU79378.1| 50S ribosomal protein L20 [Helicobacter pylori India7]
          Length = 116

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 80/109 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS F++ L  A I LDRKVL+D+A+  + +FK ++E
Sbjct: 62  VRINAACRMHETSYSHFMHALKVANIELDRKVLADMAMNDMQAFKSVLE 110


>gi|109947950|ref|YP_665178.1| 50S ribosomal protein L20 [Helicobacter acinonychis str. Sheeba]
 gi|123066132|sp|Q17VZ7|RL20_HELAH RecName: Full=50S ribosomal protein L20
 gi|109715171|emb|CAK00179.1| 50S ribosomal protein L20 [Helicobacter acinonychis str. Sheeba]
          Length = 116

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R++D +YS+F++ L  A I LDRK+L+D+A+  + +FK ++E
Sbjct: 62  VRINAACRMHDTSYSRFMHALKVANIELDRKILADMAMNDMQAFKSVLE 110


>gi|261880445|ref|ZP_06006872.1| 50S ribosomal protein L20 [Prevotella bergensis DSM 17361]
 gi|270332868|gb|EFA43654.1| 50S ribosomal protein L20 [Prevotella bergensis DSM 17361]
          Length = 114

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  KG+YG RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRKRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R++D++YSQ +  L KAGI ++RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAAARIHDMSYSQLMGALRKAGIEINRKVLADLAMNNPEAFKAIVD 111


>gi|188526929|ref|YP_001909616.1| 50S ribosomal protein L20 [Helicobacter pylori Shi470]
 gi|217034629|ref|ZP_03440036.1| hypothetical protein HP9810_881g22 [Helicobacter pylori 98-10]
 gi|226730408|sp|B2URV4|RL20_HELPS RecName: Full=50S ribosomal protein L20
 gi|188143169|gb|ACD47586.1| 50S ribosomal protein L20 [Helicobacter pylori Shi470]
 gi|216942924|gb|EEC22411.1| hypothetical protein HP9810_881g22 [Helicobacter pylori 98-10]
 gi|261837578|gb|ACX97344.1| ribosomal protein L20 [Helicobacter pylori 51]
 gi|297379347|gb|ADI34234.1| ribosomal protein L20 [Helicobacter pylori v225d]
 gi|308061416|gb|ADO03304.1| 50S ribosomal protein L20 [Helicobacter pylori Cuz20]
 gi|315586095|gb|ADU40476.1| 50S ribosomal protein L20 [Helicobacter pylori 35A]
 gi|317179931|dbj|BAJ57717.1| 50S ribosomal protein L20 [Helicobacter pylori F32]
 gi|317181402|dbj|BAJ59186.1| 50S ribosomal protein L20 [Helicobacter pylori F57]
 gi|332672966|gb|AEE69783.1| 50S ribosomal protein L20 [Helicobacter pylori 83]
          Length = 116

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 82/109 (75%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS+F++ L  AG+ LDRKVL+D+A+  + +F+ ++E
Sbjct: 62  VRINAACRMHNTSYSRFMHALKVAGVELDRKVLADMAMNDMQAFESVLE 110


>gi|298206756|ref|YP_003714935.1| 50S ribosomal protein L20 [Croceibacter atlanticus HTCC2559]
 gi|83849387|gb|EAP87255.1| 50S ribosomal protein L20 [Croceibacter atlanticus HTCC2559]
          Length = 114

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AVD++ QY+YRDR+ KKR+FRSL
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVDKAMQYSYRDRKTKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R+  ++YSQF+  + K  I L+RKVL+DLA+   ++F  +V 
Sbjct: 61  WIMRINAGARLNGMSYSQFMGAVKKNNIELNRKVLADLAMNHPEAFTAVVN 111


>gi|281423153|ref|ZP_06254066.1| ribosomal protein L20 [Prevotella oris F0302]
 gi|299140593|ref|ZP_07033731.1| ribosomal protein L20 [Prevotella oris C735]
 gi|281402489|gb|EFB33320.1| ribosomal protein L20 [Prevotella oris F0302]
 gi|298577559|gb|EFI49427.1| ribosomal protein L20 [Prevotella oris C735]
          Length = 114

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+ +++YS  +  LHKAGI ++RKVL+DLA+   ++FK IVE
Sbjct: 61  WIQRINAAARLENMSYSTLMGALHKAGIEINRKVLADLAVNNPEAFKAIVE 111


>gi|317176945|dbj|BAJ54734.1| 50S ribosomal protein L20 [Helicobacter pylori F16]
          Length = 116

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 82/109 (75%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS+F++ L  AG+ LDRKVL+D+A+  + +F+ ++E
Sbjct: 62  VRINAACRMHNTSYSRFMHALKVAGVELDRKVLADMAMNDMQAFESVLE 110


>gi|304382820|ref|ZP_07365303.1| 50S ribosomal protein L20 [Prevotella marshii DSM 16973]
 gi|304336005|gb|EFM02252.1| 50S ribosomal protein L20 [Prevotella marshii DSM 16973]
          Length = 114

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G+YG RKN    AK   ++   YAYRDRR+KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYYGARKNVWTVAKNTWEKGLTYAYRDRRLKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+ D++YS  +  LHKAGI ++RKVL+DLA+    +FK IV+
Sbjct: 61  WIQRINAAARMEDMSYSTLMGALHKAGIEINRKVLADLAVNNPQAFKAIVD 111


>gi|34811568|pdb|1PNU|O Chain O, Crystal Structure Of A Streptomycin Dependent Ribosome
           From Escherichia Coli, 50s Subunit Of 70s Ribosome. This
           File, 1pnu, Contains Only Molecules Of The 50s Ribosomal
           Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site
           Trna Are In The Pdb File 1pns.
 gi|34811621|pdb|1PNY|O Chain O, Crystal Structure Of The Wild Type Ribosome From E. Coli,
           50s Subunit Of 70s Ribosome. This File, 1pny, Contains
           Only Molecules Of The 50s Ribosomal Subunit. The 30s
           Subunit Is In The Pdb File 1pnx.
 gi|56966360|pdb|1VOR|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966413|pdb|1VOU|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966466|pdb|1VOW|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966519|pdb|1VOY|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966572|pdb|1VP0|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400
          Length = 117

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 79/114 (69%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R K G+V   +HKKVLK AKGF+G R    R A   +  +  Y YRDRR KKRDFR LW
Sbjct: 1   PRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           IQRINA  R++ +NYS FINGL +A I L+RKVL+D+A  + ++FK +V+ SR+
Sbjct: 61  IQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAREPEAFKALVDASRN 114


>gi|167948466|ref|ZP_02535540.1| 50S ribosomal protein L20 [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 119

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 78/100 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R+KRGV + A+HKKVLK AKG+YG R+   R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MSRIKRGVQARARHKKVLKEAKGYYGARRKIYRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           WI RINA  R   L+YS+ I+GL+KA + +DRK+L+DLA+
Sbjct: 61  WIARINAGARECGLSYSRMIDGLNKALVEIDRKMLADLAV 100


>gi|294155485|ref|YP_003559869.1| 50S ribosomal protein L20 [Mycoplasma crocodyli MP145]
 gi|291600418|gb|ADE19914.1| 50S ribosomal protein L20 [Mycoplasma crocodyli MP145]
          Length = 117

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 84/114 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK LK AKG++G +    + AK AV +S  YA+RDR+  KR+FR L
Sbjct: 1   MARVKGGTVTRARRKKWLKLAKGYFGHKSVGYKVAKQAVVKSWTYAFRDRKQVKRNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R +D++YS+FINGL +A I+++RK+LS+LAI +  +F  ++EL+R
Sbjct: 61  WIARINAATRAHDMSYSRFINGLKRANILINRKMLSELAINEPKTFATLIELAR 114


>gi|189424931|ref|YP_001952108.1| 50S ribosomal protein L20 [Geobacter lovleyi SZ]
 gi|226730404|sp|B3E1T8|RL20_GEOLS RecName: Full=50S ribosomal protein L20
 gi|189421190|gb|ACD95588.1| ribosomal protein L20 [Geobacter lovleyi SZ]
          Length = 117

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G  S  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFRSL
Sbjct: 1   MPRAKGGFKSRQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FI GL KA + +DRKVL+D+AIT    F +I  +++++L
Sbjct: 61  WIMRINAASRLNGLSYSKFIFGLKKADVQIDRKVLADIAITDPKGFAEISAVAKAQL 117


>gi|78357678|ref|YP_389127.1| 50S ribosomal protein L20 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|109893112|sp|Q30Y14|RL20_DESDG RecName: Full=50S ribosomal protein L20
 gi|78220083|gb|ABB39432.1| LSU ribosomal protein L20P [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 117

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 84/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ +  +HKK LK AKG+ G R    R A+ AV+RS  Y+ RDR+V+KR+FR LWI
Sbjct: 2   RVKRGMATHRRHKKYLKMAKGYRGGRSKLYRTAREAVERSLAYSTRDRKVRKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R   ++YS+FI+GL  AGI L+RKVL+DLA+ + + F K+ EL +S+L
Sbjct: 62  LRINAAARENGVSYSKFIHGLALAGIELNRKVLADLAVREKEDFAKLAELVKSKL 116


>gi|12746357|gb|AAK07457.1|AF324940_1 large subunit ribosomal protein L20 [Listonella pelagia]
          Length = 101

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/99 (62%), Positives = 74/99 (74%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR LW
Sbjct: 1   PRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRQFRQLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           I RINAA R   L+YS+FINGL KA I +DRK+L+D+A+
Sbjct: 61  IARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAV 99


>gi|327439268|dbj|BAK15633.1| ribosomal protein L20 [Solibacillus silvestris StLB046]
          Length = 119

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 80/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KKVLK AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKVLKLAKGYYGSKHTLYKVANQAVMKSGQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+T   +F ++ E
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKVAGIEVNRKMLADLAVTDSTAFAQLAE 111


>gi|302389959|ref|YP_003825780.1| LSU ribosomal protein L20P [Thermosediminibacter oceani DSM 16646]
 gi|302200587|gb|ADL08157.1| LSU ribosomal protein L20P [Thermosediminibacter oceani DSM 16646]
          Length = 118

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+GV +  +HKK+LK AKG+YG +    + A  AV +S  YAY  R++KKRDFR L
Sbjct: 1   MARVKKGVTARRRHKKILKLAKGYYGAKSKRFKIANQAVLKSLMYAYVGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KAG+ ++RK+L+++AI     F ++VE++++ +
Sbjct: 61  WITRINAAARANGLSYSKFINGLKKAGVQINRKMLAEMAIHDQGGFTQLVEIAKANI 117


>gi|254457404|ref|ZP_05070832.1| ribosomal protein L20 [Campylobacterales bacterium GD 1]
 gi|207086196|gb|EDZ63480.1| ribosomal protein L20 [Campylobacterales bacterium GD 1]
          Length = 119

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 71/95 (74%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVK GVV   +HKK+LK AKGFY  R+   R AK  ++RS  YA+RDR+ KKRDFR L
Sbjct: 1  MPRVKTGVVRRRRHKKILKLAKGFYSGRRKHFRKAKEQIERSWVYAHRDRKQKKRDFRKL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVL 95
          WI RINAA R+  +NYS FINGLHK+GI LDRK+L
Sbjct: 61 WIVRINAACRLNGMNYSTFINGLHKSGIELDRKIL 95


>gi|168040220|ref|XP_001772593.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162676148|gb|EDQ62635.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 113

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 77/101 (76%)

Query: 14  HKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYD 73
           ++K+L+ AKGF GR KN IRAA+  V+++ QYAYRDRR KKRD R LWIQRINA  R + 
Sbjct: 3   NQKILQLAKGFRGRSKNCIRAARERVEKALQYAYRDRRNKKRDMRGLWIQRINAGTRQHG 62

Query: 74  LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           +NY  F+NGL K  I L+RKVLS+LA+ +  SFK +V++SR
Sbjct: 63  VNYGDFMNGLSKENIDLNRKVLSELAMHEPYSFKSLVDISR 103


>gi|297182197|gb|ADI18368.1| hypothetical protein [uncultured actinobacterium HF4000_04C13]
          Length = 119

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 79/115 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V S  KHK +L+ A+G+YG R  T ++A  AV  +  YA+RDRR +K  FR L
Sbjct: 1   MARVKRAVHSKKKHKAILEQAQGYYGDRSRTFKSANEAVMHAGNYAFRDRRARKGQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAA R +  +YS FI GL  AG+ +DRKVL+DLA+ +  +F  +V+L+ S
Sbjct: 61  WIQRINAACRQHGTSYSVFIAGLKNAGVEVDRKVLADLAVAEPTAFAALVQLATS 115


>gi|83647269|ref|YP_435704.1| 50S ribosomal protein L20 [Hahella chejuensis KCTC 2396]
 gi|109893117|sp|Q2SDJ5|RL20_HAHCH RecName: Full=50S ribosomal protein L20
 gi|83635312|gb|ABC31279.1| ribosomal protein L20 [Hahella chejuensis KCTC 2396]
          Length = 118

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKKVL  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARRRHKKVLNQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL +A + +DRKVL+DLA+ +  +F  +V+ ++  L
Sbjct: 61  WIARINAGARDNGLSYSRLIAGLKRANVEIDRKVLADLAMNEKAAFAAVVQKAKEAL 117


>gi|308062986|gb|ADO04873.1| 50S ribosomal protein L20 [Helicobacter pylori Sat464]
          Length = 116

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 82/109 (75%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS+F++ L  AG+ LDRK+L+D+A+  + +F+ ++E
Sbjct: 62  VRINAACRMHNTSYSRFMHALKVAGVELDRKILADMAMNDMQAFESVLE 110


>gi|121535637|ref|ZP_01667443.1| ribosomal protein L20 [Thermosinus carboxydivorans Nor1]
 gi|121305807|gb|EAX46743.1| ribosomal protein L20 [Thermosinus carboxydivorans Nor1]
          Length = 117

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+GV +  +HKK+LK AKG+ G R    + A   V ++  YA RDRR KK +FR L
Sbjct: 1   MPRVKKGVTAHRRHKKILKLAKGYRGARSKQFKKANELVMKALYYARRDRRAKKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ INGL KAG+ ++RK+L+DLA+  + +F K+VE ++++L
Sbjct: 61  WITRINAAARINGLSYSQLINGLKKAGVEVNRKMLADLAVNDMAAFSKLVETAKAQL 117


>gi|304310701|ref|YP_003810299.1| 50S ribosomal protein L20 [gamma proteobacterium HdN1]
 gi|301796434|emb|CBL44642.1| 50S ribosomal protein L20 [gamma proteobacterium HdN1]
          Length = 119

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/106 (56%), Positives = 77/106 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK + +AKG+YG R    R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARARHKKTMAAAKGYYGARSRVYRVAKQAVTKAGQYAYRDRRQKKRLFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  ++YS+ I+GL KA I +DRKVL+D+A+     F
Sbjct: 61  WIARINAAARINGISYSRMIDGLKKASIEIDRKVLADIAVHDAVGF 106


>gi|15611186|ref|NP_222837.1| 50S ribosomal protein L20 [Helicobacter pylori J99]
 gi|108562550|ref|YP_626866.1| 50S ribosomal protein L20 [Helicobacter pylori HPAG1]
 gi|217031887|ref|ZP_03437389.1| hypothetical protein HPB128_3g6 [Helicobacter pylori B128]
 gi|254778843|ref|YP_003056948.1| 50S ribosomal protein L20 [Helicobacter pylori B38]
 gi|298736932|ref|YP_003729462.1| 50S ribosomal protein L20 [Helicobacter pylori B8]
 gi|308182299|ref|YP_003926426.1| 50S ribosomal protein L20 [Helicobacter pylori PeCan4]
 gi|7674219|sp|Q9ZMV1|RL20_HELPJ RecName: Full=50S ribosomal protein L20
 gi|122386810|sp|Q1CV30|RL20_HELPH RecName: Full=50S ribosomal protein L20
 gi|4154635|gb|AAD05705.1| 50S RIBOSOMAL PROTEIN L20 [Helicobacter pylori J99]
 gi|107836323|gb|ABF84192.1| ribosomal protein L20 [Helicobacter pylori HPAG1]
 gi|216946356|gb|EEC24961.1| hypothetical protein HPB128_3g6 [Helicobacter pylori B128]
 gi|254000754|emb|CAX28678.1| 50S ribosomal subunit protein L20 [Helicobacter pylori B38]
 gi|298356126|emb|CBI66998.1| large subunit ribosomal protein L20 [Helicobacter pylori B8]
 gi|307636816|gb|ADN79266.1| LSU ribosomal protein L20p [Helicobacter pylori 908]
 gi|308064484|gb|ADO06376.1| 50S ribosomal protein L20 [Helicobacter pylori PeCan4]
 gi|317011970|gb|ADU82578.1| 50S ribosomal protein L20 [Helicobacter pylori Lithuania75]
 gi|325995405|gb|ADZ50810.1| 50S ribosomal protein L20 [Helicobacter pylori 2018]
 gi|325997003|gb|ADZ49211.1| 50S ribosomal protein L20 [Helicobacter pylori 2017]
          Length = 116

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS+F++ L  A I LDRKVL+D+A+  + +FK ++E
Sbjct: 62  VRINAACRMHNTSYSRFMHALKVANIELDRKVLADMAMNDMQAFKSVLE 110


>gi|313674623|ref|YP_004052619.1| LSU ribosomal protein l20p [Marivirga tractuosa DSM 4126]
 gi|312941321|gb|ADR20511.1| LSU ribosomal protein L20P [Marivirga tractuosa DSM 4126]
          Length = 114

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 80/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+LK AKG++GR+KN    AK AV++   YAYRDR+ KKR+FR L
Sbjct: 1   MPRSVNHVASRARRKKILKYAKGYWGRKKNVWTVAKNAVEKGWLYAYRDRKQKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R + ++YSQF+  ++K GI L+RKVL+DLA+   ++FK +V+
Sbjct: 61  WIQRINAGAREHGMSYSQFMGAVNKKGIELNRKVLADLAMNHPEAFKSVVD 111


>gi|71892133|ref|YP_277865.1| 50S ribosomal protein L20 [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|109893097|sp|Q492V2|RL20_BLOPB RecName: Full=50S ribosomal protein L20
 gi|71796239|gb|AAZ40990.1| 50S ribosomal subunit protein L20 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 120

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVK  VV+ A+HKK+LK A G+YG R  T R A  +V +S QY+YRDRR KKR FR L
Sbjct: 1   MTRVKNSVVARARHKKILKQAAGYYGARSRTYRVAYQSVIKSGQYSYRDRRQKKRLFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R Y ++Y+  INGL K  + ++RK+L+D+AI   ++F  +++
Sbjct: 61  WINRINAASRKYGMSYNHLINGLQKCNVCINRKMLADIAIFDRETFSALID 111


>gi|258647091|ref|ZP_05734560.1| ribosomal protein L20 [Prevotella tannerae ATCC 51259]
 gi|260853038|gb|EEX72907.1| ribosomal protein L20 [Prevotella tannerae ATCC 51259]
          Length = 114

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G+YG RKN    AK   ++   YA+RDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYYGARKNVWTVAKNTWEKGLTYAFRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+  L+YSQ +  LHKAGI ++RKVL+DLA+    +FK IVE
Sbjct: 61  WIQRINAAARLEGLSYSQLMGNLHKAGIEINRKVLADLAVNNPQAFKAIVE 111


>gi|222056444|ref|YP_002538806.1| ribosomal protein L20 [Geobacter sp. FRC-32]
 gi|254800324|sp|B9M521|RL20_GEOSF RecName: Full=50S ribosomal protein L20
 gi|221565733|gb|ACM21705.1| ribosomal protein L20 [Geobacter sp. FRC-32]
          Length = 117

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 83/115 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+  ++YS+ I+GL +A + +DRKV++DLA++    F +IV L+++
Sbjct: 61  WITRINAAARINGISYSKLIHGLKQAKVEVDRKVMADLAVSDPRGFAEIVSLAKA 115


>gi|94984681|ref|YP_604045.1| 50S ribosomal protein L20 [Deinococcus geothermalis DSM 11300]
 gi|166219638|sp|Q1J0V8|RL20_DEIGD RecName: Full=50S ribosomal protein L20
 gi|94554962|gb|ABF44876.1| ribosomal protein L20 [Deinococcus geothermalis DSM 11300]
          Length = 119

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 79/115 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKKVLK AKGF+G R    R A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MPRVKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINA  R++ +NYS FINGL  AG+ L+RKVL+D+A  + ++F+ +V  ++ 
Sbjct: 61  WIQRINAGARLHGMNYSTFINGLKVAGVDLNRKVLADIAAREPEAFQVLVNTAKG 115


>gi|12746361|gb|AAK07459.1|AF324942_1 large subunit ribosomal protein L20 [Vibrio harveyi]
          Length = 101

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (75%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR LWI
Sbjct: 1   RVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRQFRQLWI 60

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
            RINAA R   L+YS+FINGL KA I +DRK+L+D+A+
Sbjct: 61  ARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAV 98


>gi|20808117|ref|NP_623288.1| 50S ribosomal protein L20 [Thermoanaerobacter tengcongensis MB4]
 gi|22096043|sp|Q8R9C4|RL20_THETN RecName: Full=50S ribosomal protein L20
 gi|20516704|gb|AAM24892.1| Ribosomal protein L20 [Thermoanaerobacter tengcongensis MB4]
          Length = 119

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  +HKK+LK AKG++G +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MARVKSGKVTRRRHKKILKLAKGYWGAKSKLFRVANQAVMKSLMYAYIGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R Y ++YS+FINGL KAGI ++RK+LS++AI    +F ++V +++ +L
Sbjct: 61  WITRINAAARAYGISYSRFINGLKKAGIEINRKMLSEMAIHDEKAFAELVNIAKQQL 117


>gi|118443763|ref|YP_877836.1| 50S ribosomal protein L20 [Clostridium novyi NT]
 gi|166219635|sp|A0PZN4|RL20_CLONN RecName: Full=50S ribosomal protein L20
 gi|118134219|gb|ABK61263.1| ribosomal protein L20 [Clostridium novyi NT]
          Length = 119

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  KHKK+LK AKG+YGRR  T + A   V R+  +AY  R++KKRDFR L
Sbjct: 1   MARVKRAMHARKKHKKILKLAKGYYGRRSRTFKNANETVLRAMNFAYVGRKLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NG+  AGI ++RK+LS++AI    +F  +VE+++ +L
Sbjct: 61  WIARINAAARMNGLSYSKFMNGIKLAGINMNRKMLSEIAINDEKAFADLVEVAKKQL 117


>gi|12746365|gb|AAK07461.1|AF324944_1 large subunit ribosomal protein L20 [Grimontia hollisae]
          Length = 102

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 61/99 (61%), Positives = 74/99 (74%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR LW
Sbjct: 1   PRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRQFRQLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           I RINAA R   ++YS+FINGL KA I +DRK+L+D+A+
Sbjct: 61  IARINAAARQNGMSYSRFINGLKKASIEIDRKILADIAV 99


>gi|257455762|ref|ZP_05620988.1| ribosomal protein L20 [Enhydrobacter aerosaccus SK60]
 gi|257446776|gb|EEV21793.1| ribosomal protein L20 [Enhydrobacter aerosaccus SK60]
          Length = 119

 Score =  120 bits (300), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV ++ +HKKVL  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQANRRHKKVLARAKGYYGARSRVFRVAVQAVTKAGQYAYRDRRNKKRSFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+ INGL KA I +DR+VL+D+A+     F  + E ++  L
Sbjct: 61  WIARINAGARLNGLSYSRMINGLKKASIEIDRRVLADIAMHDAQGFTALAEKAKQAL 117


>gi|257790988|ref|YP_003181594.1| 50S ribosomal protein L20 [Eggerthella lenta DSM 2243]
 gi|317488302|ref|ZP_07946865.1| ribosomal protein L20 [Eggerthella sp. 1_3_56FAA]
 gi|325830898|ref|ZP_08164282.1| ribosomal protein L20 [Eggerthella sp. HGA1]
 gi|257474885|gb|ACV55205.1| ribosomal protein L20 [Eggerthella lenta DSM 2243]
 gi|316912587|gb|EFV34133.1| ribosomal protein L20 [Eggerthella sp. 1_3_56FAA]
 gi|325487305|gb|EGC89748.1| ribosomal protein L20 [Eggerthella sp. HGA1]
          Length = 117

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  AKG+YG +  + RAAK  V  S QY YRDRR KKR+ R L
Sbjct: 1   MPRVKRAVSAHKKRRTVLNRAKGYYGAKSRSYRAAKEQVQHSLQYMYRDRRNKKREIRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  +NGL KAG+ LDRKVLSD+AI    +F  I E+++  L
Sbjct: 61  WITRINAAARINGMSYSVLMNGLKKAGVQLDRKVLSDMAINDPAAFTAITEVAKKAL 117


>gi|39996618|ref|NP_952569.1| 50S ribosomal protein L20 [Geobacter sulfurreducens PCA]
 gi|60390514|sp|Q74D01|RL20_GEOSL RecName: Full=50S ribosomal protein L20
 gi|39983499|gb|AAR34892.1| ribosomal protein L20 [Geobacter sulfurreducens PCA]
 gi|307634867|gb|ADI84354.2| ribosomal protein L20 [Geobacter sulfurreducens KN400]
          Length = 117

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKGF G R    R+A  AVDR+  YA+RDR+VKKRDFR+L
Sbjct: 1   MPRVKRGFKARRRRNKVLKLAKGFRGARSKLFRSATEAVDRALNYAFRDRKVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ I+GL +A + +DRKVL+DLA++    F +I  L++++ 
Sbjct: 61  WITRINAASRLNGLSYSKLIHGLKQAQVEIDRKVLADLAVSDPKGFSEIATLAKAQF 117


>gi|282882482|ref|ZP_06291103.1| ribosomal protein L20 [Peptoniphilus lacrimalis 315-B]
 gi|281297624|gb|EFA90099.1| ribosomal protein L20 [Peptoniphilus lacrimalis 315-B]
          Length = 116

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 83/115 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HK +LK AKG++G +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKNILKQAKGYFGAKSKLFRPANQAVMKSLSYAYIGRKQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+Y ++YS+FI+GL KAG+ ++RK+LS++AI     FK++V+++++
Sbjct: 61  WITRINAATRLYGMSYSKFISGLKKAGVNINRKMLSEMAINDPQGFKELVDIAKA 115


>gi|78222626|ref|YP_384373.1| 50S ribosomal protein L20 [Geobacter metallireducens GS-15]
 gi|109893116|sp|Q39VS6|RL20_GEOMG RecName: Full=50S ribosomal protein L20
 gi|78193881|gb|ABB31648.1| LSU ribosomal protein L20P [Geobacter metallireducens GS-15]
          Length = 117

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDR+VKKRDFR+L
Sbjct: 1   MPRVKRGFKARRRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRKVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ I+GL KA + +DRKVL+DLA++    F +I  ++++++
Sbjct: 61  WITRINAASRLNGLSYSKLIHGLKKASVEIDRKVLADLAVSDPQGFSEIASVAKTQI 117


>gi|332981196|ref|YP_004462637.1| 50S ribosomal protein L20P [Mahella australiensis 50-1 BON]
 gi|332698874|gb|AEE95815.1| LSU ribosomal protein L20P [Mahella australiensis 50-1 BON]
          Length = 119

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  +HKKVLK AKG++G +    +AA  AV ++  YAY  R+++KRDFR L
Sbjct: 1   MARVKSGVTTHRRHKKVLKLAKGYWGGKSKQYKAANEAVMKALAYAYVGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FINGL KAGI ++RK+L+++A++   +F ++VE+++ ++
Sbjct: 61  WIARINAASRMNGLSYSKFINGLKKAGIEINRKMLAEMAVSDSKAFTQLVEVAKQQM 117


>gi|208434084|ref|YP_002265750.1| ribosomalprotein L20 [Helicobacter pylori G27]
 gi|226730407|sp|B5Z9Q4|RL20_HELPG RecName: Full=50S ribosomal protein L20
 gi|208432013|gb|ACI26884.1| ribosomalprotein L20 [Helicobacter pylori G27]
          Length = 116

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 80/109 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKRDFRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKRDFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS+F++ L  A I LDRKVL+D+A+  + +F  ++E
Sbjct: 62  VRINAACRMHNTSYSRFMHALKVANIELDRKVLADMAMNDMQAFTSVLE 110


>gi|82524024|emb|CAI78702.1| Ribosomal protein L20 [uncultured Flavobacteriaceae bacterium]
          Length = 114

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKGF+GRRKN    AK AVD++  Y+YRDRR KKR FR+L
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGFFGRRKNVWTVAKNAVDKAMLYSYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R Y L+YSQF+  L    I L+RKVL+DLA+   ++FK ++E
Sbjct: 61  WITRINAGARQYGLSYSQFMGKLKANDIELNRKVLADLAMNNPEAFKAVIE 111


>gi|225013015|ref|ZP_03703431.1| ribosomal protein L20 [Flavobacteria bacterium MS024-2A]
 gi|225002831|gb|EEG40811.1| ribosomal protein L20 [Flavobacteria bacterium MS024-2A]
          Length = 114

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+LK AKGF+GRRKN    AK AVD++  YAYRDR+V KR+FR+L
Sbjct: 1   MPRSVNSVASRARRKKILKQAKGFFGRRKNVWTVAKNAVDKAMLYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R+  ++YSQF+  +    I L+RKVL+DLA+   D+FK I +
Sbjct: 61  WITRINAGARINGMSYSQFMGKIKSHNIELNRKVLADLAMNHPDAFKAIAD 111


>gi|330883050|gb|EGH17199.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 105

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 76/104 (73%)

Query: 14  HKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYD 73
           HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+LWI RINA  RV  
Sbjct: 1   HKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRALWIARINAGARVNG 60

Query: 74  LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           L+YS+FI GL KA I +DRKVL+DLA+ +  +F  IVE +++ L
Sbjct: 61  LSYSRFIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKATL 104


>gi|322379031|ref|ZP_08053434.1| 50S ribosomal protein L20 [Helicobacter suis HS1]
 gi|322380797|ref|ZP_08054903.1| 50S ribosomal protein L20 [Helicobacter suis HS5]
 gi|321146801|gb|EFX41595.1| 50S ribosomal protein L20 [Helicobacter suis HS5]
 gi|321148523|gb|EFX43020.1| 50S ribosomal protein L20 [Helicobacter suis HS1]
          Length = 120

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 82/115 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKRDFRSLWI
Sbjct: 2   RVKTGVVRHRRHKKVLKQARGFYSGRRKHFRKAKEQLERSLCYAFRDRKQKKRDFRSLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA  +++ +YS+F++ L  + I LDRK+L+D+A+  + +F  ++E  ++ L
Sbjct: 62  VRINAACHMHNTSYSRFMHALKSSHIELDRKILADMAMNDMPAFSNLIEQVKAHL 116


>gi|317131313|ref|YP_004090627.1| ribosomal protein L20 [Ethanoligenens harbinense YUAN-3]
 gi|315469292|gb|ADU25896.1| ribosomal protein L20 [Ethanoligenens harbinense YUAN-3]
          Length = 117

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  + KK+LK AKG++G +    R A  AV +S  YAY  R++KKRDFRSL
Sbjct: 1   MARVKGAMMTRKRRKKILKLAKGYWGGKSRLFRTANEAVMKSLSYAYVGRKLKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS FINGL KAGIVL+RK+LS+LA++    F  +VE +++ L
Sbjct: 61  WITRISAACKLNGMNYSTFINGLKKAGIVLNRKILSELAVSDSAGFAALVEKAKAAL 117


>gi|169831540|ref|YP_001717522.1| 50S ribosomal protein L20 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|226730388|sp|B1I4I8|RL20_DESAP RecName: Full=50S ribosomal protein L20
 gi|169638384|gb|ACA59890.1| ribosomal protein L20 [Candidatus Desulforudis audaxviator MP104C]
          Length = 120

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  VV+  +HKKVLK AKG++G +    R A   V RS  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKNAVVARKRHKKVLKLAKGYWGAKSKLYRVANQQVMRSLLYAYRDRRAKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++Y++FI GL +AG+ ++RKVL++LA+    +F ++V++++++L
Sbjct: 61  WITRINAAARLNGMSYNRFIEGLRRAGVEINRKVLAELAVKDQAAFGQLVQVAKAQL 117


>gi|88606750|ref|YP_504693.1| 50S ribosomal protein L20 [Anaplasma phagocytophilum HZ]
 gi|109893095|sp|Q2GLQ8|RL20_ANAPZ RecName: Full=50S ribosomal protein L20
 gi|88597813|gb|ABD43283.1| ribosomal protein L20 [Anaplasma phagocytophilum HZ]
          Length = 128

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 80/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GR KN  RAA   ++++  YAYRDRR +KRDFRSL
Sbjct: 1   MARVKRGVTTRARHKKVIALAKGYRGRSKNCYRAALQRLEKALAYAYRDRRARKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA  +Y L YS+F++G+    I L+RK+L+++A+    +F+KI  
Sbjct: 61  WIVRINAAAGLYGLRYSEFMHGVSLCSIGLNRKMLAEMAVRDKGAFEKIAH 111


>gi|12746359|gb|AAK07458.1|AF324941_1 large subunit ribosomal protein L20 [Aliivibrio fischeri]
          Length = 102

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/99 (61%), Positives = 74/99 (74%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR LW
Sbjct: 1   PRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRVFRQLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
           I RINAA R  ++ YS+FINGL KA I +DRK+L+D+A+
Sbjct: 61  IARINAAARQNEMPYSRFINGLKKASIEIDRKILADIAV 99


>gi|86143060|ref|ZP_01061482.1| 50S ribosomal protein L20 [Leeuwenhoekiella blandensis MED217]
 gi|85830505|gb|EAQ48964.1| 50S ribosomal protein L20 [Leeuwenhoekiella blandensis MED217]
          Length = 114

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV+++  YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGYFGRRKNVYTVAKNAVEKAMLYAYRDRRQKKRNFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YSQF+  +  A I L+RKVL+DLA+   ++F+ IV 
Sbjct: 61  WITRINAGARMHGMSYSQFMGKVKAANIELNRKVLADLAMNHPEAFEAIVN 111


>gi|210134327|ref|YP_002300766.1| 50S ribosomal protein L20 [Helicobacter pylori P12]
 gi|226730406|sp|B6JPM5|RL20_HELP2 RecName: Full=50S ribosomal protein L20
 gi|210132295|gb|ACJ07286.1| 50S ribosomal protein L20 [Helicobacter pylori P12]
          Length = 116

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 80/109 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKRKFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS+F++ L  A I LDRKVL+D+A+  + +FK ++E
Sbjct: 62  VRINAACRMHETSYSRFMHALKVANIELDRKVLADMAMNDMQAFKSVLE 110


>gi|312793385|ref|YP_004026308.1| 50S ribosomal protein L20 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180525|gb|ADQ40695.1| ribosomal protein L20 [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 119

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 83/116 (71%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LW
Sbjct: 1   MRIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRRLKKRDFRKLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RINAA R   L+YS+FINGL KAGI L+RKVL+D+A+    +F ++VE+++ ++
Sbjct: 61  ITRINAAARQNGLSYSKFINGLKKAGISLNRKVLADMAVNDQKAFAELVEIAKKQI 116


>gi|310779332|ref|YP_003967665.1| LSU ribosomal protein L20P [Ilyobacter polytropus DSM 2926]
 gi|309748655|gb|ADO83317.1| LSU ribosomal protein L20P [Ilyobacter polytropus DSM 2926]
          Length = 116

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 80/115 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GVV   +HKKVL +AKG+ G   +  + A  AV R++ ++ RDR+V+KR  R L
Sbjct: 1   MSRVKTGVVRRKRHKKVLDAAKGYRGASGDVFKQANQAVMRAEAFSTRDRKVRKRKMRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+  L YSQF+NGL K+GI LDRKVLSDLA+     F K+ E +++
Sbjct: 61  WIIRINAAARLNGLTYSQFMNGLKKSGIELDRKVLSDLAVNNAAEFSKLAETAKN 115


>gi|146296776|ref|YP_001180547.1| ribosomal protein L20 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|166219622|sp|A4XKC1|RL20_CALS8 RecName: Full=50S ribosomal protein L20
 gi|145410352|gb|ABP67356.1| LSU ribosomal protein L20P [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 118

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 83/116 (71%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LW
Sbjct: 1   MRIKNGVWARKRHKKWLKLAKGYWGAKSRVFKQAHIAVMRSLRYAYIGRRLKKRDFRRLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RINAA R   L+YS+FINGL KAGI L+RKVL+D+AI    +F ++VE+++ ++
Sbjct: 61  ITRINAAARQNGLSYSKFINGLKKAGISLNRKVLADMAINDQKAFAELVEIAKKQI 116


>gi|328955211|ref|YP_004372544.1| LSU ribosomal protein L20P [Coriobacterium glomerans PW2]
 gi|328455535|gb|AEB06729.1| LSU ribosomal protein L20P [Coriobacterium glomerans PW2]
          Length = 119

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 79/119 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + V+  AKG+YG    T + AK  V  S QY YRDRR KKRD RSL
Sbjct: 1   MARVKRAVSAKKKRRTVMSRAKGYYGAASRTYKHAKEQVQHSLQYQYRDRRTKKRDIRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+ DL+YSQF++GL  AGI LDRKVL+ +A    +SF ++  +++  L V
Sbjct: 61  WITRINAAARMDDLSYSQFMHGLKLAGIELDRKVLAQMAYEDPESFSELTGIAKKALEV 119


>gi|296112357|ref|YP_003626295.1| 50S ribosomal protein L20 [Moraxella catarrhalis RH4]
 gi|295920051|gb|ADG60402.1| 50S ribosomal protein L20 [Moraxella catarrhalis RH4]
 gi|326561865|gb|EGE12200.1| 50S ribosomal protein L20 [Moraxella catarrhalis 7169]
 gi|326563300|gb|EGE13567.1| 50S ribosomal protein L20 [Moraxella catarrhalis 46P47B1]
 gi|326563415|gb|EGE13680.1| 50S ribosomal protein L20 [Moraxella catarrhalis 12P80B1]
 gi|326565954|gb|EGE16115.1| 50S ribosomal protein L20 [Moraxella catarrhalis 103P14B1]
 gi|326568911|gb|EGE18980.1| 50S ribosomal protein L20 [Moraxella catarrhalis BC1]
 gi|326569212|gb|EGE19273.1| 50S ribosomal protein L20 [Moraxella catarrhalis BC7]
 gi|326571885|gb|EGE21890.1| 50S ribosomal protein L20 [Moraxella catarrhalis BC8]
 gi|326575397|gb|EGE25322.1| 50S ribosomal protein L20 [Moraxella catarrhalis 101P30B1]
 gi|326576516|gb|EGE26424.1| 50S ribosomal protein L20 [Moraxella catarrhalis CO72]
 gi|326577985|gb|EGE27849.1| 50S ribosomal protein L20 [Moraxella catarrhalis O35E]
          Length = 118

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV ++ +HKKVL  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQANRRHKKVLARAKGYYGARSRVYRVAVQAVMKAGQYAYRDRRNKKRSFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+ INGL KA + +DR++L+D+A+    +F  I E +++ L
Sbjct: 61  WIARINAGARLNGLSYSRLINGLKKANVEIDRRILADIAMHDAAAFTAITEKAKAAL 117


>gi|158523051|ref|YP_001530921.1| ribosomal protein L20 [Desulfococcus oleovorans Hxd3]
 gi|215274796|sp|A8ZZ71|RL20_DESOH RecName: Full=50S ribosomal protein L20
 gi|158511877|gb|ABW68844.1| ribosomal protein L20 [Desulfococcus oleovorans Hxd3]
          Length = 116

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (72%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+KRG  +  + KK+LK AKGF G      + AK  VD++  YAYRDR+ +KRDFR LWI
Sbjct: 2   RIKRGFKARHRRKKILKLAKGFRGGHSKLFKTAKNTVDKALGYAYRDRKQRKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
            RINAAVR++ L+YS+F++GL KAG+ LDRKVL++LAI+    F K+V ++
Sbjct: 62  ARINAAVRMHSLSYSRFMHGLKKAGVELDRKVLAELAISDPSGFSKVVAVA 112


>gi|300778189|ref|ZP_07088047.1| 50S ribosomal protein L20 [Chryseobacterium gleum ATCC 35910]
 gi|300503699|gb|EFK34839.1| 50S ribosomal protein L20 [Chryseobacterium gleum ATCC 35910]
          Length = 114

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+ K AKG++GRRKN    AK AV+++ QYAYR R+ KKR+FR+L
Sbjct: 1   MPRSVNAVASRARRKKIFKHAKGYFGRRKNVWTVAKNAVEKAMQYAYRGRKEKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R + ++YSQF+  L K  I L+RKVL+DLA+   ++FK +V+
Sbjct: 61  WITRINAGTREHGMSYSQFMGALKKNNIELNRKVLADLAMNHPEAFKAVVD 111


>gi|91215267|ref|ZP_01252239.1| 50S ribosomal protein L20 [Psychroflexus torquis ATCC 700755]
 gi|91186872|gb|EAS73243.1| 50S ribosomal protein L20 [Psychroflexus torquis ATCC 700755]
          Length = 114

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 80/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK++K AKG++GRRKN    AK AV+++  YAYRDR+ KKR+FRSL
Sbjct: 1   MPRSTNSVASRARRKKIMKQAKGYFGRRKNVWTIAKNAVEKAMLYAYRDRKTKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R++ L+YSQF+  +    I L+RKVL+DLA+   ++FK +V+
Sbjct: 61  WIIRINAAARLHGLSYSQFMGKVKAHNIELNRKVLADLAMNNPEAFKAVVD 111


>gi|293363863|ref|ZP_06610599.1| ribosomal protein L20 [Mycoplasma alligatoris A21JP2]
 gi|292552353|gb|EFF41127.1| ribosomal protein L20 [Mycoplasma alligatoris A21JP2]
          Length = 117

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 82/114 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK LK AKG++G +    + AK AV +S  YA+RDR+  KR+FR L
Sbjct: 1   MARVKGGTVTRARRKKWLKLAKGYFGHKSVGYKVAKQAVVKSWTYAFRDRKQVKRNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R   ++YS+FINGL KA I+++RK+LS+LAI +  +F  +VEL+R
Sbjct: 61  WIARINAATRAAGMSYSRFINGLKKANILINRKMLSELAINEPKTFATLVELAR 114


>gi|258515610|ref|YP_003191832.1| 50S ribosomal protein L20 [Desulfotomaculum acetoxidans DSM 771]
 gi|257779315|gb|ACV63209.1| ribosomal protein L20 [Desulfotomaculum acetoxidans DSM 771]
          Length = 118

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GV    +HKK+LK AKG+ G R    R A  +V ++  YAYRDR+ +KRDFR L
Sbjct: 1   MSRVKSGVTRRKRHKKILKLAKGYRGSRSKLFRVANQSVMKALSYAYRDRKARKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+Y++F+NGL +AG+ ++RK+L++LA+    SF ++V++++S+L
Sbjct: 61  WIARINAAARTNGLSYNKFMNGLKQAGVEVNRKMLAELAVNDNQSFVQLVQIAKSKL 117


>gi|295107328|emb|CBL04871.1| LSU ribosomal protein L20P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 117

 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  AKG+YG +  + RAAK  V  S QY YRDRR KKR+ R L
Sbjct: 1   MARVKRAVSAHKKRRTVLNRAKGYYGAKSRSYRAAKEQVQHSLQYMYRDRRNKKREIRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  +NGL KAG+ LDRKVLSD+A+    +F  I E+++  L
Sbjct: 61  WITRINAAARINGMSYSVLMNGLKKAGVQLDRKVLSDMAVNDPAAFTAITEVAKKAL 117


>gi|226355446|ref|YP_002785186.1| 50S ribosomal protein L20 [Deinococcus deserti VCD115]
 gi|259646179|sp|C1D0Q8|RL20_DEIDV RecName: Full=50S ribosomal protein L20
 gi|226317436|gb|ACO45432.1| putative 50S ribosomal protein L20 [Deinococcus deserti VCD115]
          Length = 117

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 79/115 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK AKGF G R    R A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MPRVKTGTVRRRRHKKVLKRAKGFEGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           W+QRINA  R++ +NYS FI GL +AG+ L+RKVL+D+A  + ++FK +V+ +++
Sbjct: 61  WVQRINAGARLHGMNYSTFIGGLKRAGVDLNRKVLADIAAREPEAFKALVDAAKN 115


>gi|300856607|ref|YP_003781591.1| 50S ribosomal protein L20 [Clostridium ljungdahlii DSM 13528]
 gi|300436722|gb|ADK16489.1| 50S ribosomal protein L20 [Clostridium ljungdahlii DSM 13528]
          Length = 119

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   HKK+LK AKG+YG +    R A   V R+ +Y+Y  RR+KKRDFR L
Sbjct: 1   MARVKRAVNARKHHKKILKLAKGYYGGKSRLFRTANETVLRALRYSYIGRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FING+  AGI ++RK+LS++AI     F ++VE+++ +L
Sbjct: 61  WIARINAATRMNGLSYSKFINGIKTAGINMNRKMLSEIAINDPKGFTELVEVAKKQL 117


>gi|77919022|ref|YP_356837.1| 50S ribosomal protein L20 [Pelobacter carbinolicus DSM 2380]
 gi|109893131|sp|Q3A4P0|RL20_PELCD RecName: Full=50S ribosomal protein L20
 gi|77545105|gb|ABA88667.1| LSU ribosomal protein L20P [Pelobacter carbinolicus DSM 2380]
          Length = 118

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARRRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA+ R   L+YS+ ++GL KA I LDRK+L++LA+T    F  I + ++++L
Sbjct: 61  WIARINASARENGLSYSRLVHGLKKAEIALDRKILAELAVTDPAGFTAIADKAKAQL 117


>gi|315453310|ref|YP_004073580.1| 50S ribosomal protein L20 [Helicobacter felis ATCC 49179]
 gi|315132362|emb|CBY82990.1| 50S ribosomal protein L20 [Helicobacter felis ATCC 49179]
          Length = 116

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 80/109 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKRDFRSLWI
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSLCYAFRDRKQKKRDFRSLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS+F++ L  A I LDRKVL+D+A++   +F  ++E
Sbjct: 62  VRINAACRMHNTSYSRFMHALKSANIELDRKVLADMAMSDAHAFSALLE 110


>gi|317502975|ref|ZP_07961064.1| 50S ribosomal protein L20 [Prevotella salivae DSM 15606]
 gi|315665911|gb|EFV05489.1| 50S ribosomal protein L20 [Prevotella salivae DSM 15606]
          Length = 114

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+ +++YS  +  LHKAGI ++RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAAARLENMSYSTLMGALHKAGIEINRKVLADLAVNNPEAFKAIVD 111


>gi|325298800|ref|YP_004258717.1| 50S ribosomal protein L20 [Bacteroides salanitronis DSM 18170]
 gi|324318353|gb|ADY36244.1| 50S ribosomal protein L20 [Bacteroides salanitronis DSM 18170]
          Length = 116

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+LK  +G++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKILKLTRGYFGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+  ++YSQ +  LHKAGI ++RKVL+DLA+   ++FK +VE
Sbjct: 61  WIQRINAAARLEGMSYSQLMGALHKAGIEINRKVLADLAMNHPEAFKAVVE 111


>gi|319954100|ref|YP_004165367.1| lsu ribosomal protein l20p [Cellulophaga algicola DSM 14237]
 gi|319422760|gb|ADV49869.1| LSU ribosomal protein L20P [Cellulophaga algicola DSM 14237]
          Length = 114

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV+++  YAYRDRR KKR+FRSL
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVEKAMLYAYRDRRNKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YSQF+  +    I L+RKVL+DLA+   ++FK +V+
Sbjct: 61  WITRINAGARLHGMSYSQFMGKVKANNIELNRKVLADLAMNHPEAFKAVVQ 111


>gi|325283503|ref|YP_004256044.1| 50S ribosomal protein L20 [Deinococcus proteolyticus MRP]
 gi|324315312|gb|ADY26427.1| 50S ribosomal protein L20 [Deinococcus proteolyticus MRP]
          Length = 123

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 79/114 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G++   +HKKVLK AKGF+G R    R A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MARSKTGIIRRRRHKKVLKRAKGFWGTRSKLYRNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R++ +NYS F+NGL  AG+ L+RKVL+D+A  + ++FK +V+ ++
Sbjct: 61  WIQRINAGARLHGMNYSTFMNGLKVAGVDLNRKVLADIAAREPETFKALVDTAK 114


>gi|261415201|ref|YP_003248884.1| ribosomal protein L20 [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|261371657|gb|ACX74402.1| ribosomal protein L20 [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|302326486|gb|ADL25687.1| ribosomal protein L20 [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 116

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 82/115 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  V S  + KK+LK+AKG+YGRRK+ +R A  AV  + QYAY  RR KK DFRSL
Sbjct: 1   MPRAKTRVPSRERRKKILKAAKGYYGRRKSNLRLAIDAVAHAGQYAYAHRRDKKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI R+NAAVR + ++YSQFI  L KA I ++RKVL+DLA+    +F K+VE+ ++
Sbjct: 61  WITRLNAAVREFGISYSQFIYKLSKANINMNRKVLADLAVADPAAFAKVVEIVKA 115


>gi|255035017|ref|YP_003085638.1| 50S ribosomal protein L20 [Dyadobacter fermentans DSM 18053]
 gi|254947773|gb|ACT92473.1| ribosomal protein L20 [Dyadobacter fermentans DSM 18053]
          Length = 114

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/111 (55%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK AKG++GRRKN    AK AV+R   YAY  R+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKVLKLAKGYFGRRKNVWTVAKNAVERGLAYAYEGRKQKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R + L+YS FI  L+  GI L+RKVL+DLA+   D+FK IV+
Sbjct: 61  WIQRINAGTRQHGLSYSAFIGKLNAKGIELNRKVLADLAMNHPDAFKAIVD 111


>gi|254481700|ref|ZP_05094943.1| ribosomal protein L20 [marine gamma proteobacterium HTCC2148]
 gi|214037829|gb|EEB78493.1| ribosomal protein L20 [marine gamma proteobacterium HTCC2148]
          Length = 111

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 78/110 (70%)

Query: 8   VVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINA 67
           +V+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+LWI RINA
Sbjct: 1   MVAHRRHKKILKQAKGYYGARSRVFRVAKQAVTKAGQYAYRDRRQRKRQFRALWITRINA 60

Query: 68  AVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
             R   L+YS+ INGL KA I LDR+VL+DLA+    +F  IVE +++ L
Sbjct: 61  QSRANGLSYSRLINGLKKADIALDRRVLADLAVHDKPAFAAIVEQAKASL 110


>gi|319949972|ref|ZP_08023961.1| 50S ribosomal protein L20 [Dietzia cinnamea P4]
 gi|319436368|gb|EFV91499.1| 50S ribosomal protein L20 [Dietzia cinnamea P4]
          Length = 126

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+S KG+ G+R    R AK  +  S  Y+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTVLESTKGYRGQRSRLYRKAKEQMLHSMTYSYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++F+ GL  AG+ +DRKVL+DLA+T   +F  +VE++R  L  D
Sbjct: 61  WISRINAAARANDMTYNRFVQGLKLAGVEVDRKVLADLAVTDPAAFTALVEVARKALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|15644756|ref|NP_206926.1| 50S ribosomal protein L20 [Helicobacter pylori 26695]
 gi|2500290|sp|P56045|RL20_HELPY RecName: Full=50S ribosomal protein L20
 gi|2313209|gb|AAD07194.1| ribosomal protein L20 (rpl20) [Helicobacter pylori 26695]
          Length = 116

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 80/109 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKR+FRSLW+
Sbjct: 2   RVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R+++ +YS+F++ L  A I LDRKVL+D+A+  + +F  ++E
Sbjct: 62  VRINAACRMHNTSYSRFMHALKVANIELDRKVLADMAMNDMQAFTSVLE 110


>gi|255534994|ref|YP_003095365.1| LSU ribosomal protein L20p [Flavobacteriaceae bacterium 3519-10]
 gi|255341190|gb|ACU07303.1| LSU ribosomal protein L20p [Flavobacteriaceae bacterium 3519-10]
          Length = 114

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKGF+GRRKN    AK AV ++ QYAYR R+ KKR FRSL
Sbjct: 1   MPRSVNAVASRARRKKVMKLAKGFFGRRKNVWTVAKNAVQKAMQYAYRGRKEKKRSFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R + + YSQF+  L    I L+RKVL+DLA+   ++FK +V+
Sbjct: 61  WIMRINAGAREHGMTYSQFMGALKSNNIELNRKVLADLAMNHPEAFKAVVD 111


>gi|89891846|ref|ZP_01203347.1| 50S ribosomal protein L20 [Flavobacteria bacterium BBFL7]
 gi|89515751|gb|EAS18552.1| 50S ribosomal protein L20 [Flavobacteria bacterium BBFL7]
          Length = 114

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  V S A+ K+VLK AKG++GRRKN    AK AV+++  Y+YRDRR KKR FR+L
Sbjct: 1   MPRAKNRVASRARRKRVLKQAKGYFGRRKNVWTVAKNAVEKAMSYSYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YSQF+  + K  I L+RKVL+DLA+   ++F+ +V 
Sbjct: 61  WITRINAGARMHGMSYSQFMGAVKKNDIELNRKVLADLAMNHPEAFEAVVN 111


>gi|313836586|gb|EFS74300.1| ribosomal protein L20 [Propionibacterium acnes HL037PA2]
 gi|314928096|gb|EFS91927.1| ribosomal protein L20 [Propionibacterium acnes HL044PA1]
 gi|314972096|gb|EFT16193.1| ribosomal protein L20 [Propionibacterium acnes HL037PA3]
          Length = 123

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 84/123 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL+ A G+ G+R    R AK     S  Y++RDRR KK DFRSL
Sbjct: 1   MARVKRSVNAKKKRREVLEQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FINGL  AG+ +DRKVL++LA++ +D+F  +VE++++    +
Sbjct: 61  WIQRINAASRAQGMTYNRFINGLKNAGVEVDRKVLAELAVSDIDAFNSLVEVAKANQPQN 120

Query: 121 VAS 123
            A+
Sbjct: 121 AAA 123


>gi|305664646|ref|YP_003860933.1| 50S ribosomal protein L20 [Maribacter sp. HTCC2170]
 gi|88707347|gb|EAQ99593.1| 50S ribosomal protein L20 [Maribacter sp. HTCC2170]
          Length = 114

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV+++  YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNAVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVEKAMLYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YSQF+  +    I L+RKVL+DLA+   D+FK IV+
Sbjct: 61  WITRINAGARLHGMSYSQFMGKVKANNIELNRKVLADLAMNHPDAFKAIVD 111


>gi|148264669|ref|YP_001231375.1| 50S ribosomal protein L20 [Geobacter uraniireducens Rf4]
 gi|189041865|sp|A5G4T4|RL20_GEOUR RecName: Full=50S ribosomal protein L20
 gi|146398169|gb|ABQ26802.1| LSU ribosomal protein L20P [Geobacter uraniireducens Rf4]
          Length = 117

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ I+GL  A + +DRKV++DLA++    F +I  L+++ +
Sbjct: 61  WIARINAAARINGLSYSKLIHGLKIAKVEVDRKVMADLAVSDPRGFAEIASLAKANI 117


>gi|15828732|ref|NP_326092.1| 50S ribosomal protein L20 [Mycoplasma pulmonis UAB CTIP]
 gi|20978647|sp|Q98QV0|RL20_MYCPU RecName: Full=50S ribosomal protein L20
 gi|14089674|emb|CAC13434.1| 50S RIBOSOMAL PROTEIN L20 [Mycoplasma pulmonis]
          Length = 116

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 83/113 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ KK LK AKG++G +    + AK AV +S  YA+RDR+  KR+FR LWI
Sbjct: 2   RVKGGTVTRARRKKWLKLAKGYWGHKSIGYKVAKQAVVKSWTYAFRDRKQVKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
            RINAAVR   ++YSQFINGL KA + ++RK+LS+LAI ++ +F+ +V +S+S
Sbjct: 62  SRINAAVRPLGMSYSQFINGLKKANVKINRKMLSELAIREMKTFEMLVSISKS 114


>gi|146297793|ref|YP_001192384.1| 50S ribosomal protein L20 [Flavobacterium johnsoniae UW101]
 gi|189041863|sp|A5FP04|RL20_FLAJO RecName: Full=50S ribosomal protein L20
 gi|146152211|gb|ABQ03065.1| 50S ribosomal protein L20 [Flavobacterium johnsoniae UW101]
          Length = 114

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KK++K AKGF+GRRKN    AK AV+++  YAYRDR+  KR+FRSL
Sbjct: 1   MPRSVNSVAKRARRKKIMKQAKGFFGRRKNVWTVAKNAVEKAMSYAYRDRKQNKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINA  R+  ++YSQF+  +   GI L+RKVL+DLA+   ++FK I+
Sbjct: 61  WIQRINAGARLEGMSYSQFMGKVKANGIELNRKVLADLAMNHPEAFKAIL 110


>gi|307244175|ref|ZP_07526290.1| ribosomal protein L20 [Peptostreptococcus stomatis DSM 17678]
 gi|306492325|gb|EFM64363.1| ribosomal protein L20 [Peptostreptococcus stomatis DSM 17678]
          Length = 118

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+G+ +  +HKKVLK AKG+ G R    + +   V ++ + AY  R+ KKRDFR L
Sbjct: 1   MARVKKGMNAHKRHKKVLKLAKGYQGSRSKLFKTSNQFVMKALKNAYIGRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+ D++YS+F+NGL KAG+ ++RK+LS+LAI   D F K+V +++  L
Sbjct: 61  WIQRINAACRMNDMSYSKFMNGLKKAGVEVNRKMLSELAIADPDGFAKLVAVAKENL 117


>gi|315608033|ref|ZP_07883026.1| 50S ribosomal protein L20 [Prevotella buccae ATCC 33574]
 gi|315250502|gb|EFU30498.1| 50S ribosomal protein L20 [Prevotella buccae ATCC 33574]
          Length = 114

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R    V S A+ K++LK  KG++G RKN    AK   ++   YAYRDRR KKR FR+L
Sbjct: 1   MSRSVNHVASRARRKRILKLTKGYFGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+ +++YSQ +  LHKAGI ++RKVL+DLA+    +FK IV+
Sbjct: 61  WIQRINAAARLENMSYSQLMGALHKAGIEINRKVLADLAVNNPQAFKAIVD 111


>gi|300813854|ref|ZP_07094159.1| ribosomal protein L20 [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|300512041|gb|EFK39236.1| ribosomal protein L20 [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 116

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 83/115 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HK +LK AKG++G +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKNILKQAKGYFGAKSKLFRPANQAVMKSLSYAYIGRKQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R++ ++YS+FI+GL KAG+ ++RK+LS++AI     FK++V+++++
Sbjct: 61  WITRINAATRLHGMSYSKFISGLKKAGVNINRKMLSEMAINDPQGFKELVDIAKA 115


>gi|257784329|ref|YP_003179546.1| 50S ribosomal protein L20 [Atopobium parvulum DSM 20469]
 gi|257472836|gb|ACV50955.1| ribosomal protein L20 [Atopobium parvulum DSM 20469]
          Length = 119

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V    K + +++  KG+YG    T R  K     S QYAYRDRR KKRDFR+L
Sbjct: 1   MARVKRAVAGRKKRQTLVERTKGYYGTSSRTFRGMKEQSQHSGQYAYRDRRNKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+ DL+YS+F++GL  AG+ LDRKVL+++A +    F  + E+++  L
Sbjct: 61  WIQRINAAARINDLSYSKFMHGLKLAGVELDRKVLAEIAYSDEQGFADLAEIAKKAL 117


>gi|320531670|ref|ZP_08032610.1| ribosomal protein L20 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320136090|gb|EFW28098.1| ribosomal protein L20 [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 126

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YA+RDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEKASGYRGQRSRLYRKAKEQVTHSGVYAFRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA RV  L Y++FI GL  AG+ +DR++L++LA+ + + FK +VE++R  L  D
Sbjct: 61  WIQRINAAARVEGLTYNRFIQGLGLAGVEIDRRMLAELAVNEPEGFKALVEVARKALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|326336125|ref|ZP_08202297.1| 50S ribosomal protein L20 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325691634|gb|EGD33601.1| 50S ribosomal protein L20 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 114

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KK++K AKG++GRRKN    AK AV+++  YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNAVARRARRKKIMKQAKGYFGRRKNVWTVAKNAVEKALVYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA VR Y L+YS+F+  L    I L+RKVL+DLA+   ++FK IVE
Sbjct: 61  WIVRINAGVRPYGLSYSKFMGALRANEIELNRKVLADLAMNHPEAFKAIVE 111


>gi|303242605|ref|ZP_07329081.1| ribosomal protein L20 [Acetivibrio cellulolyticus CD2]
 gi|302589862|gb|EFL59634.1| ribosomal protein L20 [Acetivibrio cellulolyticus CD2]
          Length = 117

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 80/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK  + + A+HKK+LK AKG++G +    R A  AV +S  YAYRDR+ KKR FR L
Sbjct: 1   MSRVKGAMRTRARHKKILKLAKGYFGMKSKNYRLANQAVMKSLVYAYRDRKAKKRSFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+  L+YS+F++GL K+GI L+RK+L+++A+    SF ++ E
Sbjct: 61  WIARINAAARINGLSYSKFMSGLKKSGITLNRKMLAEMAVNDASSFAQLAE 111


>gi|295399481|ref|ZP_06809463.1| ribosomal protein L20 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109960|ref|YP_003988276.1| ribosomal protein L20 [Geobacillus sp. Y4.1MC1]
 gi|294978947|gb|EFG54543.1| ribosomal protein L20 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215061|gb|ADP73665.1| ribosomal protein L20 [Geobacillus sp. Y4.1MC1]
          Length = 118

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    R A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L+YS+F++GL  AG+ ++RK+L+DLA+    +F ++ EL++S+L
Sbjct: 61  WITRINAAARTHGLSYSRFMHGLKLAGVEVNRKMLADLAVNDQAAFAQLAELAKSKL 117


>gi|313888422|ref|ZP_07822090.1| ribosomal protein L20 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845619|gb|EFR33012.1| ribosomal protein L20 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 116

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 81/116 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HK +LK +KG++G +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRGVNAKKRHKNILKQSKGYFGAKSKLFRTANQAVMKSLNYAYIGRKQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  ++YS+FI+GL KA I ++RK+LS++AI     F K+VE+++ +
Sbjct: 61  WITRINAAARINGMSYSKFISGLKKANITINRKMLSEMAINDPAGFAKLVEIAKEQ 116


>gi|228472719|ref|ZP_04057477.1| ribosomal protein L20 [Capnocytophaga gingivalis ATCC 33624]
 gi|228275770|gb|EEK14536.1| ribosomal protein L20 [Capnocytophaga gingivalis ATCC 33624]
          Length = 114

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KK++K AKG++GRRKN    AK AV+++  YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNAVARRARRKKIMKQAKGYFGRRKNVWTVAKNAVEKALVYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA VR Y L+YS+F+  L    I L+RKVL+DLA+   ++FK IVE
Sbjct: 61  WIVRINAGVRPYGLSYSKFMGALKANKIELNRKVLADLALNHPEAFKAIVE 111


>gi|85858500|ref|YP_460702.1| 50S ribosomal protein L20 [Syntrophus aciditrophicus SB]
 gi|109893159|sp|Q2LR24|RL20_SYNAS RecName: Full=50S ribosomal protein L20
 gi|85721591|gb|ABC76534.1| LSU ribosomal protein L20P [Syntrophus aciditrophicus SB]
          Length = 119

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKR V +  K +K+ K AKGF+G R   +R A  AV+R+  YA+RDRRV+KR+FR L
Sbjct: 1   MSRVKRSVTAKKKRRKIFKLAKGFFGARSRLLRTATEAVNRALNYAFRDRRVRKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R   L YS+ I+GL K+ + +DRKVL+D+A+     F +IV L++ 
Sbjct: 61  WIARINAASRAQGLTYSRLIDGLRKSHVEIDRKVLADIAVNDPRGFSEIVLLAKG 115


>gi|281420274|ref|ZP_06251273.1| ribosomal protein L20 [Prevotella copri DSM 18205]
 gi|281405769|gb|EFB36449.1| ribosomal protein L20 [Prevotella copri DSM 18205]
          Length = 114

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/110 (53%), Positives = 75/110 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  ++YSQ +  LHKAGI ++RKVL+DLA+   ++FK IV
Sbjct: 61  WIQRINAAARLDGMSYSQLMGALHKAGIEINRKVLADLAVNNPEAFKAIV 110


>gi|332292751|ref|YP_004431360.1| ribosomal protein L20 [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170837|gb|AEE20092.1| ribosomal protein L20 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 114

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKV+K AKG++GRRKN    AK AVD++  YAYRDRR  KR+FRSL
Sbjct: 1   MPRSVNSVAKRARRKKVMKQAKGYFGRRKNVWTVAKNAVDKAMSYAYRDRRQNKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YSQF+  +   GI L+RKVL+DLA+   ++F+ ++ 
Sbjct: 61  WITRINAGARMHGMSYSQFMGKVKANGIELNRKVLADLAMNHPEAFEAVIN 111


>gi|78189668|ref|YP_380006.1| 50S ribosomal protein L20 [Chlorobium chlorochromatii CaD3]
 gi|109893104|sp|Q3APW2|RL20_CHLCH RecName: Full=50S ribosomal protein L20
 gi|78171867|gb|ABB28963.1| LSU ribosomal protein L20P [Chlorobium chlorochromatii CaD3]
          Length = 115

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 76/113 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M +    V S A+ K++LK AKGF+G R N +   K +VD+++QYAYRDRR KKR FRSL
Sbjct: 1   MPKANNAVASRARRKRILKKAKGFWGARGNVLTVVKHSVDKAEQYAYRDRRAKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAA R+    YSQ ING+ K  I +DRK L+++A+    +F  IV+ +
Sbjct: 61  WIMRINAAARLNGTTYSQLINGMAKNNIQIDRKALAEIAVKDAAAFSAIVQAA 113


>gi|312127731|ref|YP_003992605.1| 50S ribosomal protein L20 [Caldicellulosiruptor hydrothermalis 108]
 gi|311777750|gb|ADQ07236.1| ribosomal protein L20 [Caldicellulosiruptor hydrothermalis 108]
          Length = 119

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 83/116 (71%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LW
Sbjct: 1   MRIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYVGRRLKKRDFRRLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RINAA R   L+YS+F+NGL KAGI L+RKVL+D+A+    +F ++VE+++ ++
Sbjct: 61  ITRINAAARQNGLSYSKFMNGLKKAGINLNRKVLADMAVNDQKAFAELVEIAKKQI 116


>gi|160946415|ref|ZP_02093624.1| hypothetical protein PEPMIC_00375 [Parvimonas micra ATCC 33270]
 gi|158447531|gb|EDP24526.1| hypothetical protein PEPMIC_00375 [Parvimonas micra ATCC 33270]
          Length = 114

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 79/114 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KR + +  KH+KVLK AKG+YG +    + A  A+ +S  YA+  R+ KKRDFRSL
Sbjct: 1   MARIKRSLNARKKHRKVLKQAKGYYGAKSKLFKVANQAIMKSMTYAFIGRKRKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R Y L+YS+F+ GL K  I ++RK+LS++AI   + FKK+VEL R
Sbjct: 61  WIARINAGTRQYGLSYSKFMYGLKKNNINMNRKMLSEMAINDPEGFKKLVELVR 114


>gi|50086059|ref|YP_047569.1| 50S ribosomal protein L20 [Acinetobacter sp. ADP1]
 gi|126640666|ref|YP_001083650.1| 50S ribosomal protein L20 [Acinetobacter baumannii ATCC 17978]
 gi|169797151|ref|YP_001714944.1| 50S ribosomal protein L20 [Acinetobacter baumannii AYE]
 gi|184156921|ref|YP_001845260.1| 50S ribosomal protein L20 [Acinetobacter baumannii ACICU]
 gi|213156059|ref|YP_002318104.1| ribosomal protein L20 [Acinetobacter baumannii AB0057]
 gi|215484614|ref|YP_002326849.1| ribosomal protein L20 [Acinetobacter baumannii AB307-0294]
 gi|226954301|ref|ZP_03824765.1| 50S ribosomal protein L20 [Acinetobacter sp. ATCC 27244]
 gi|239500695|ref|ZP_04660005.1| 50S ribosomal protein L20 [Acinetobacter baumannii AB900]
 gi|260551936|ref|ZP_05825798.1| ribosomal protein L20 [Acinetobacter sp. RUH2624]
 gi|260556054|ref|ZP_05828273.1| ribosomal protein L20 [Acinetobacter baumannii ATCC 19606]
 gi|262281015|ref|ZP_06058798.1| ribosomal protein L20 [Acinetobacter calcoaceticus RUH2202]
 gi|262374314|ref|ZP_06067590.1| ribosomal protein L20 [Acinetobacter junii SH205]
 gi|293610412|ref|ZP_06692713.1| 50S ribosomal protein L20 [Acinetobacter sp. SH024]
 gi|294649372|ref|ZP_06726803.1| 50S ribosomal protein L20 [Acinetobacter haemolyticus ATCC 19194]
 gi|299771529|ref|YP_003733555.1| 50S ribosomal protein L20 [Acinetobacter sp. DR1]
 gi|301345038|ref|ZP_07225779.1| 50S ribosomal protein L20 [Acinetobacter baumannii AB056]
 gi|301510737|ref|ZP_07235974.1| 50S ribosomal protein L20 [Acinetobacter baumannii AB058]
 gi|301596047|ref|ZP_07241055.1| 50S ribosomal protein L20 [Acinetobacter baumannii AB059]
 gi|332856890|ref|ZP_08436299.1| ribosomal protein L20 [Acinetobacter baumannii 6013150]
 gi|332867207|ref|ZP_08437472.1| ribosomal protein L20 [Acinetobacter baumannii 6013113]
 gi|332874002|ref|ZP_08441937.1| ribosomal protein L20 [Acinetobacter baumannii 6014059]
 gi|60390407|sp|Q6F868|RL20_ACIAD RecName: Full=50S ribosomal protein L20
 gi|166219597|sp|A3M2A4|RL20_ACIBT RecName: Full=50S ribosomal protein L20
 gi|226730337|sp|B7GZZ9|RL20_ACIB3 RecName: Full=50S ribosomal protein L20
 gi|226730338|sp|B7I694|RL20_ACIB5 RecName: Full=50S ribosomal protein L20
 gi|226730339|sp|B2HTH6|RL20_ACIBC RecName: Full=50S ribosomal protein L20
 gi|226730341|sp|B0V5Q9|RL20_ACIBY RecName: Full=50S ribosomal protein L20
 gi|49532035|emb|CAG69747.1| 50S ribosomal protein L20, also posttranslational autoregulator
           [Acinetobacter sp. ADP1]
 gi|126386550|gb|ABO11048.1| 50S ribosomal protein L20 [Acinetobacter baumannii ATCC 17978]
 gi|169150078|emb|CAM87972.1| 50S ribosomal protein L20, also posttranslational autoregulator
           [Acinetobacter baumannii AYE]
 gi|183208515|gb|ACC55913.1| putative 50S ribosomal protein L20 [Acinetobacter baumannii ACICU]
 gi|213055219|gb|ACJ40121.1| ribosomal protein L20 [Acinetobacter baumannii AB0057]
 gi|213987996|gb|ACJ58295.1| ribosomal protein L20 [Acinetobacter baumannii AB307-0294]
 gi|226834972|gb|EEH67355.1| 50S ribosomal protein L20 [Acinetobacter sp. ATCC 27244]
 gi|260405339|gb|EEW98834.1| ribosomal protein L20 [Acinetobacter sp. RUH2624]
 gi|260410109|gb|EEX03408.1| ribosomal protein L20 [Acinetobacter baumannii ATCC 19606]
 gi|262257915|gb|EEY76650.1| ribosomal protein L20 [Acinetobacter calcoaceticus RUH2202]
 gi|262310872|gb|EEY91960.1| ribosomal protein L20 [Acinetobacter junii SH205]
 gi|292824742|gb|EFF83514.1| 50S ribosomal protein L20 [Acinetobacter haemolyticus ATCC 19194]
 gi|292827644|gb|EFF86008.1| 50S ribosomal protein L20 [Acinetobacter sp. SH024]
 gi|298701617|gb|ADI92182.1| 50S ribosomal protein L20 [Acinetobacter sp. DR1]
 gi|322506817|gb|ADX02271.1| rplT [Acinetobacter baumannii 1656-2]
 gi|323516686|gb|ADX91067.1| 50S ribosomal protein L20 [Acinetobacter baumannii TCDC-AB0715]
 gi|325124568|gb|ADY84091.1| rplT; 50S ribosomal protein L20 [Acinetobacter calcoaceticus
           PHEA-2]
 gi|332726944|gb|EGJ58449.1| ribosomal protein L20 [Acinetobacter baumannii 6013150]
 gi|332734146|gb|EGJ65278.1| ribosomal protein L20 [Acinetobacter baumannii 6013113]
 gi|332737743|gb|EGJ68635.1| ribosomal protein L20 [Acinetobacter baumannii 6014059]
          Length = 119

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVVAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I+GL KA +++DR+VL+D+A+    +F  + E ++  L
Sbjct: 61  WIARINAGARQNGLSYSRMIDGLKKAQVIIDRRVLADIAMHDAVAFAALAEKAKGAL 117


>gi|237750834|ref|ZP_04581314.1| ribosomal protein L20 [Helicobacter bilis ATCC 43879]
 gi|229373279|gb|EEO23670.1| ribosomal protein L20 [Helicobacter bilis ATCC 43879]
          Length = 113

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 78/110 (70%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVK G+V   +HKK+LK A+GFY  R+   R AK  ++RS  YA+RDR+ KKRDFR LW
Sbjct: 1   MRVKTGIVRRRRHKKILKLARGFYSGRRKHFRKAKEQLERSMCYAFRDRKQKKRDFRKLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           I RINAA R++ ++YS+F+  L KA I LDRK+L+D+A +   +F  +VE
Sbjct: 61  IVRINAACRLHGMSYSKFMFALKKANIELDRKILADMAYSNPSAFASLVE 110


>gi|260062393|ref|YP_003195473.1| 50S ribosomal protein L20 [Robiginitalea biformata HTCC2501]
 gi|88783956|gb|EAR15127.1| 50S ribosomal protein L20 [Robiginitalea biformata HTCC2501]
          Length = 114

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV+++  YAYRDRR KKR FRSL
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVEKAMLYAYRDRRNKKRSFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R + ++YSQF+  +    I L+RKVL+DLA+   D+FK IV+
Sbjct: 61  WIARINAGARQHGMSYSQFMGRVKANNIELNRKVLADLAMNHPDAFKAIVD 111


>gi|86134207|ref|ZP_01052789.1| 50S ribosomal protein L20 [Polaribacter sp. MED152]
 gi|85821070|gb|EAQ42217.1| 50S ribosomal protein L20 [Polaribacter sp. MED152]
          Length = 114

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+LK+AKG++GRRKN    AK AV++   YAYRDR+  KR+FRSL
Sbjct: 1   MPRSVNSVASRNRRKKILKAAKGYFGRRKNVYTVAKNAVEKGMLYAYRDRKNNKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+  ++YSQF+  +    I L+RKVL+DLA+   D+FK +VE
Sbjct: 61  WITRINAAARLNGMSYSQFMGKVKANNIQLNRKVLADLAVNNPDAFKAVVE 111


>gi|288801331|ref|ZP_06406785.1| ribosomal protein L20 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288331714|gb|EFC70198.1| ribosomal protein L20 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 114

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+  ++LK  KG++G RKN    AK   ++   YAYRDRR KKR+FRSL
Sbjct: 1   MPRSVNHVASKARRTRILKLTKGYFGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+ ++ YS  +  LHKAGI ++RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAAARLENMTYSTLMGALHKAGIEINRKVLADLAVNNPEAFKAIVD 111


>gi|312898391|ref|ZP_07757781.1| ribosomal protein L20 [Megasphaera micronuciformis F0359]
 gi|310620310|gb|EFQ03880.1| ribosomal protein L20 [Megasphaera micronuciformis F0359]
          Length = 116

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 84/116 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K GV + A+HKK++K AKG+ G R    + A  +V ++  YA RDRR KKR+FR L
Sbjct: 1   MARIKVGVTAHARHKKIIKMAKGYRGTRSRLFKKANESVMKALFYARRDRRQKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   ++YS+FINGL KAG+ ++RK+L+DLA+    +F K+VE+++++
Sbjct: 61  WIARINAATRANGMSYSRFINGLTKAGVEVNRKMLADLAVNDAAAFAKLVEVAKAQ 116


>gi|220931405|ref|YP_002508313.1| ribosomal protein L20 [Halothermothrix orenii H 168]
 gi|219992715|gb|ACL69318.1| ribosomal protein L20 [Halothermothrix orenii H 168]
          Length = 119

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  + KK+LK AKG++G R    R A  AV +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKRGYKARRRRKKILKMAKGYFGGRSKLFRPANQAVMKSLHYAYRDRRARKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FI+GL KA I ++RK+L+D+AI   +SF ++  +++  L
Sbjct: 61  WITRINAAARQEGISYSKFIHGLKKADIQINRKMLADMAIKDKESFSELAAIAKKEL 117


>gi|222529197|ref|YP_002573079.1| 50S ribosomal protein L20 [Caldicellulosiruptor bescii DSM 6725]
 gi|312622556|ref|YP_004024169.1| 50S ribosomal protein L20 [Caldicellulosiruptor kronotskyensis
           2002]
 gi|254800295|sp|B9MRK2|RL20_ANATD RecName: Full=50S ribosomal protein L20
 gi|222456044|gb|ACM60306.1| ribosomal protein L20 [Caldicellulosiruptor bescii DSM 6725]
 gi|312203023|gb|ADQ46350.1| ribosomal protein L20 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 119

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 83/116 (71%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LW
Sbjct: 1   MRIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRRLKKRDFRRLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RINAA R   L+YS+F+NGL KAGI L+RKVL+D+A+    +F ++VE+++ ++
Sbjct: 61  ITRINAAARQNGLSYSKFMNGLKKAGINLNRKVLADMAVNDQKAFAELVEIAKKQI 116


>gi|312135022|ref|YP_004002360.1| 50S ribosomal protein L20 [Caldicellulosiruptor owensensis OL]
 gi|311775073|gb|ADQ04560.1| ribosomal protein L20 [Caldicellulosiruptor owensensis OL]
          Length = 119

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 83/116 (71%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LW
Sbjct: 1   MRIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRRLKKRDFRRLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RINAA R   L+YS+F+NGL KAGI L+RKVL+D+A+    +F ++VE+++ ++
Sbjct: 61  ITRINAAARQNGLSYSRFMNGLKKAGINLNRKVLADMAVNDQKAFAELVEIAKKQI 116


>gi|319892725|ref|YP_004149600.1| LSU ribosomal protein L20p [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162421|gb|ADV05964.1| LSU ribosomal protein L20p [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464242|gb|ADX76395.1| ribosomal protein L20 [Staphylococcus pseudintermedius ED99]
          Length = 118

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGAKSTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL +AGI ++RK+LS++AI+   +F ++V  +++ L
Sbjct: 61  WITRINAAARQHDMSYSRLMNGLKQAGIDVNRKMLSEIAISDEKAFAELVNQAKAAL 117


>gi|221194604|ref|ZP_03567661.1| ribosomal protein L20 [Atopobium rimae ATCC 49626]
 gi|221185508|gb|EEE17898.1| ribosomal protein L20 [Atopobium rimae ATCC 49626]
          Length = 119

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 1/120 (0%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR +    K + +++  KG+YG R  T R  K     S QYAYRDRR KKR+FR+L
Sbjct: 1   MARVKRAMAGRKKRQTLVERTKGYYGVRSRTFRGMKEQAQHSGQYAYRDRRNKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ DL+YS+F++GL  AG+ LDRKVL+++A +   +F  + E+++ + LVD
Sbjct: 61  WIQRINAAARLNDLSYSKFMHGLKLAGVELDRKVLAEIAYSDEQAFADLAEVAK-KALVD 119


>gi|333029964|ref|ZP_08458025.1| 50S ribosomal protein L20 [Bacteroides coprosuis DSM 18011]
 gi|332740561|gb|EGJ71043.1| 50S ribosomal protein L20 [Bacteroides coprosuis DSM 18011]
          Length = 115

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ K+VLK  KG++G RKN    AK A ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKRVLKQTKGYFGARKNVWTVAKNAWEKGLTYAYRDRKSKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  + YS+ + GL KAGI ++RKVL+DLA+   ++FK IV
Sbjct: 61  WIQRINAAARLEGMTYSRLMGGLKKAGIEINRKVLADLAVNHPEAFKAIV 110


>gi|78776408|ref|YP_392723.1| 50S ribosomal protein L20 [Sulfurimonas denitrificans DSM 1251]
 gi|109893168|sp|Q30U43|RL20_SULDN RecName: Full=50S ribosomal protein L20
 gi|78496948|gb|ABB43488.1| LSU ribosomal protein L20P [Sulfurimonas denitrificans DSM 1251]
          Length = 118

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 70/95 (73%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVK GVV   +HKK+LK AKGFY  R+   R AK  ++RS  Y++RDR+ KKRDFR L
Sbjct: 1  MPRVKTGVVRRRRHKKILKLAKGFYSGRRKHYRKAKEQLERSMYYSFRDRKQKKRDFRKL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVL 95
          WI RINAA R+  +NYS FINGL KAGI LDRK+L
Sbjct: 61 WIIRINAACRLNGMNYSTFINGLSKAGIELDRKIL 95


>gi|254518662|ref|ZP_05130718.1| ribosomal protein L20 [Clostridium sp. 7_2_43FAA]
 gi|226912411|gb|EEH97612.1| ribosomal protein L20 [Clostridium sp. 7_2_43FAA]
          Length = 119

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V S   HKKVLK AKG+YG +    + A  +V R+ + AY  RR+KKRDFR L
Sbjct: 1   MARVKRAVNSRKNHKKVLKLAKGYYGGKSRLFKTANESVIRALRNAYVGRRLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FING+  AGI ++RK+LS++AI    +F  +VE+++S+L
Sbjct: 61  WIARINAATRMNGLSYSKFINGIKLAGIDMNRKMLSEIAINDPKAFADLVEVAKSQL 117


>gi|253582914|ref|ZP_04860132.1| ribosomal protein L20 [Fusobacterium varium ATCC 27725]
 gi|251835120|gb|EES63663.1| ribosomal protein L20 [Fusobacterium varium ATCC 27725]
          Length = 116

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G+V   KHKK+L++AKGF G   + I+ AK A  ++  Y+ RDR+V KR  RSLWI
Sbjct: 2   RVKTGIVRRRKHKKILQAAKGFRGASGDVIKQAKQATMKAAAYSTRDRKVNKRRMRSLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RIN+A R+  L YS  INGL +AGIVLDRKVL+D+A+     F K+ E +++ L
Sbjct: 62  IRINSAARINGLTYSTLINGLKRAGIVLDRKVLADIALNNAAEFAKLAETAKAAL 116


>gi|291277003|ref|YP_003516775.1| 50S ribosomal protein L20 [Helicobacter mustelae 12198]
 gi|290964197|emb|CBG40043.1| 50S ribosomal protein L20 [Helicobacter mustelae 12198]
          Length = 121

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 82/116 (70%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVK G V   +HKK+LK A+GFY  R+   R AK  ++RS  YA+RDR+ KKRDFRSLW
Sbjct: 1   MRVKTGFVRRRRHKKILKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKRDFRSLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RINAA R+  ++YS+F++GL  A + LDRKVL+D+A+    +F +I+ +++  L
Sbjct: 61  IVRINAACRMSAMSYSKFMHGLKLANVELDRKVLADMAMNDSAAFHEILSIAKEAL 116


>gi|326382699|ref|ZP_08204390.1| 50S ribosomal protein L20 [Gordonia neofelifaecis NRRL B-59395]
 gi|326198818|gb|EGD56001.1| 50S ribosomal protein L20 [Gordonia neofelifaecis NRRL B-59395]
          Length = 126

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 82/121 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+++KG+ G+R    R AK     S  YAYRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA RV D+ Y++FI GL  AG+ +DRKVL+D+A+T   +F  +VE++R+ L  D
Sbjct: 61  WITRINAAARVNDITYNRFIQGLKLAGVEVDRKVLADIAVTDPAAFTGLVEVARAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|299821798|ref|ZP_07053686.1| 50S ribosomal protein L20 [Listeria grayi DSM 20601]
 gi|299817463|gb|EFI84699.1| 50S ribosomal protein L20 [Listeria grayi DSM 20601]
          Length = 119

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVIKLAKGYYGAKHTLFKVANQAVMKSYQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+++L+YS+ ++GL  AGI ++RK+L+DLA+    +F  + + +++ L
Sbjct: 61  WITRINAAARLHELSYSKLMHGLKLAGIDINRKMLADLAVNDTAAFGALADQAKNAL 117


>gi|163756234|ref|ZP_02163349.1| 50S ribosomal protein L20 [Kordia algicida OT-1]
 gi|161323846|gb|EDP95180.1| 50S ribosomal protein L20 [Kordia algicida OT-1]
          Length = 114

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AVD++  Y+YRDRR KKR FR+L
Sbjct: 1   MPRSVNAVARRARRKKVLKQAKGYFGRRKNVWTVAKNAVDKAMSYSYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R+  ++YSQF+  +    I L+RKVL+DLA+   ++FK IVE
Sbjct: 61  WITRINAGARLNGMSYSQFMGKVKANNIELNRKVLADLAMNHPEAFKAIVE 111


>gi|163788633|ref|ZP_02183078.1| 50S ribosomal protein L20 [Flavobacteriales bacterium ALC-1]
 gi|159875870|gb|EDP69929.1| 50S ribosomal protein L20 [Flavobacteriales bacterium ALC-1]
          Length = 114

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AVD++ QY+YRDRR KKR FRSL
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGYFGRRKNVWTVAKNAVDKAMQYSYRDRRNKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R + ++YS+F+  L    I L+RKVL+DLA+   ++F+ IV 
Sbjct: 61  WIMRINAGARQHGMSYSKFMGKLKANNIELNRKVLADLAMNHPEAFEAIVN 111


>gi|260911580|ref|ZP_05918165.1| 50S ribosomal protein L20 [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260634286|gb|EEX52391.1| 50S ribosomal protein L20 [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 114

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+ ++ YS  +  LHKAGI ++RKVL+DLA+    +FK IV+
Sbjct: 61  WIQRINAAARLENMTYSTLMGALHKAGIEINRKVLADLAVNNPQAFKAIVD 111


>gi|139437955|ref|ZP_01771508.1| Hypothetical protein COLAER_00494 [Collinsella aerofaciens ATCC
           25986]
 gi|133776152|gb|EBA39972.1| Hypothetical protein COLAER_00494 [Collinsella aerofaciens ATCC
           25986]
          Length = 119

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KR V +  K + V+  AKG+YG    T + AK  V  S QY YRDRR KKR+ RSL
Sbjct: 1   MARIKRAVAAKKKRRTVMHRAKGYYGAASRTYKHAKEQVQHSLQYQYRDRRNKKREIRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YSQF++GL  AGI LDRKVL+ +A   ++SF ++  +++  L
Sbjct: 61  WITRINAAARLNDISYSQFMHGLKVAGIELDRKVLAQMAYEDIESFNELATIAKKAL 117


>gi|83590591|ref|YP_430600.1| 50S ribosomal protein L20 [Moorella thermoacetica ATCC 39073]
 gi|109893121|sp|Q2RHN2|RL20_MOOTA RecName: Full=50S ribosomal protein L20
 gi|83573505|gb|ABC20057.1| LSU ribosomal protein L20P [Moorella thermoacetica ATCC 39073]
          Length = 121

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV    +HKK+LK AKG++G +    R A   V +S  YAY  RR +K DFR L
Sbjct: 1   MARVKRGVTKHQRHKKILKLAKGYFGAKSKLFRPANEQVIKSLAYAYAHRRQRKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  +NYS+ +NGL KAG+ ++RK+L+D+A+     F ++V++++ +L
Sbjct: 61  WIARINAAARMNGINYSRLVNGLKKAGVEINRKMLADMAVNDQAGFNRLVDIAKEKL 117


>gi|312877040|ref|ZP_07737013.1| ribosomal protein L20 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796181|gb|EFR12537.1| ribosomal protein L20 [Caldicellulosiruptor lactoaceticus 6A]
          Length = 119

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 82/116 (70%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R+K  V +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LW
Sbjct: 1   MRIKNSVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRRLKKRDFRKLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RINAA R   L+YS+FINGL KAGI L+RKVL+D+A+    +F ++VE+++ ++
Sbjct: 61  ITRINAAARQNGLSYSKFINGLKKAGISLNRKVLADMAVNDQKAFAELVEIAKKQI 116


>gi|237737798|ref|ZP_04568279.1| LSU ribosomal protein L20P [Fusobacterium mortiferum ATCC 9817]
 gi|229419678|gb|EEO34725.1| LSU ribosomal protein L20P [Fusobacterium mortiferum ATCC 9817]
          Length = 116

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 77/115 (66%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G+V   KHKKVL++AKGF G   + I+ AK A  R+  Y+ RDR+V KR  R LWI
Sbjct: 2   RVKTGIVRRRKHKKVLRAAKGFRGASGDVIKQAKQATMRAAAYSTRDRKVTKRRMRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RIN A R+  L YS  +NGL KAGIVLDRKVL+D+A+     F K+ E +++ L
Sbjct: 62  IRINTAARLNGLTYSTLMNGLKKAGIVLDRKVLADIALNNAAEFTKLAETAKAAL 116


>gi|158321003|ref|YP_001513510.1| ribosomal protein L20 [Alkaliphilus oremlandii OhILAs]
 gi|166984655|sp|A8MI82|RL20_ALKOO RecName: Full=50S ribosomal protein L20
 gi|158141202|gb|ABW19514.1| ribosomal protein L20 [Alkaliphilus oremlandii OhILAs]
          Length = 119

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  +HKKVLK AKGF G R    R A   V +S +YAY  R+++KRDFR L
Sbjct: 1   MARVKTGKTAHKRHKKVLKLAKGFRGARSKLFRPANQFVMKSLKYAYIGRKLRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+F+NGL  AGI ++RKVLS++AI   + F ++VE ++ +L
Sbjct: 61  WITRINAATRANGLSYSKFMNGLKLAGIDMNRKVLSEMAIYDKEGFAQLVETAKQKL 117


>gi|258592603|emb|CBE68912.1| 50S ribosomal subunit protein L20 [NC10 bacterium 'Dutch sediment']
          Length = 119

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 78/109 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G  +  +  +VLK A+G++G+R    R+A+ AVDR+++YAYRDR+ +KR+FRSL
Sbjct: 1   MPRAKGGFKTRRRRNRVLKEAEGYFGKRSKAYRSAQEAVDRAKRYAYRDRKARKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKI 109
           WI RINAA R+  L+YS  + GL KAG+ +DRK L+DLAI    +F K+
Sbjct: 61  WIIRINAAARLSGLSYSVMMGGLKKAGVAMDRKALADLAIQDPSAFTKL 109


>gi|327398465|ref|YP_004339334.1| 50S ribosomal protein L20 [Hippea maritima DSM 10411]
 gi|327181094|gb|AEA33275.1| 50S ribosomal protein L20 [Hippea maritima DSM 10411]
          Length = 115

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 81/109 (74%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G     +HKK+LK AKG+Y RR +T + A+ +V R+  YAYRDR+V+KR+FR LWI
Sbjct: 2   RVKTGFKRRRRHKKILKLAKGYYQRRHSTYKNAEESVRRALAYAYRDRKVRKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAAVR Y L+YS+F++ L +  I L+RKVLS +AI + ++FK ++E
Sbjct: 62  TRINAAVREYGLSYSKFMHLLKEKNIDLNRKVLSQMAIYEPEAFKNLIE 110


>gi|212550459|ref|YP_002308776.1| 50S ribosomal protein L20 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|212548697|dbj|BAG83365.1| 50S ribosomal protein L20 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 115

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++ K  KG+YG RKN +  AK   ++   YA+RDRR KKR FRSL
Sbjct: 1   MPRSVNHVASRAKRKRIFKLTKGYYGARKNVLTVAKNTWEKGLTYAFRDRRTKKRIFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           W+QRINAA R+  L+YS+F+ GLH+  I ++RKVL+DLA+    +FK+IV+
Sbjct: 61  WVQRINAAARLEGLSYSEFMRGLHRNSIEINRKVLADLAMNHAGAFKEIVD 111


>gi|294101707|ref|YP_003553565.1| ribosomal protein L20 [Aminobacterium colombiense DSM 12261]
 gi|293616687|gb|ADE56841.1| ribosomal protein L20 [Aminobacterium colombiense DSM 12261]
          Length = 119

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G VS+ K KK+    KG++G++KN  R A+ A  +S   AY DR++KKRDFR L
Sbjct: 1   MPRVKGGSVSNKKRKKLFSITKGYWGKKKNVYRRAREAFLKSLSRAYDDRKLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS  I GL KAGI ++RK+LS+LAI  + +F K+VE +R+ L
Sbjct: 61  WITRINAAARAQGMSYSSLIAGLKKAGIGINRKMLSELAINDMPAFAKLVEQARNAL 117


>gi|206890043|ref|YP_002249218.1| ribosomal protein L20 [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|226730469|sp|B5YG20|RL20_THEYD RecName: Full=50S ribosomal protein L20
 gi|206741981|gb|ACI21038.1| ribosomal protein L20 [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 120

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G  +   HKK+L  AKG+Y  R+   + A  AV+++ +++YRDRR+KKRD RSL
Sbjct: 1   MPRAKGGFKTRRYHKKILSMAKGYYSGRRRCYKVAAKAVEKALEHSYRDRRLKKRDLRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAAVR++ L Y+QFI+GL KA I L+RK L+D+A   ++ F ++VE
Sbjct: 61  WITRINAAVRMFGLTYNQFIDGLKKANISLNRKALADIAYNDINVFGELVE 111


>gi|115465033|ref|NP_001056116.1| Os05g0528200 [Oryza sativa Japonica Group]
 gi|52353395|gb|AAU43963.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group]
 gi|113579667|dbj|BAF18030.1| Os05g0528200 [Oryza sativa Japonica Group]
 gi|215693127|dbj|BAG88509.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 121

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           K+ K AKGF GR KN IR A+  V+++ QY+YRDRR KKRD RSLWI+RINA  R++ +N
Sbjct: 5   KIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRIHGVN 64

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           Y  F++GL K  I L+RKVLS+L++ +  SFK +V++SR+
Sbjct: 65  YGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRT 104


>gi|329944513|ref|ZP_08292678.1| ribosomal protein L20 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328530278|gb|EGF57157.1| ribosomal protein L20 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 126

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YA+RDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEKASGYRGQRSRLYRKAKEQVTHSGVYAFRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ + + FK +VE++R  L  D
Sbjct: 61  WIQRINAAARAEGLTYNRFIQGLGLAGVEIDRRMLAELAVNEPEGFKALVEVARKALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|332521039|ref|ZP_08397497.1| ribosomal protein L20 [Lacinutrix algicola 5H-3-7-4]
 gi|332043132|gb|EGI79329.1| ribosomal protein L20 [Lacinutrix algicola 5H-3-7-4]
          Length = 114

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AVD++ QY+YRDRR KKR FR+L
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGYFGRRKNVWTVAKNAVDKAMQYSYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YSQF+  L    I L+RKVL+DLA+    +F+ IV 
Sbjct: 61  WITRINAGARLHGMSYSQFMGKLKANNIELNRKVLADLAMNHPVAFEAIVN 111


>gi|171911358|ref|ZP_02926828.1| 50S ribosomal protein L20 [Verrucomicrobium spinosum DSM 4136]
          Length = 123

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R      S A+ K+ L+ AKGF G R    R AK AV ++  YAYRDR+V+KR+FR L
Sbjct: 1   MPRATNAPASRARRKRTLQKAKGFRGFRSKLFRYAKDAVRKAMTYAYRDRKVRKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R   L+YS+F  GL  AGI LDRKVLSD+AI    +F  I++ +++ L
Sbjct: 61  WIQRINAATRAQGLSYSRFTEGLKAAGIELDRKVLSDIAIKDAAAFNAIIQQAKTAL 117


>gi|125553065|gb|EAY98774.1| hypothetical protein OsI_20708 [Oryza sativa Indica Group]
 gi|222632308|gb|EEE64440.1| hypothetical protein OsJ_19285 [Oryza sativa Japonica Group]
          Length = 151

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           K+ K AKGF GR KN IR A+  V+++ QY+YRDRR KKRD RSLWI+RINA  R++ +N
Sbjct: 35  KIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRIHGVN 94

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           Y  F++GL K  I L+RKVLS+L++ +  SFK +V++SR+
Sbjct: 95  YGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRT 134


>gi|302871992|ref|YP_003840628.1| ribosomal protein L20 [Caldicellulosiruptor obsidiansis OB47]
 gi|302574851|gb|ADL42642.1| ribosomal protein L20 [Caldicellulosiruptor obsidiansis OB47]
          Length = 119

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 83/116 (71%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  R++KKRDFR LW
Sbjct: 1   MRIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRKLKKRDFRRLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RINAA R   L+YS+F+NGL KAGI L+RKVL+D+A+    +F ++VE+++ ++
Sbjct: 61  ITRINAAARQNGLSYSKFMNGLKKAGINLNRKVLADMAVNDQKAFAELVEIAKKQI 116


>gi|15924668|ref|NP_372202.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927257|ref|NP_374790.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283351|ref|NP_646439.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MW2]
 gi|49483921|ref|YP_041145.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49486505|ref|YP_043726.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650550|ref|YP_186563.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus COL]
 gi|82751267|ref|YP_417008.1| 50S ribosomal protein L20 [Staphylococcus aureus RF122]
 gi|87162399|ref|YP_494320.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88195485|ref|YP_500289.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148268159|ref|YP_001247102.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus JH9]
 gi|150394226|ref|YP_001316901.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus JH1]
 gi|151221784|ref|YP_001332606.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156979996|ref|YP_001442255.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus Mu3]
 gi|221142571|ref|ZP_03567064.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253732330|ref|ZP_04866495.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253734537|ref|ZP_04868702.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006463|ref|ZP_05145064.2| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257425794|ref|ZP_05602218.1| LSU ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428460|ref|ZP_05604858.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431094|ref|ZP_05607471.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257433777|ref|ZP_05610135.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus E1410]
 gi|257436693|ref|ZP_05612737.1| LSU ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257794064|ref|ZP_05643043.1| 50S ribosomal protein L20 [Staphylococcus aureus A9781]
 gi|258415768|ref|ZP_05682039.1| 50S ribosomal protein L20 [Staphylococcus aureus A9763]
 gi|258421995|ref|ZP_05684915.1| LSU ribosomal protein L20 [Staphylococcus aureus A9719]
 gi|258424095|ref|ZP_05686977.1| LSU ribosomal protein L20 [Staphylococcus aureus A9635]
 gi|258438247|ref|ZP_05689531.1| 50S ribosomal protein L20 [Staphylococcus aureus A9299]
 gi|258443705|ref|ZP_05692044.1| LSU ribosomal protein L20P [Staphylococcus aureus A8115]
 gi|258445916|ref|ZP_05694092.1| LSU ribosomal protein L20P [Staphylococcus aureus A6300]
 gi|258448403|ref|ZP_05696520.1| 50S ribosomal protein L20 [Staphylococcus aureus A6224]
 gi|258451807|ref|ZP_05699829.1| ribosomal protein L20 [Staphylococcus aureus A5948]
 gi|258454295|ref|ZP_05702264.1| ribosomal protein L20 [Staphylococcus aureus A5937]
 gi|262048653|ref|ZP_06021536.1| 50S ribosomal protein L20 [Staphylococcus aureus D30]
 gi|262052250|ref|ZP_06024455.1| 50S ribosomal protein L20 [Staphylococcus aureus 930918-3]
 gi|269203297|ref|YP_003282566.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893174|ref|ZP_06301408.1| 50S ribosomal protein L20 [Staphylococcus aureus A8117]
 gi|282904250|ref|ZP_06312138.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus C160]
 gi|282906075|ref|ZP_06313930.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908990|ref|ZP_06316808.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911306|ref|ZP_06319108.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914475|ref|ZP_06322261.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus M899]
 gi|282916938|ref|ZP_06324696.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282919444|ref|ZP_06327179.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282920219|ref|ZP_06327944.1| 50S ribosomal protein L20 [Staphylococcus aureus A9765]
 gi|282924821|ref|ZP_06332487.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           C101]
 gi|283770743|ref|ZP_06343635.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus H19]
 gi|283958430|ref|ZP_06375881.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284024727|ref|ZP_06379125.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus 132]
 gi|293503553|ref|ZP_06667400.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510568|ref|ZP_06669273.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537110|ref|ZP_06671790.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus M1015]
 gi|294848700|ref|ZP_06789446.1| 50S ribosomal protein L20 [Staphylococcus aureus A9754]
 gi|295405989|ref|ZP_06815797.1| 50S ribosomal protein L20 [Staphylococcus aureus A8819]
 gi|295428250|ref|ZP_06820879.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296274894|ref|ZP_06857401.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MR1]
 gi|297207608|ref|ZP_06924043.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245085|ref|ZP_06928962.1| 50S ribosomal protein L20 [Staphylococcus aureus A8796]
 gi|297590787|ref|ZP_06949425.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MN8]
 gi|300911690|ref|ZP_07129134.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304380730|ref|ZP_07363399.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|54039127|sp|P66108|RL20_STAAN RecName: Full=50S ribosomal protein L20
 gi|54039128|sp|P66109|RL20_STAAW RecName: Full=50S ribosomal protein L20
 gi|54041831|sp|P66107|RL20_STAAM RecName: Full=50S ribosomal protein L20
 gi|60390418|sp|Q6G8P7|RL20_STAAS RecName: Full=50S ribosomal protein L20
 gi|60390432|sp|Q6GG27|RL20_STAAR RecName: Full=50S ribosomal protein L20
 gi|73914081|sp|Q5HF94|RL20_STAAC RecName: Full=50S ribosomal protein L20
 gi|109893155|sp|Q2FG58|RL20_STAA3 RecName: Full=50S ribosomal protein L20
 gi|109893156|sp|Q2YTB1|RL20_STAAB RecName: Full=50S ribosomal protein L20
 gi|122539333|sp|Q2FXQ1|RL20_STAA8 RecName: Full=50S ribosomal protein L20
 gi|166220789|sp|A7X3A1|RL20_STAA1 RecName: Full=50S ribosomal protein L20
 gi|172048938|sp|A6QHL2|RL20_STAAE RecName: Full=50S ribosomal protein L20
 gi|189041890|sp|A6U2E6|RL20_STAA2 RecName: Full=50S ribosomal protein L20
 gi|189041891|sp|A5ITK3|RL20_STAA9 RecName: Full=50S ribosomal protein L20
 gi|13701475|dbj|BAB42769.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247450|dbj|BAB57840.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21204791|dbj|BAB95487.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MW2]
 gi|49242050|emb|CAG40749.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49244948|emb|CAG43409.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284736|gb|AAW36830.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus COL]
 gi|82656798|emb|CAI81227.1| 50S ribosomal protein L20 [Staphylococcus aureus RF122]
 gi|87128373|gb|ABD22887.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203043|gb|ABD30853.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|147741228|gb|ABQ49526.1| LSU ribosomal protein L20P [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149946678|gb|ABR52614.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus JH1]
 gi|150374584|dbj|BAF67844.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156722131|dbj|BAF78548.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus Mu3]
 gi|253723930|gb|EES92659.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253727478|gb|EES96207.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257271488|gb|EEV03634.1| LSU ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275301|gb|EEV06788.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278042|gb|EEV08690.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257281870|gb|EEV12007.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus E1410]
 gi|257284044|gb|EEV14167.1| LSU ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257788036|gb|EEV26376.1| 50S ribosomal protein L20 [Staphylococcus aureus A9781]
 gi|257839361|gb|EEV63834.1| 50S ribosomal protein L20 [Staphylococcus aureus A9763]
 gi|257842039|gb|EEV66468.1| LSU ribosomal protein L20 [Staphylococcus aureus A9719]
 gi|257845716|gb|EEV69748.1| LSU ribosomal protein L20 [Staphylococcus aureus A9635]
 gi|257848291|gb|EEV72282.1| 50S ribosomal protein L20 [Staphylococcus aureus A9299]
 gi|257851111|gb|EEV75054.1| LSU ribosomal protein L20P [Staphylococcus aureus A8115]
 gi|257855158|gb|EEV78097.1| LSU ribosomal protein L20P [Staphylococcus aureus A6300]
 gi|257858371|gb|EEV81256.1| 50S ribosomal protein L20 [Staphylococcus aureus A6224]
 gi|257860519|gb|EEV83345.1| ribosomal protein L20 [Staphylococcus aureus A5948]
 gi|257863525|gb|EEV86284.1| ribosomal protein L20 [Staphylococcus aureus A5937]
 gi|259159851|gb|EEW44890.1| 50S ribosomal protein L20 [Staphylococcus aureus 930918-3]
 gi|259163300|gb|EEW47859.1| 50S ribosomal protein L20 [Staphylococcus aureus D30]
 gi|262075587|gb|ACY11560.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941159|emb|CBI49546.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282313187|gb|EFB43583.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317254|gb|EFB47628.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282319425|gb|EFB49777.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282321656|gb|EFB51981.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus M899]
 gi|282325001|gb|EFB55311.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327254|gb|EFB57549.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331367|gb|EFB60881.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282594567|gb|EFB99552.1| 50S ribosomal protein L20 [Staphylococcus aureus A9765]
 gi|282595868|gb|EFC00832.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus C160]
 gi|282764492|gb|EFC04618.1| 50S ribosomal protein L20 [Staphylococcus aureus A8117]
 gi|283460890|gb|EFC07980.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus H19]
 gi|283470946|emb|CAQ50157.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus ST398]
 gi|283790579|gb|EFC29396.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817362|gb|ADC37849.1| 50S ribosomal protein L20 [Staphylococcus aureus 04-02981]
 gi|290919955|gb|EFD97023.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus M1015]
 gi|291095219|gb|EFE25484.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466459|gb|EFF08980.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824726|gb|EFG41149.1| 50S ribosomal protein L20 [Staphylococcus aureus A9754]
 gi|294968986|gb|EFG45007.1| 50S ribosomal protein L20 [Staphylococcus aureus A8819]
 gi|295127650|gb|EFG57287.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296887625|gb|EFH26523.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297178165|gb|EFH37413.1| 50S ribosomal protein L20 [Staphylococcus aureus A8796]
 gi|297575673|gb|EFH94389.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MN8]
 gi|298694949|gb|ADI98171.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300887111|gb|EFK82312.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302333344|gb|ADL23537.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302751505|gb|ADL65682.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304340729|gb|EFM06660.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312437863|gb|ADQ76934.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312830057|emb|CBX34899.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315130688|gb|EFT86674.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315195583|gb|EFU25970.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198625|gb|EFU28953.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140443|gb|EFW32297.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143981|gb|EFW35750.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323440777|gb|EGA98486.1| 50S ribosomal protein L20 [Staphylococcus aureus O11]
 gi|323442932|gb|EGB00555.1| 50S ribosomal protein L20 [Staphylococcus aureus O46]
 gi|329314351|gb|AEB88764.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727404|gb|EGG63860.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 21172]
 gi|329728363|gb|EGG64800.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 21189]
 gi|329733269|gb|EGG69606.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 21193]
          Length = 118

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R ++++YS+ +NGL KAGI ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDAL 117


>gi|297183199|gb|ADI19340.1| ribosomal protein l20 [uncultured delta proteobacterium
           HF0500_03A04]
          Length = 119

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KR V S  + K   K+AKG+ G R    R  K AV+RS +Y+YRDR+V+KR+FR  
Sbjct: 1   MARIKRAVHSRKRKKDYFKAAKGYRGGRGKLWRTVKDAVERSWEYSYRDRKVRKREFRKT 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR   L YS+FI  L KAGI LDRK L+ LA+ + D+F KIV
Sbjct: 61  WIQRINAAVRAEGLKYSEFIYELGKAGIDLDRKALAHLALDEPDAFSKIV 110


>gi|210632541|ref|ZP_03297451.1| hypothetical protein COLSTE_01354 [Collinsella stercoris DSM 13279]
 gi|229816629|ref|ZP_04446918.1| hypothetical protein COLINT_03677 [Collinsella intestinalis DSM
           13280]
 gi|210159488|gb|EEA90459.1| hypothetical protein COLSTE_01354 [Collinsella stercoris DSM 13279]
 gi|229807757|gb|EEP43570.1| hypothetical protein COLINT_03677 [Collinsella intestinalis DSM
           13280]
          Length = 119

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  AKG+YG+   + + AK  V  S QY YRDRR KKR+ RSL
Sbjct: 1   MARVKRAVNAKKKRRTVLNRAKGYYGQASRSYKYAKEQVQHSLQYQYRDRRNKKREIRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YSQF++GL  AGI LDRKVL+ +A   ++SF ++  +++  L
Sbjct: 61  WITRINAAARMNDISYSQFMHGLKLAGIELDRKVLAQMAYEDIESFNELAAIAKKAL 117


>gi|150024982|ref|YP_001295808.1| 50S ribosomal protein L20 [Flavobacterium psychrophilum JIP02/86]
 gi|166219643|sp|A6GY19|RL20_FLAPJ RecName: Full=50S ribosomal protein L20
 gi|149771523|emb|CAL42992.1| 50S ribosomal protein L20 [Flavobacterium psychrophilum JIP02/86]
          Length = 114

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KK++K AKGF+GRRKN    AK AV+++  YAYRDR+V KR+FR+L
Sbjct: 1   MPRSVNSVAKRARRKKIMKQAKGFFGRRKNVWTVAKNAVEKAMCYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R+  ++YSQF+  + K  I L+RKVL+DLA+    +FK I+ 
Sbjct: 61  WIQRINAGARLEGMSYSQFMGKVKKHNIELNRKVLADLAMNHPVAFKTILN 111


>gi|255320844|ref|ZP_05362018.1| ribosomal protein L20 [Acinetobacter radioresistens SK82]
 gi|262380263|ref|ZP_06073418.1| ribosomal protein L20 [Acinetobacter radioresistens SH164]
 gi|255302013|gb|EET81256.1| ribosomal protein L20 [Acinetobacter radioresistens SK82]
 gi|262298457|gb|EEY86371.1| ribosomal protein L20 [Acinetobacter radioresistens SH164]
          Length = 119

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+YG R    R A  AV ++ QYAYRDRR KKR FRSL
Sbjct: 1   MARVKRGVQAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I+GL KA +++DR+VL+D+A+    +F  + E ++  L
Sbjct: 61  WIARINAGARQNGLSYSRMISGLKKAQVIIDRRVLADIAMHDAVAFAALAEKAKGAL 117


>gi|222151590|ref|YP_002560746.1| 50S ribosomal protein L20 [Macrococcus caseolyticus JCSC5402]
 gi|254800327|sp|B9E782|RL20_MACCJ RecName: Full=50S ribosomal protein L20
 gi|222120715|dbj|BAH18050.1| 50S ribosomal protein L20 [Macrococcus caseolyticus JCSC5402]
          Length = 118

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYAYRDRR KKR+FR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAYRDRRQKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL  AGI ++RK+LS++AI+   +F ++V  +++ L
Sbjct: 61  WIARINAAARQHDISYSRLMNGLKVAGIDVNRKMLSEIAISDEKAFAELVNQAKAAL 117


>gi|210623618|ref|ZP_03293944.1| hypothetical protein CLOHIR_01894 [Clostridium hiranonis DSM 13275]
 gi|210153488|gb|EEA84494.1| hypothetical protein CLOHIR_01894 [Clostridium hiranonis DSM 13275]
          Length = 118

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+G+ +  KHKKVLK AKGF G R    R A A V ++ + AY  R++KKRD+R L
Sbjct: 1   MARVKKGMNARKKHKKVLKLAKGFRGSRSKLFRPANAFVMKALRNAYIGRKLKKRDYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+  ++YS+ +NGL  AG+ ++RK+LS++AI     F K+VE+++++L
Sbjct: 61  WIQRINAAARMNGISYSRLMNGLKLAGVEVNRKMLSEMAIADPAGFAKLVEVAKAKL 117


>gi|291533295|emb|CBL06408.1| LSU ribosomal protein L20P [Megamonas hypermegale ART12/1]
          Length = 117

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV + A+HKK+LK AKG+ G R    + A   V ++  YA RDRR KK +FR L
Sbjct: 1   MPRVKSGVTAHARHKKILKLAKGYRGARSKQFKKANELVMKALYYARRDRRAKKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FI GL KAG+ ++RK+L+D+AI    +F K+VE+++S L
Sbjct: 61  WIARINAATRANGMSYSRFICGLTKAGVQVNRKMLADVAINDAAAFAKLVEVAKSNL 117


>gi|197118375|ref|YP_002138802.1| 50S ribosomal protein L20 [Geobacter bemidjiensis Bem]
 gi|253700845|ref|YP_003022034.1| 50S ribosomal protein L20 [Geobacter sp. M21]
 gi|226730403|sp|B5EBY2|RL20_GEOBB RecName: Full=50S ribosomal protein L20
 gi|259646187|sp|C6DYJ2|RL20_GEOSM RecName: Full=50S ribosomal protein L20
 gi|197087735|gb|ACH39006.1| ribosomal protein L20 [Geobacter bemidjiensis Bem]
 gi|251775695|gb|ACT18276.1| ribosomal protein L20 [Geobacter sp. M21]
          Length = 117

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/106 (54%), Positives = 76/106 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  L+YS+ I+GL  A + +DRKV++DLA++  + F
Sbjct: 61  WITRINAAARINGLSYSKLIHGLKLANVEIDRKVMADLAVSDPNGF 106


>gi|16800961|ref|NP_471229.1| 50S ribosomal protein L20 [Listeria innocua Clip11262]
 gi|16803823|ref|NP_465308.1| 50S ribosomal protein L20 [Listeria monocytogenes EGD-e]
 gi|46908013|ref|YP_014402.1| 50S ribosomal protein L20 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47094152|ref|ZP_00231872.1| ribosomal protein L20 [Listeria monocytogenes str. 4b H7858]
 gi|47097523|ref|ZP_00235062.1| ribosomal protein L20 [Listeria monocytogenes str. 1/2a F6854]
 gi|116873220|ref|YP_850001.1| 50S ribosomal protein L20 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217964069|ref|YP_002349747.1| ribosomal protein L20 [Listeria monocytogenes HCC23]
 gi|224500777|ref|ZP_03669126.1| 50S ribosomal protein L20 [Listeria monocytogenes Finland 1988]
 gi|224503786|ref|ZP_03672093.1| 50S ribosomal protein L20 [Listeria monocytogenes FSL R2-561]
 gi|226224386|ref|YP_002758493.1| ribosomal protein L20 [Listeria monocytogenes Clip81459]
 gi|254826391|ref|ZP_05231392.1| rplT [Listeria monocytogenes FSL J1-194]
 gi|254829587|ref|ZP_05234274.1| rplT [Listeria monocytogenes FSL N3-165]
 gi|254832538|ref|ZP_05237193.1| 50S ribosomal protein L20 [Listeria monocytogenes 10403S]
 gi|254854528|ref|ZP_05243876.1| rplT [Listeria monocytogenes FSL R2-503]
 gi|254901190|ref|ZP_05261114.1| 50S ribosomal protein L20 [Listeria monocytogenes J0161]
 gi|254914077|ref|ZP_05264089.1| 50S ribosomal protein L20 [Listeria monocytogenes J2818]
 gi|254933632|ref|ZP_05266991.1| ribosomal protein L20 [Listeria monocytogenes HPB2262]
 gi|254938391|ref|ZP_05270088.1| 50S ribosomal protein L20 [Listeria monocytogenes F6900]
 gi|255026969|ref|ZP_05298955.1| 50S ribosomal protein L20 [Listeria monocytogenes FSL J2-003]
 gi|255028317|ref|ZP_05300268.1| 50S ribosomal protein L20 [Listeria monocytogenes LO28]
 gi|255521085|ref|ZP_05388322.1| 50S ribosomal protein L20 [Listeria monocytogenes FSL J1-175]
 gi|284802227|ref|YP_003414092.1| 50S ribosomal protein L20 [Listeria monocytogenes 08-5578]
 gi|284995369|ref|YP_003417137.1| 50S ribosomal protein L20 [Listeria monocytogenes 08-5923]
 gi|289435123|ref|YP_003464995.1| 50S ribosomal protein L20 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290893089|ref|ZP_06556078.1| ribosomal protein L20 [Listeria monocytogenes FSL J2-071]
 gi|300766429|ref|ZP_07076384.1| ribosomal protein L20 [Listeria monocytogenes FSL N1-017]
 gi|315282773|ref|ZP_07871103.1| ribosomal protein L20 [Listeria marthii FSL S4-120]
 gi|315303672|ref|ZP_07874197.1| ribosomal protein L20 [Listeria ivanovii FSL F6-596]
 gi|54039125|sp|P66104|RL20_LISIN RecName: Full=50S ribosomal protein L20
 gi|54041829|sp|P66103|RL20_LISMO RecName: Full=50S ribosomal protein L20
 gi|60390487|sp|Q71YN5|RL20_LISMF RecName: Full=50S ribosomal protein L20
 gi|16411237|emb|CAC99861.1| ribosomal protein L20 [Listeria monocytogenes EGD-e]
 gi|16414396|emb|CAC97125.1| ribosomal protein L20 [Listeria innocua Clip11262]
 gi|46881283|gb|AAT04579.1| ribosomal protein L20 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47014106|gb|EAL05100.1| ribosomal protein L20 [Listeria monocytogenes str. 1/2a F6854]
 gi|47017477|gb|EAL08290.1| ribosomal protein L20 [Listeria monocytogenes str. 4b H7858]
 gi|116742098|emb|CAK21222.1| 50S ribosomal protein L20 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217333339|gb|ACK39133.1| ribosomal protein L20 [Listeria monocytogenes HCC23]
 gi|225876848|emb|CAS05557.1| ribosomal protein L20 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258602004|gb|EEW15329.1| rplT [Listeria monocytogenes FSL N3-165]
 gi|258607928|gb|EEW20536.1| rplT [Listeria monocytogenes FSL R2-503]
 gi|258611003|gb|EEW23611.1| 50S ribosomal protein L20 [Listeria monocytogenes F6900]
 gi|284057789|gb|ADB68730.1| 50S ribosomal protein L20 [Listeria monocytogenes 08-5578]
 gi|284060836|gb|ADB71775.1| 50S ribosomal protein L20 [Listeria monocytogenes 08-5923]
 gi|289171367|emb|CBH27909.1| 50S ribosomal protein L20 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290557449|gb|EFD90974.1| ribosomal protein L20 [Listeria monocytogenes FSL J2-071]
 gi|293585195|gb|EFF97227.1| ribosomal protein L20 [Listeria monocytogenes HPB2262]
 gi|293592097|gb|EFG00432.1| 50S ribosomal protein L20 [Listeria monocytogenes J2818]
 gi|293595631|gb|EFG03392.1| rplT [Listeria monocytogenes FSL J1-194]
 gi|300512853|gb|EFK39945.1| ribosomal protein L20 [Listeria monocytogenes FSL N1-017]
 gi|307571363|emb|CAR84542.1| rplT [Listeria monocytogenes L99]
 gi|313608205|gb|EFR84230.1| ribosomal protein L20 [Listeria monocytogenes FSL F2-208]
 gi|313613577|gb|EFR87391.1| ribosomal protein L20 [Listeria marthii FSL S4-120]
 gi|313618351|gb|EFR90387.1| ribosomal protein L20 [Listeria innocua FSL S4-378]
 gi|313623314|gb|EFR93546.1| ribosomal protein L20 [Listeria innocua FSL J1-023]
 gi|313627962|gb|EFR96570.1| ribosomal protein L20 [Listeria ivanovii FSL F6-596]
 gi|313632795|gb|EFR99751.1| ribosomal protein L20 [Listeria seeligeri FSL N1-067]
 gi|313637376|gb|EFS02854.1| ribosomal protein L20 [Listeria seeligeri FSL S4-171]
 gi|328466426|gb|EGF37574.1| 50S ribosomal protein L20 [Listeria monocytogenes 1816]
 gi|328473850|gb|EGF44680.1| 50S ribosomal protein L20 [Listeria monocytogenes 220]
 gi|332312223|gb|EGJ25318.1| 50S ribosomal protein L20 [Listeria monocytogenes str. Scott A]
          Length = 119

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK++K AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKIVKLAKGYYGSKHLLFKVANQAVMKSYQYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ DL+YS+ ++GL  AGI ++RK+L+DLA+  + SF  + + ++  L
Sbjct: 61  WIARINAAARMQDLSYSKLMHGLKLAGIDINRKMLADLAVNDIASFNTLADSAKKAL 117


>gi|255579823|ref|XP_002530749.1| 50S ribosomal protein L20, putative [Ricinus communis]
 gi|223529713|gb|EEF31655.1| 50S ribosomal protein L20, putative [Ricinus communis]
          Length = 224

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 76/101 (75%)

Query: 15  KKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDL 74
           K++ K AKGF GR KN IR A+  V+++ QY+YRDRR KKRD RSLWIQRINA  R + +
Sbjct: 4   KEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV 63

Query: 75  NYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           NY  F++GL K  I L+RKVLS+L++ +  SFK +V++SR+
Sbjct: 64  NYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRN 104


>gi|124267074|ref|YP_001021078.1| 50S ribosomal protein L20 [Methylibium petroleiphilum PM1]
 gi|166219660|sp|A2SH04|RL20_METPP RecName: Full=50S ribosomal protein L20
 gi|124259849|gb|ABM94843.1| LSU ribosomal protein L20P [Methylibium petroleiphilum PM1]
          Length = 118

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL+ AKGF GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLELAKGFRGRRKNVYRIAKQAVMKAGQYAYRDRRNRKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + + YS+FI G+ KA I +DRK+L++LA+    +F  IVE  +++L
Sbjct: 61  WIARINAASRSHGITYSRFIAGIKKAAIDIDRKMLAELAVNDPAAFGSIVEKVKAQL 117


>gi|169634336|ref|YP_001708072.1| 50S ribosomal protein L20 [Acinetobacter baumannii SDF]
 gi|226730340|sp|B0VV91|RL20_ACIBS RecName: Full=50S ribosomal protein L20
 gi|169153128|emb|CAP02204.1| 50S ribosomal protein L20, also posttranslational autoregulator
           [Acinetobacter baumannii]
          Length = 119

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L   KG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVVAHRRHKKILARTKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I+GL KA +++DR+VL+D+A+    +F  + E ++  L
Sbjct: 61  WIARINAGARQNGLSYSRMIDGLKKAQVIIDRRVLADIAMHDAVAFAALAEKAKGAL 117


>gi|110638047|ref|YP_678256.1| 50S ribosomal protein L20 [Cytophaga hutchinsonii ATCC 33406]
 gi|123354609|sp|Q11UK0|RL20_CYTH3 RecName: Full=50S ribosomal protein L20
 gi|110280728|gb|ABG58914.1| LSU ribosomal protein L20P [Cytophaga hutchinsonii ATCC 33406]
          Length = 115

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+LK AKG++GRRKN    AK AV+R + +AY  R+ KKR FR L
Sbjct: 1   MPRSVPSVASRERRKKILKLAKGYFGRRKNVWTVAKNAVERGKVFAYIGRKQKKRHFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R + L+YSQFI  L KA I L+RKVL+DLA+   ++FK +VE
Sbjct: 61  WIQRINAGTRQHGLSYSQFIGALDKANIKLNRKVLADLAMNDPEAFKAVVE 111


>gi|126652711|ref|ZP_01724872.1| 50S ribosomal protein L20 [Bacillus sp. B14905]
 gi|169829539|ref|YP_001699697.1| 50S ribosomal protein L20 [Lysinibacillus sphaericus C3-41]
 gi|299535485|ref|ZP_07048807.1| 50S ribosomal protein L20 [Lysinibacillus fusiformis ZC1]
 gi|226730416|sp|B1HWC8|RL20_LYSSC RecName: Full=50S ribosomal protein L20
 gi|126590560|gb|EAZ84678.1| 50S ribosomal protein L20 [Bacillus sp. B14905]
 gi|168994027|gb|ACA41567.1| 50S ribosomal protein L20 [Lysinibacillus sphaericus C3-41]
 gi|298729246|gb|EFI69799.1| 50S ribosomal protein L20 [Lysinibacillus fusiformis ZC1]
          Length = 119

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 78/109 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYYGSKHTLYKVANQAVMKSGQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKI 109
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+T   +F ++
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKVAGIEVNRKMLADLAVTDAAAFTQL 109


>gi|297183100|gb|ADI19244.1| hypothetical protein [uncultured delta proteobacterium
           HF0200_14D13]
          Length = 119

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 76/110 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V S  + K   K+AKG+ G R    R  K AV+RS +Y+YRDR+V+KR+FR  
Sbjct: 1   MARVKRAVHSRKRKKDYFKAAKGYRGGRGKLWRTVKDAVERSWEYSYRDRKVRKREFRKT 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAAVR   + YS+FI GL +AGI LDRK L+ LA+ + D+F KIV
Sbjct: 61  WIMRINAAVRAEGMKYSEFIYGLGQAGIDLDRKALAHLALDEPDAFSKIV 110


>gi|150389422|ref|YP_001319471.1| ribosomal protein L20 [Alkaliphilus metalliredigens QYMF]
 gi|166984625|sp|A6TNP4|RL20_ALKMQ RecName: Full=50S ribosomal protein L20
 gi|149949284|gb|ABR47812.1| ribosomal protein L20 [Alkaliphilus metalliredigens QYMF]
          Length = 119

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+GV +  +HKKVLK AKGF G R    R A   V ++ ++AY  R+++KRDFR L
Sbjct: 1   MARVKKGVTARKRHKKVLKLAKGFRGARSKLFRPANQFVMKALRHAYVGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FI+GL  +GI ++RKVLS++AI   + F ++VE ++ +L
Sbjct: 61  WITRINAATRINGLSYSKFISGLKLSGIEMNRKVLSEMAIHDKEGFAQLVETAKQKL 117


>gi|288928016|ref|ZP_06421863.1| ribosomal protein L20 [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330850|gb|EFC69434.1| ribosomal protein L20 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 114

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 74/111 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNHVASKARRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+ ++ YS  +  LHKAGI ++RKVL+DLA+    +FK IV+
Sbjct: 61  WIQRINAAARLENMTYSTLMGALHKAGIEINRKVLADLAVNNPQAFKAIVD 111


>gi|300781274|ref|ZP_07091128.1| 50S ribosomal protein L20 [Corynebacterium genitalium ATCC 33030]
 gi|300532981|gb|EFK54042.1| 50S ribosomal protein L20 [Corynebacterium genitalium ATCC 33030]
          Length = 129

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     SQ YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSQTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A + +DRK+L+DLA+    +F  I E++++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLKLAEVEVDRKILADLAVNDFAAFSAICEVAKNALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|326533764|dbj|BAK05413.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 122

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           K+ K AKGF GR KN IR A+  V+++ QY+YRDRR KKRD RSLWI+RINA  R++ +N
Sbjct: 5   KIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRLHGVN 64

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           Y  F++GL K  I L+RKVLS+L++ +  SFK +V++SR+
Sbjct: 65  YGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRT 104


>gi|224178079|ref|YP_002600935.1| ribosomal protein L20 [Pyramimonas parkeae]
 gi|215882746|gb|ACJ71119.1| ribosomal protein L20 [Pyramimonas parkeae]
          Length = 118

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/116 (52%), Positives = 80/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  + +++LK  KGF G      R A     ++ +Y+Y DRR +K +FR L
Sbjct: 1   MTRVKRGAVARNRRRRILKLTKGFQGSHSTLFRTANQQAMKALKYSYVDRRKRKIEFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI+RINA+ R+Y LNYSQ I GL KA I L+RKVL+ LAI   DSFKKI+EL+ S+
Sbjct: 61  WIRRINASSRMYGLNYSQLIYGLKKAKIDLNRKVLAQLAILDPDSFKKIIELAISK 116


>gi|226311196|ref|YP_002771090.1| 50S ribosomal protein L20 [Brevibacillus brevis NBRC 100599]
 gi|254800303|sp|C0Z9B6|RL20_BREBN RecName: Full=50S ribosomal protein L20
 gi|226094144|dbj|BAH42586.1| 50S ribosomal protein L20 [Brevibacillus brevis NBRC 100599]
          Length = 119

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V+  +HKK+LK AKG++G +    ++A A V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGIVTRRRHKKILKLAKGYFGSKHRLFKSANAQVMKSLLYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  +++S+L
Sbjct: 61  WITRINAQARMNGLSYSRLMHGLKVAGIEVNRKMLADLAVNDKAAFNELATVAKSKL 117


>gi|242054321|ref|XP_002456306.1| hypothetical protein SORBIDRAFT_03g033790 [Sorghum bicolor]
 gi|241928281|gb|EES01426.1| hypothetical protein SORBIDRAFT_03g033790 [Sorghum bicolor]
          Length = 121

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           K+ K AKGF GR KN IR A+  V+++ QY+YRDRR KKRD RSLWI+RINA  R++ +N
Sbjct: 5   KIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRLHGVN 64

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           Y  F++GL K  I L+RKVLS+L++ +  SFK +V++SR+
Sbjct: 65  YGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRT 104


>gi|226500868|ref|NP_001151809.1| 50S ribosomal protein L20 [Zea mays]
 gi|226958655|ref|NP_001152923.1| LOC100280565 [Zea mays]
 gi|242091177|ref|XP_002441421.1| hypothetical protein SORBIDRAFT_09g026330 [Sorghum bicolor]
 gi|195605838|gb|ACG24749.1| 50S ribosomal protein L20 [Zea mays]
 gi|195649829|gb|ACG44382.1| 50S ribosomal protein L20 [Zea mays]
 gi|241946706|gb|EES19851.1| hypothetical protein SORBIDRAFT_09g026330 [Sorghum bicolor]
          Length = 122

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           K+ K AKGF GR KN IR A+  V+++ QY+YRDRR KKRD RSLWI+RINA  R++ +N
Sbjct: 5   KIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRLHGVN 64

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           Y  F++GL K  I L+RKVLS+L++ +  SFK +V++SR+
Sbjct: 65  YGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRN 104


>gi|260584102|ref|ZP_05851850.1| 50S ribosomal protein L20 [Granulicatella elegans ATCC 700633]
 gi|260158728|gb|EEW93796.1| 50S ribosomal protein L20 [Granulicatella elegans ATCC 700633]
          Length = 119

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  +  +VLK AKG+YG +    + AK AV +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRRRRNRVLKLAKGYYGAKSKLFKTAKQAVMKSYMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F  + E ++S L
Sbjct: 61  WIARINAAARLNGLSYSKLMHGLKLAGIEMNRKMLADLAVNDAAAFTVLAEQAKSAL 117


>gi|269119785|ref|YP_003307962.1| ribosomal protein L20 [Sebaldella termitidis ATCC 33386]
 gi|268613663|gb|ACZ08031.1| ribosomal protein L20 [Sebaldella termitidis ATCC 33386]
          Length = 114

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 75/112 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKKVL  AKGF G  +   + A  AV ++  YA   R++KKR  R L
Sbjct: 1   MPRVKTGIVRKKRHKKVLAEAKGFRGSSRTNYKKANEAVKKAMAYATEHRKLKKRKMREL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVEL 112
           WI RINAA R+  L+YS+F+NGL K+GI LDRKVL+DLA+     F K+V+L
Sbjct: 61  WIIRINAAARLNGLSYSKFMNGLKKSGIELDRKVLADLAVNNAGEFAKLVDL 112


>gi|254993710|ref|ZP_05275900.1| 50S ribosomal protein L20 [Listeria monocytogenes FSL J2-064]
          Length = 118

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK++K AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKIVKLAKGYYGSKHLLFKVANQAVMKSYQYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+ DL+YS+ ++GL  AGI ++RK+L+DLA+  + SF  + +
Sbjct: 61  WIARINAAARMQDLSYSKLMHGLKLAGIDINRKMLADLAVNDIASFNTLAD 111


>gi|310814728|ref|YP_003962692.1| 50S ribosomal protein L20 [Ketogulonicigenium vulgare Y25]
 gi|308753463|gb|ADO41392.1| 50S ribosomal protein L20 [Ketogulonicigenium vulgare Y25]
          Length = 120

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 91/119 (76%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K G V+  +HKKVL +AKG+Y  R+ T + AK AVD++ QYA RDRRV++R+FR+L
Sbjct: 1   MSRTKGGTVTHRRHKKVLDAAKGYYDHRRRTFKVAKQAVDKANQYATRDRRVRRRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR  D  LNYS+FINGL  AGI +DRKVL+DLA+ + ++F  IVE +++ L
Sbjct: 61  WIQRINAGVRAIDQTLNYSKFINGLALAGIEVDRKVLADLAVHEPEAFAAIVEKAKAAL 119


>gi|332878460|ref|ZP_08446181.1| ribosomal protein L20 [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332683555|gb|EGJ56431.1| ribosomal protein L20 [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 114

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 76/110 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+L   KG++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKILGLTKGYFGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  ++YSQ +  LHKAGI ++RKVL+DLA+   ++FK +V
Sbjct: 61  WIQRINAAARLEGMSYSQLMGALHKAGIEINRKVLADLAMNHPEAFKAVV 110


>gi|289422364|ref|ZP_06424210.1| ribosomal protein L20 [Peptostreptococcus anaerobius 653-L]
 gi|289157199|gb|EFD05818.1| ribosomal protein L20 [Peptostreptococcus anaerobius 653-L]
          Length = 118

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+G+ +  +HKK+LK AKGF G R    + +   V +S + AY  R+ KKRDFR L
Sbjct: 1   MARVKKGMNAHKRHKKILKLAKGFRGSRSKLFKTSNQFVMKSLKNAYVGRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+ D++YS+F++GL KA I ++RK+LS++AI     F ++VE+++S+L
Sbjct: 61  WIQRINAACRMNDISYSKFMHGLKKADIEVNRKMLSEMAIADPQGFAQLVEVAKSKL 117


>gi|242278818|ref|YP_002990947.1| ribosomal protein L20 [Desulfovibrio salexigens DSM 2638]
 gi|259646180|sp|C6BRG8|RL20_DESAD RecName: Full=50S ribosomal protein L20
 gi|242121712|gb|ACS79408.1| ribosomal protein L20 [Desulfovibrio salexigens DSM 2638]
          Length = 117

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 81/115 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRGV +  +HKK LK AKGF G      R A+  V+RS   AY  R+++KRD R LWI
Sbjct: 2   RVKRGVAAKRRHKKYLKMAKGFRGSGSTLYRTARERVERSLCMAYVGRKLRKRDMRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           QRINAA R+  ++YS+ I+GL  AG+ L+RKVL+DLA+    +F K+VE++++++
Sbjct: 62  QRINAAARLNGMSYSRLIHGLSTAGVTLNRKVLADLAVNDAPAFAKVVEIAKAQV 116


>gi|224476769|ref|YP_002634375.1| 50S ribosomal protein L20 [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254800339|sp|B9DNC4|RL20_STACT RecName: Full=50S ribosomal protein L20
 gi|222421376|emb|CAL28190.1| 50S ribosomal protein L20 [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 118

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KKV+K AKG++G ++   + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKVIKLAKGYFGAKRTLYKTAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + ++YS+ +NGL +A I ++RK+LS++AI+   +F ++VE +++ L
Sbjct: 61  WITRINAAARNHGMSYSKLMNGLKQADIDINRKMLSEIAISDDKAFGELVEKAKAAL 117


>gi|150007318|ref|YP_001302061.1| 50S ribosomal protein L20 [Parabacteroides distasonis ATCC 8503]
 gi|255014057|ref|ZP_05286183.1| 50S ribosomal protein L20 [Bacteroides sp. 2_1_7]
 gi|256839607|ref|ZP_05545116.1| ribosomal protein L20 [Parabacteroides sp. D13]
 gi|262382109|ref|ZP_06075247.1| 50S ribosomal protein L20 [Bacteroides sp. 2_1_33B]
 gi|298375304|ref|ZP_06985261.1| ribosomal protein L20 [Bacteroides sp. 3_1_19]
 gi|301310682|ref|ZP_07216621.1| ribosomal protein L20 [Bacteroides sp. 20_3]
 gi|166219672|sp|A6L9S5|RL20_PARD8 RecName: Full=50S ribosomal protein L20
 gi|149935742|gb|ABR42439.1| ribosomal protein L20 [Parabacteroides distasonis ATCC 8503]
 gi|256738537|gb|EEU51862.1| ribosomal protein L20 [Parabacteroides sp. D13]
 gi|262297286|gb|EEY85216.1| 50S ribosomal protein L20 [Bacteroides sp. 2_1_33B]
 gi|298267804|gb|EFI09460.1| ribosomal protein L20 [Bacteroides sp. 3_1_19]
 gi|300832256|gb|EFK62887.1| ribosomal protein L20 [Bacteroides sp. 20_3]
          Length = 114

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 76/110 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G+YG RKN    AK   ++   YA+RDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYYGARKNVWTVAKNTWEKGLTYAFRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  L+YS+ +  LH AGI ++RKVL+DLA+   ++FK IV
Sbjct: 61  WIQRINAAARMEGLSYSRLMGALHAAGIEINRKVLADLAVNHPEAFKAIV 110


>gi|239905700|ref|YP_002952439.1| 50S ribosomal protein L20 [Desulfovibrio magneticus RS-1]
 gi|259646182|sp|C4XL14|RL20_DESMR RecName: Full=50S ribosomal protein L20
 gi|239795564|dbj|BAH74553.1| 50S ribosomal protein L20 [Desulfovibrio magneticus RS-1]
          Length = 117

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG  +  +HKK LK AKG+ G R      A+   +RS  YAYRDR+ +KR  R LWI
Sbjct: 2   RVKRGQAAHKRHKKFLKMAKGYVGARSKLYETAREVAERSLVYAYRDRKQRKRQMRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R   L+YS F++GL  AG+ LDRKVL+D+A+ + DSF+K+ EL +S++
Sbjct: 62  LRINAAARENGLSYSVFMHGLTVAGVELDRKVLADMAVREKDSFQKLAELVKSKV 116


>gi|212715581|ref|ZP_03323709.1| hypothetical protein BIFCAT_00480 [Bifidobacterium catenulatum DSM
           16992]
 gi|225351392|ref|ZP_03742415.1| hypothetical protein BIFPSEUDO_02986 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|212660948|gb|EEB21523.1| hypothetical protein BIFCAT_00480 [Bifidobacterium catenulatum DSM
           16992]
 gi|225157736|gb|EEG71019.1| hypothetical protein BIFPSEUDO_02986 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 127

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LAI+  ++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAISDPETFKAIVEQAKAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|226941670|ref|YP_002796744.1| 50S ribosomal protein L20 [Laribacter hongkongensis HLHK9]
 gi|254800326|sp|C1DDA3|RL20_LARHH RecName: Full=50S ribosomal protein L20
 gi|226716597|gb|ACO75735.1| RplT [Laribacter hongkongensis HLHK9]
          Length = 119

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+F+NGL KA I +DRKVL+DLA+ +   F ++VE +++ L
Sbjct: 61  WIARINAAARECGLSYSKFMNGLKKASIEIDRKVLADLAVFEKAVFAQLVEKAKASL 117


>gi|167037186|ref|YP_001664764.1| 50S ribosomal protein L20 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|307267645|ref|ZP_07549107.1| ribosomal protein L20 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|320115604|ref|YP_004185763.1| 50S ribosomal protein L20 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|326391473|ref|ZP_08213008.1| ribosomal protein L20 [Thermoanaerobacter ethanolicus JW 200]
 gi|226730466|sp|B0K8B5|RL20_THEP3 RecName: Full=50S ribosomal protein L20
 gi|166856020|gb|ABY94428.1| ribosomal protein L20 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|306917334|gb|EFN47646.1| ribosomal protein L20 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|319928695|gb|ADV79380.1| ribosomal protein L20 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325992499|gb|EGD50956.1| ribosomal protein L20 [Thermoanaerobacter ethanolicus JW 200]
          Length = 119

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG++G +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MARVKFGKVTRRRRKKILKLAKGYFGAKSKLFRVANQAVMKSLMYAYIGRKLRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + ++YS+FINGL KAGI ++RK+LS++AI    +F ++V +++ +L
Sbjct: 61  WITRINAAARAHGISYSRFINGLKKAGIEINRKMLSEMAINDEKAFAELVNIAKQQL 117


>gi|73662395|ref|YP_301176.1| 50S ribosomal protein L20 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82581579|sp|Q49YB0|RL20_STAS1 RecName: Full=50S ribosomal protein L20
 gi|72494910|dbj|BAE18231.1| 50S ribosomal protein L20 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 118

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 81/110 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G ++   + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKRTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V
Sbjct: 61  WITRINAAARQHDMSYSRLMNGLKKAEIDINRKMLSEIAISDEKAFGELV 110


>gi|51245277|ref|YP_065161.1| 50S ribosomal protein L20 [Desulfotalea psychrophila LSv54]
 gi|60390369|sp|Q6ANC0|RL20_DESPS RecName: Full=50S ribosomal protein L20
 gi|50876314|emb|CAG36154.1| probable 50S ribosomal protein L20 [Desulfotalea psychrophila
           LSv54]
          Length = 118

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV RG  +  +  +VLK AKG+ G R    + A  AVDR+  YAYRDR+ +KRDFR L
Sbjct: 1   MPRVTRGFKARRRRNRVLKLAKGYRGARSRLFKTATEAVDRALCYAYRDRKQRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKI 109
           WI RINA  ++ D+NYS+FI GL KAGI LDRKVL++LA+    +F K+
Sbjct: 61  WITRINAGAKMNDINYSRFIGGLAKAGIELDRKVLANLAVLDAPAFTKL 109


>gi|289661759|ref|ZP_06483340.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289668710|ref|ZP_06489785.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 112

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%)

Query: 13  KHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVY 72
           +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSLWI RINAA R+ 
Sbjct: 6   RHKKILTLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSLWITRINAAARIN 65

Query: 73  DLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            L+YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L
Sbjct: 66  GLSYSRFMNGLLKAGITLDRKVLADIAVHDAAGFAALAEKAKGAL 110


>gi|224438522|ref|ZP_03659442.1| 50S ribosomal protein L20 [Helicobacter cinaedi CCUG 18818]
 gi|313144949|ref|ZP_07807142.1| 50S ribosomal protein L20 [Helicobacter cinaedi CCUG 18818]
 gi|313129980|gb|EFR47597.1| 50S ribosomal protein L20 [Helicobacter cinaedi CCUG 18818]
          Length = 117

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKK+LK A+GFY  R+   R AK  ++RS  YA+RDR+ KKRDFR LWI
Sbjct: 2   RVKTGVVRRRRHKKILKLARGFYSGRRKHFRKAKEQLERSMCYAFRDRKQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA ++  ++YS+FI+ L  A I LDRK+L+D+A+  + +F  IV   + R+
Sbjct: 62  TRINAACKMNGISYSRFIHALKLANIDLDRKILADMAMNDIQTFNTIVASVKDRI 116


>gi|224065238|ref|XP_002301732.1| predicted protein [Populus trichocarpa]
 gi|222843458|gb|EEE81005.1| predicted protein [Populus trichocarpa]
          Length = 126

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 76/101 (75%)

Query: 15  KKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDL 74
           K++ K AKGF GR KN IR A+  V+++ QY+YRDRR KKRD RSLWIQRINA  R + +
Sbjct: 4   KEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGV 63

Query: 75  NYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           NY  F++GL K  I L+RKVLS++++ +  SFK +V++SR+
Sbjct: 64  NYGNFMHGLMKENIQLNRKVLSEISMHEPYSFKALVDISRN 104


>gi|322419728|ref|YP_004198951.1| 50S ribosomal protein L20 [Geobacter sp. M18]
 gi|320126115|gb|ADW13675.1| ribosomal protein L20 [Geobacter sp. M18]
          Length = 117

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/106 (54%), Positives = 75/106 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  L+YS+ I+GL  A + +DRKV++DLA++    F
Sbjct: 61  WITRINAAARINGLSYSKLIHGLKLANVEIDRKVMADLAVSDPKGF 106


>gi|325067169|ref|ZP_08125842.1| 50S ribosomal protein L20 [Actinomyces oris K20]
 gi|326771654|ref|ZP_08230939.1| ribosomal protein L20 [Actinomyces viscosus C505]
 gi|326637787|gb|EGE38688.1| ribosomal protein L20 [Actinomyces viscosus C505]
          Length = 126

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YA+RDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEKASGYRGQRSRLYRKAKEQVTHSGVYAFRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +   FK +VE++R  L  D
Sbjct: 61  WIQRINAAARAEGLTYNRFIQGLGLAGVEIDRRMLAELAVNEPAGFKALVEVARKALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|255632234|gb|ACU16475.1| unknown [Glycine max]
          Length = 121

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           K+ K AKGF GR KN IR A+  V+++ QY+YRDRR  KRD RSLWIQRINA  R++ +N
Sbjct: 5   KIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNNKRDMRSLWIQRINAGTRIHGVN 64

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           Y  F++GL K  I L+RKVLS++++ +  SFK +V++SR+
Sbjct: 65  YGNFMHGLMKENIQLNRKVLSEISMHEPYSFKSLVDISRN 104


>gi|88803832|ref|ZP_01119355.1| 50S ribosomal protein L20 [Polaribacter irgensii 23-P]
 gi|88780360|gb|EAR11542.1| 50S ribosomal protein L20 [Polaribacter irgensii 23-P]
          Length = 114

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+LK+AKG++GRRKN    AK AV++   YAYRDR+  KR+FRSL
Sbjct: 1   MPRSVNSVASRKRRKKILKAAKGYFGRRKNVYTVAKNAVEKGMLYAYRDRKNNKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R++ ++YSQF+  +    I L+RKVL+DLA+    +FK +VE
Sbjct: 61  WIVRINAAARLHGMSYSQFMGKVKAHSIELNRKVLADLAMNNPQAFKAVVE 111


>gi|282927809|ref|ZP_06335420.1| 50S ribosomal protein L20 [Staphylococcus aureus A10102]
 gi|282590319|gb|EFB95398.1| 50S ribosomal protein L20 [Staphylococcus aureus A10102]
          Length = 118

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKKIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R ++++YS+ +NGL KAGI ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDAL 117


>gi|32490833|ref|NP_871087.1| 50S ribosomal protein L20 [Wigglesworthia glossinidia endosymbiont
           of Glossina brevipalpis]
 gi|31340356|sp|Q8D3B7|RL20_WIGBR RecName: Full=50S ribosomal protein L20
 gi|25166039|dbj|BAC24230.1| rplT [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 117

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 79/111 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR+KRGV S  +HKK+LK  KG+YG R  + R A  A  ++ QYAYRDR+ KKR FR +
Sbjct: 1   MTRIKRGVSSKFRHKKILKKTKGYYGARSRSYRIAFQAFIKAGQYAYRDRKNKKRTFRKI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RIN+AVR + L+YS F+  + K  I +DRK+LSDLA+   ++F ++++
Sbjct: 61  WICRINSAVRKHGLSYSCFMYKIKKLSIFIDRKILSDLAVLNKEAFSELIK 111


>gi|225181658|ref|ZP_03735098.1| ribosomal protein L20 [Dethiobacter alkaliphilus AHT 1]
 gi|225167639|gb|EEG76450.1| ribosomal protein L20 [Dethiobacter alkaliphilus AHT 1]
          Length = 117

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 83/115 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HK+V+K AKG++G +    + A  AV +S   AYRDRR++KRD+R L
Sbjct: 1   MPRVKRGVATRARHKRVIKLAKGYFGAKSKLFKTANQAVMKSLANAYRDRRLRKRDYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA RV  ++YS+ + GL +AGI ++RK+L+DLA+   + F +++ +++ 
Sbjct: 61  WISRINAAARVNGMSYSRMMYGLKRAGIDINRKMLADLAVNDAEGFSQLIGVAKE 115


>gi|116747875|ref|YP_844562.1| 50S ribosomal protein L20 [Syntrophobacter fumaroxidans MPOB]
 gi|166220797|sp|A0LFC5|RL20_SYNFM RecName: Full=50S ribosomal protein L20
 gi|116696939|gb|ABK16127.1| LSU ribosomal protein L20P [Syntrophobacter fumaroxidans MPOB]
          Length = 117

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 80/115 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+ V S  + KK+LK AKG+ G R   IR+A   VDR+ ++AYRDR+ +KR FRSL
Sbjct: 1   MPRVKKAVKSRERRKKILKLAKGYRGGRGKLIRSASETVDRALKFAYRDRKTRKRQFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R +DL+YS+F++ L KA I +DRK L+ LA+    +F K+  +++ 
Sbjct: 61  WIMRINAAAREHDLSYSRFMHALKKANIDMDRKALAHLAVNDPAAFAKLARIAKE 115


>gi|115439769|ref|NP_001044164.1| Os01g0734100 [Oryza sativa Japonica Group]
 gi|15624022|dbj|BAB68076.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group]
 gi|20161006|dbj|BAB89939.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group]
 gi|113533695|dbj|BAF06078.1| Os01g0734100 [Oryza sativa Japonica Group]
 gi|215693931|dbj|BAG89130.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218189012|gb|EEC71439.1| hypothetical protein OsI_03640 [Oryza sativa Indica Group]
 gi|222619213|gb|EEE55345.1| hypothetical protein OsJ_03363 [Oryza sativa Japonica Group]
          Length = 122

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           K+ K AKGF GR KN IR A+  V+++ QY+YRDR  KKRD RSLWI+RINA  R++ +N
Sbjct: 5   KIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRHNKKRDMRSLWIERINAGTRLHGVN 64

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           Y  F++GL K  I L+RKVLS+L++ +  SFK +V++SRS
Sbjct: 65  YGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSRS 104


>gi|332653952|ref|ZP_08419696.1| ribosomal protein L20 [Ruminococcaceae bacterium D16]
 gi|332517038|gb|EGJ46643.1| ribosomal protein L20 [Ruminococcaceae bacterium D16]
          Length = 118

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  +  K+LK AKG++G +    + A  AV +S  YAY  R++KKRDFR L
Sbjct: 1   MARVKGAMMTRKRRNKILKMAKGYWGAKSKHFKMANQAVMKSGSYAYTGRKLKKRDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA ++  +NYS F+NGL KAGIV++RK+LS+LA+    +F ++ E ++  L
Sbjct: 61  WITRINAACKMNGMNYSTFMNGLKKAGIVINRKMLSELAVNDKAAFAQLTETAKKAL 117


>gi|15615700|ref|NP_244004.1| 50S ribosomal protein L20 [Bacillus halodurans C-125]
 gi|14195132|sp|Q9K869|RL20_BACHD RecName: Full=50S ribosomal protein L20
 gi|10175760|dbj|BAB06857.1| 50S ribosomal protein L20 [Bacillus halodurans C-125]
          Length = 119

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    ++A+  V +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYVARRRRKKVLKLAKGYFGSKHTLFKSAQGQVMKSLQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLAI    +F ++ E +++ L
Sbjct: 61  WITRINAAARLNGLSYSRLMHGLKLAGINVNRKMLADLAINDEKAFAQLAEKAKASL 117


>gi|225464801|ref|XP_002268463.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|147832535|emb|CAN74888.1| hypothetical protein VITISV_041868 [Vitis vinifera]
 gi|296087520|emb|CBI34109.3| unnamed protein product [Vitis vinifera]
          Length = 125

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 77/100 (77%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           K+ K AKGF GR KN IR A+  V+++ QY+YRDRR KKRD RSLWI+RINA  R++ +N
Sbjct: 5   KIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRTKKRDMRSLWIERINAGSRLHGVN 64

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           Y+ FI+GL K  I L+RKVLS+L++ +  +FK +V++S++
Sbjct: 65  YNNFIHGLMKENIQLNRKVLSELSMHEPYTFKALVDISQN 104


>gi|119358272|ref|YP_912916.1| 50S ribosomal protein L20 [Chlorobium phaeobacteroides DSM 266]
 gi|166219629|sp|A1BJB5|RL20_CHLPD RecName: Full=50S ribosomal protein L20
 gi|119355621|gb|ABL66492.1| LSU ribosomal protein L20P [Chlorobium phaeobacteroides DSM 266]
          Length = 115

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M +    V S A+ K++LK AKGF+G R N +   K AVD+++QYAYRDRR KKR FRSL
Sbjct: 1   MPKANNAVASRARRKRILKKAKGFWGSRGNILTVVKHAVDKAEQYAYRDRRAKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+    YS+ +N + K  I +DRK L+++A+    +F +IV+
Sbjct: 61  WIMRINAAARLNGTTYSKMVNAMSKKSIEIDRKTLAEIAVKDPAAFSQIVK 111


>gi|282881466|ref|ZP_06290140.1| putative ribosomal protein L20 [Prevotella timonensis CRIS 5C-B1]
 gi|281304692|gb|EFA96778.1| putative ribosomal protein L20 [Prevotella timonensis CRIS 5C-B1]
          Length = 114

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG++G RKN    AK   ++   YAYRDRR KKR+FRSL
Sbjct: 1   MPRSVNHVASKAKRTRILKQTKGYFGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+  ++YS  +  L+KAGI ++RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAAARLEGMSYSVLMGALNKAGIEINRKVLADLAVNNPEAFKAIVD 111


>gi|289550565|ref|YP_003471469.1| LSU ribosomal protein L20p [Staphylococcus lugdunensis HKU09-01]
 gi|315658059|ref|ZP_07910932.1| 50S ribosomal protein L20 [Staphylococcus lugdunensis M23590]
 gi|289180097|gb|ADC87342.1| LSU ribosomal protein L20p [Staphylococcus lugdunensis HKU09-01]
 gi|315496949|gb|EFU85271.1| 50S ribosomal protein L20 [Staphylococcus lugdunensis M23590]
          Length = 118

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDMSYSRLMNGLKKADIDINRKMLSEIAISDEKAFGELVSKAKEAL 117


>gi|237744048|ref|ZP_04574529.1| LSU ribosomal protein L20P [Fusobacterium sp. 7_1]
 gi|256028152|ref|ZP_05441986.1| 50S ribosomal protein L20 [Fusobacterium sp. D11]
 gi|260494367|ref|ZP_05814498.1| ribosomal protein L20 [Fusobacterium sp. 3_1_33]
 gi|289766088|ref|ZP_06525466.1| LSU ribosomal protein L20P [Fusobacterium sp. D11]
 gi|229431277|gb|EEO41489.1| LSU ribosomal protein L20P [Fusobacterium sp. 7_1]
 gi|260198513|gb|EEW96029.1| ribosomal protein L20 [Fusobacterium sp. 3_1_33]
 gi|289717643|gb|EFD81655.1| LSU ribosomal protein L20P [Fusobacterium sp. D11]
          Length = 116

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G++   +HK+VLK+AKGF G   +  + AK A  ++  YA RDR+V KR  R LWI
Sbjct: 2   RVKTGIIRRKRHKRVLKAAKGFRGASGDAFKQAKQATRKAMAYATRDRKVNKRRMRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RIN+A R+  ++YS  +NGL KAGI+LDRKVL+D+A+     F K+VE ++S L
Sbjct: 62  TRINSAARMNGVSYSVLMNGLKKAGILLDRKVLADIALNNATEFTKLVEAAKSAL 116


>gi|171742547|ref|ZP_02918354.1| hypothetical protein BIFDEN_01660 [Bifidobacterium dentium ATCC
           27678]
 gi|283456367|ref|YP_003360931.1| 50S ribosomal protein L20P [Bifidobacterium dentium Bd1]
 gi|306822460|ref|ZP_07455838.1| 50S ribosomal protein L20 [Bifidobacterium dentium ATCC 27679]
 gi|309801412|ref|ZP_07695539.1| ribosomal protein L20 [Bifidobacterium dentium JCVIHMP022]
 gi|171278161|gb|EDT45822.1| hypothetical protein BIFDEN_01660 [Bifidobacterium dentium ATCC
           27678]
 gi|283103001|gb|ADB10107.1| rplT LSU ribosomal protein L20P [Bifidobacterium dentium Bd1]
 gi|304554005|gb|EFM41914.1| 50S ribosomal protein L20 [Bifidobacterium dentium ATCC 27679]
 gi|308221927|gb|EFO78212.1| ribosomal protein L20 [Bifidobacterium dentium JCVIHMP022]
          Length = 127

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LA++  ++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAVSDPETFKAIVEQAKAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|297183123|gb|ADI19266.1| hypothetical protein [uncultured delta proteobacterium
           HF0200_39L23]
          Length = 118

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 81/115 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKR V +  + K   ++AKG+ G R    R  K AV+RS++Y++RDR+V+KRDFR LWI
Sbjct: 2   RVKRAVQAKKRKKAYFQAAKGYRGGRSRLWRTVKDAVERSREYSFRDRKVRKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAAVR + +NYSQFI+GL +A I LDRK L+ LA+ + + F KI   ++ +L
Sbjct: 62  TRINAAVRDHGMNYSQFIHGLQQAEIDLDRKALAHLAMEEPEMFAKIAGEAKEKL 116


>gi|126663525|ref|ZP_01734522.1| 50S ribosomal protein L20 [Flavobacteria bacterium BAL38]
 gi|126624473|gb|EAZ95164.1| 50S ribosomal protein L20 [Flavobacteria bacterium BAL38]
          Length = 114

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V + A+ K+VLK AKGF+GRRKN    AK AV+++  YAYRDR+  KR+FR+L
Sbjct: 1   MPRATNSVATKARKKRVLKQAKGFFGRRKNVWTVAKNAVEKAMCYAYRDRKQNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YSQF+  +    I L+RKVL+DLA+   ++F  IV 
Sbjct: 61  WITRINAGARLHGMSYSQFMGKVKANNIELNRKVLADLAMNHSEAFTAIVN 111


>gi|225019251|ref|ZP_03708443.1| hypothetical protein CLOSTMETH_03204 [Clostridium methylpentosum
           DSM 5476]
 gi|224947882|gb|EEG29091.1| hypothetical protein CLOSTMETH_03204 [Clostridium methylpentosum
           DSM 5476]
          Length = 117

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR +++  + KKV+K AKG++G +    R AK AV +S QYAY  R+ KKRDFR +
Sbjct: 1   MARVKRAMMTRKRRKKVMKLAKGYFGGKSKLFRTAKEAVMKSGQYAYIGRKQKKRDFRRI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+A  ++  +NYS FINGL KA I L+RK+LS++AI    +F  + E +++ L
Sbjct: 61  WITRISAGCKMNGMNYSTFINGLKKANITLNRKMLSEIAINDPAAFTALCEKAKAAL 117


>gi|254519560|ref|ZP_05131616.1| ribosomal protein L20 [Clostridium sp. 7_2_43FAA]
 gi|226913309|gb|EEH98510.1| ribosomal protein L20 [Clostridium sp. 7_2_43FAA]
          Length = 118

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 81/115 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   HKKVLK AKG+YG +    + A  +V R+ + AY  RR+KKRDFR L
Sbjct: 1   MARVKRAVNARKNHKKVLKLAKGYYGGKSRLFKTANESVIRALRNAYVGRRLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+  L+YS+F+NGL  AGI ++RK+LS++AI    +F  +VEL++S
Sbjct: 61  WIARINAASRMNGLSYSRFMNGLKLAGIDMNRKMLSEIAINDPKAFADLVELAKS 115


>gi|19703668|ref|NP_603230.1| 50S ribosomal protein L20 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|256845726|ref|ZP_05551184.1| ribosomal protein L20 [Fusobacterium sp. 3_1_36A2]
 gi|294785028|ref|ZP_06750316.1| ribosomal protein L20 [Fusobacterium sp. 3_1_27]
 gi|296327261|ref|ZP_06869816.1| 50S ribosomal protein L20 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
 gi|22096052|sp|Q8RGH2|RL20_FUSNN RecName: Full=50S ribosomal protein L20
 gi|19713788|gb|AAL94529.1| LSU ribosomal protein L20P [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|256719285|gb|EEU32840.1| ribosomal protein L20 [Fusobacterium sp. 3_1_36A2]
 gi|294486742|gb|EFG34104.1| ribosomal protein L20 [Fusobacterium sp. 3_1_27]
 gi|296155618|gb|EFG96380.1| 50S ribosomal protein L20 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
          Length = 116

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G++   +HK+VLK+AKGF G   +  + AK A  R+  +A RDR+V KR  R LWI
Sbjct: 2   RVKTGIIRRKRHKRVLKAAKGFRGASGDAFKQAKQATRRAMAFATRDRKVNKRRMRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RIN+A R+  ++YS  +NGL KAGI+LDRKVL+D+A+     F K+VE ++S L
Sbjct: 62  TRINSAARMNGVSYSVLMNGLKKAGILLDRKVLADIALNNATEFTKLVEAAKSAL 116


>gi|303248733|ref|ZP_07334986.1| ribosomal protein L20 [Desulfovibrio fructosovorans JJ]
 gi|302489898|gb|EFL49826.1| ribosomal protein L20 [Desulfovibrio fructosovorans JJ]
          Length = 117

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG  +  +HKK LK AKGF G R      A+   +RS  YAYRDR+ +KR  R LWI
Sbjct: 2   RVKRGQAAHKRHKKYLKMAKGFVGARGVLYETAREVAERSLAYAYRDRKQRKRQMRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R   L+YS F+ GL  AG+ LDRKVL+D+A+ + DSF+K+ EL+++++
Sbjct: 62  IRINAAARENGLSYSVFMRGLTLAGVELDRKVLADMAVREKDSFQKLAELAKAKV 116


>gi|257452490|ref|ZP_05617789.1| 50S ribosomal protein L20 [Fusobacterium sp. 3_1_5R]
 gi|257466357|ref|ZP_05630668.1| 50S ribosomal protein L20 [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917513|ref|ZP_07913753.1| LSU ribosomal protein L20P [Fusobacterium gonidiaformans ATCC
           25563]
 gi|317059031|ref|ZP_07923516.1| LSU ribosomal protein L20P [Fusobacterium sp. 3_1_5R]
 gi|313684707|gb|EFS21542.1| LSU ribosomal protein L20P [Fusobacterium sp. 3_1_5R]
 gi|313691388|gb|EFS28223.1| LSU ribosomal protein L20P [Fusobacterium gonidiaformans ATCC
           25563]
          Length = 116

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G+V   +HKK+LK+AKGF G   + ++ AK A  ++  Y+ RDR+V KR  R LWI
Sbjct: 2   RVKTGIVRRRRHKKILKAAKGFRGASGDALKQAKQATMKAMAYSTRDRKVNKRRMRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
            RIN+A R+  L YS F+NGL KAGI LDRKVL+DLA+     F K+ E +++
Sbjct: 62  TRINSAARLNGLTYSVFMNGLKKAGIELDRKVLADLALNNAAEFAKLAETAKA 114


>gi|256394617|ref|YP_003116181.1| 50S ribosomal protein L20 [Catenulispora acidiphila DSM 44928]
 gi|256360843|gb|ACU74340.1| ribosomal protein L20 [Catenulispora acidiphila DSM 44928]
          Length = 129

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRVVLEQASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKDRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH A + +DRK+L++LA+   D+F+ +VE+++  L  D
Sbjct: 61  WIQRINAAVRAEGMTYNRFIQGLHLANVEVDRKMLAELAVNDADAFRALVEVAKKALPSD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|119026092|ref|YP_909937.1| 50S ribosomal protein L20 [Bifidobacterium adolescentis ATCC 15703]
 gi|154488865|ref|ZP_02029714.1| hypothetical protein BIFADO_02173 [Bifidobacterium adolescentis
           L2-32]
 gi|166219611|sp|A1A2C2|RL20_BIFAA RecName: Full=50S ribosomal protein L20
 gi|118765676|dbj|BAF39855.1| 50S ribosomal protein L20 [Bifidobacterium adolescentis ATCC 15703]
 gi|154083002|gb|EDN82047.1| hypothetical protein BIFADO_02173 [Bifidobacterium adolescentis
           L2-32]
          Length = 127

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LA++  ++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAVSDPEAFKAIVEQAKAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|70726248|ref|YP_253162.1| 50S ribosomal protein L20 [Staphylococcus haemolyticus JCSC1435]
 gi|82581578|sp|Q4L719|RL20_STAHJ RecName: Full=50S ribosomal protein L20
 gi|68446972|dbj|BAE04556.1| 50S ribosomal protein L20 [Staphylococcus haemolyticus JCSC1435]
          Length = 118

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGAKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDMSYSRLMNGLKKADININRKMLSEVAISDEKAFAELVSKAKEAL 117


>gi|256751284|ref|ZP_05492164.1| ribosomal protein L20 [Thermoanaerobacter ethanolicus CCSD1]
 gi|256749839|gb|EEU62863.1| ribosomal protein L20 [Thermoanaerobacter ethanolicus CCSD1]
          Length = 119

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG++G +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MARVKFGKVTRRRRKKILKLAKGYWGAKSKLFRVANQAVMKSLMYAYIGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + ++YS+FINGL KAGI ++RK+LS++AI    +F ++V +++ +L
Sbjct: 61  WITRINAAARAHGISYSRFINGLKKAGIEINRKMLSEMAINDEKAFAELVNIAKQQL 117


>gi|256379475|ref|YP_003103135.1| ribosomal protein L20 [Actinosynnema mirum DSM 43827]
 gi|255923778|gb|ACU39289.1| ribosomal protein L20 [Actinosynnema mirum DSM 43827]
          Length = 129

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTTLELASGYRGQRSRLYRKAKEQVLHSLNYAYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINA VR   + Y++FI GL  AGI +DRK+L++LA++   +F  +VEL+++ +  D
Sbjct: 61  WIQRINAGVRANGMTYNRFIQGLRLAGIEVDRKILAELAVSDPTAFAAVVELAKAAMPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|50842893|ref|YP_056120.1| 50S ribosomal protein L20 [Propionibacterium acnes KPA171202]
 gi|282854557|ref|ZP_06263892.1| ribosomal protein L20 [Propionibacterium acnes J139]
 gi|60390367|sp|Q6A7V3|RL20_PROAC RecName: Full=50S ribosomal protein L20
 gi|50840495|gb|AAT83162.1| 50S ribosomal protein L20 [Propionibacterium acnes KPA171202]
 gi|282582139|gb|EFB87521.1| ribosomal protein L20 [Propionibacterium acnes J139]
 gi|314923956|gb|EFS87787.1| ribosomal protein L20 [Propionibacterium acnes HL001PA1]
 gi|314966002|gb|EFT10101.1| ribosomal protein L20 [Propionibacterium acnes HL082PA2]
 gi|314981815|gb|EFT25908.1| ribosomal protein L20 [Propionibacterium acnes HL110PA3]
 gi|315090683|gb|EFT62659.1| ribosomal protein L20 [Propionibacterium acnes HL110PA4]
 gi|315094894|gb|EFT66870.1| ribosomal protein L20 [Propionibacterium acnes HL060PA1]
 gi|315104166|gb|EFT76142.1| ribosomal protein L20 [Propionibacterium acnes HL050PA2]
 gi|315106685|gb|EFT78661.1| ribosomal protein L20 [Propionibacterium acnes HL030PA1]
 gi|327327989|gb|EGE69758.1| ribosomal protein L20 [Propionibacterium acnes HL103PA1]
 gi|327333953|gb|EGE75669.1| ribosomal protein L20 [Propionibacterium acnes HL097PA1]
          Length = 123

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 83/123 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL  A G+ G+R    R AK     S  Y++RDRR KK DFRSL
Sbjct: 1   MARVKRSVNAKKKRREVLDQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FINGL  AG+ +DRK+L++LA++ +++F  +VE++++    +
Sbjct: 61  WIQRINAASRAQGMTYNRFINGLKNAGVEVDRKMLAELAVSDINAFNSLVEVAKANQPQN 120

Query: 121 VAS 123
            A+
Sbjct: 121 AAA 123


>gi|212691285|ref|ZP_03299413.1| hypothetical protein BACDOR_00776 [Bacteroides dorei DSM 17855]
 gi|237712286|ref|ZP_04542767.1| 50S ribosomal protein L20 [Bacteroides sp. 9_1_42FAA]
 gi|237726425|ref|ZP_04556906.1| 50S ribosomal protein L20 [Bacteroides sp. D4]
 gi|265751994|ref|ZP_06087787.1| 50S ribosomal protein L20 [Bacteroides sp. 3_1_33FAA]
 gi|212666517|gb|EEB27089.1| hypothetical protein BACDOR_00776 [Bacteroides dorei DSM 17855]
 gi|229434951|gb|EEO45028.1| 50S ribosomal protein L20 [Bacteroides dorei 5_1_36/D4]
 gi|229453607|gb|EEO59328.1| 50S ribosomal protein L20 [Bacteroides sp. 9_1_42FAA]
 gi|263236786|gb|EEZ22256.1| 50S ribosomal protein L20 [Bacteroides sp. 3_1_33FAA]
          Length = 116

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 76/110 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+L   KG++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKILGLTKGYFGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  ++YS+ +  LHKAGI ++RKVL+DLA+   ++FK IV
Sbjct: 61  WIQRINAAARLEGMSYSKLMGALHKAGIEINRKVLADLAMNHPEAFKAIV 110


>gi|254302738|ref|ZP_04970096.1| ribosomal protein L20 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|148322930|gb|EDK88180.1| ribosomal protein L20 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
          Length = 116

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G++   +HK+VLK+AKGF G   +  + AK A  R+  +A RDR+V KR  R LWI
Sbjct: 2   RVKTGIIRRKRHKRVLKAAKGFRGASGDAFKQAKQATRRAMAFATRDRKVNKRRMRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RIN+A R+  ++YS  +NGL KAGI+LDRKVL+D+A+     F K+VE ++S L
Sbjct: 62  TRINSAARMNGVSYSVLMNGLKKAGILLDRKVLADIALNNAAEFTKLVETAKSAL 116


>gi|317052585|ref|YP_004113701.1| 50S ribosomal protein L20 [Desulfurispirillum indicum S5]
 gi|316947669|gb|ADU67145.1| ribosomal protein L20 [Desulfurispirillum indicum S5]
          Length = 117

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/108 (51%), Positives = 78/108 (72%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVLK  KG+ G R N  R A   + R+  +A+RDR+V+KR+FR LWI
Sbjct: 2   RVKGGFVTRRRHKKVLKQTKGYRGGRSNLFRMANTTLVRALNFAFRDRKVRKREFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
            RINAAVR + L+YS+F++GL +A + LDRKVL+D+A+    SF+ +V
Sbjct: 62  IRINAAVRPHGLSYSRFMHGLKQAQVHLDRKVLADMAVNSPSSFEAVV 109


>gi|227497643|ref|ZP_03927861.1| 50S ribosomal protein L20 [Actinomyces urogenitalis DSM 15434]
 gi|226832914|gb|EEH65297.1| 50S ribosomal protein L20 [Actinomyces urogenitalis DSM 15434]
          Length = 126

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YA+RDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEKASGYRGQRSRLYRKAKEQVTHSGVYAFRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +   FK +VE+++  L  D
Sbjct: 61  WIQRINAAARAEGLTYNRFIQGLGLAGVEIDRRMLAELAVNEPAGFKALVEVAKKALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|298243922|ref|ZP_06967729.1| ribosomal protein L20 [Ktedonobacter racemifer DSM 44963]
 gi|297556976|gb|EFH90840.1| ribosomal protein L20 [Ktedonobacter racemifer DSM 44963]
          Length = 121

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 54/106 (50%), Positives = 75/106 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  KHKK+L+ A+G  G RK   R A  +V RS  Y YRDRR +KRD RSL
Sbjct: 1   MPRVKRGVPAHKKHKKLLQFAEGHRGTRKRLFRPAHESVMRSMAYMYRDRRNRKRDMRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R++ ++YS  ++ +H A I +DRK+L+++A+  +D+F
Sbjct: 61  WITRINAAARMHGISYSTLMHAIHVANIDVDRKILAEMAVNDMDAF 106


>gi|262037714|ref|ZP_06011156.1| ribosomal protein L20 [Leptotrichia goodfellowii F0264]
 gi|261748186|gb|EEY35583.1| ribosomal protein L20 [Leptotrichia goodfellowii F0264]
          Length = 114

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 74/111 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKKVLK AKG+ G  K   + A  AV ++  YA   R+ KKR  R L
Sbjct: 1   MPRVKTGIVRRKRHKKVLKEAKGYRGSVKTNFKKANEAVKKAMAYATEHRKQKKRKMREL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+  ++YS+F+NGL KAGI LDRKVL+DLA+     F K+VE
Sbjct: 61  WIIRINAAARLNGVSYSKFMNGLKKAGIELDRKVLADLALNNPADFAKLVE 111


>gi|205374570|ref|ZP_03227366.1| 50S ribosomal protein L20 [Bacillus coahuilensis m4-4]
          Length = 119

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG++G +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVIKLAKGYFGSKHTLYKVANQAVMKSGQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L++LAI    +F ++ E ++++ 
Sbjct: 61  WIARINAAARMNGLSYSRLMHGLKLAGIEVNRKMLAELAIADEKAFAQLAETAKAQF 117


>gi|256827015|ref|YP_003150974.1| 50S ribosomal protein L20P [Cryptobacterium curtum DSM 15641]
 gi|256583158|gb|ACU94292.1| LSU ribosomal protein L20P [Cryptobacterium curtum DSM 15641]
          Length = 117

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK A+G+YG +  + RAAK  V  S QY YRDRR KKR+ R L
Sbjct: 1   MPRVKRAVNAHKKRRVVLKRARGYYGAKSRSYRAAKEQVRHSLQYQYRDRRNKKREIRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAA R+  ++YS F+NGL K+GI LDRKVL+D+A+    +F  +VE++
Sbjct: 61  WITRINAAARLNGMSYSTFMNGLKKSGIELDRKVLADMAVNDAAAFAALVEVA 113


>gi|218459864|ref|ZP_03499955.1| 50S ribosomal protein L20 [Rhizobium etli Kim 5]
          Length = 73

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 55/65 (84%), Positives = 61/65 (93%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVKRGV + AKHKKVLK+AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1  MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61 WIQRI 65
          WIQRI
Sbjct: 61 WIQRI 65


>gi|154490248|ref|ZP_02030509.1| hypothetical protein PARMER_00480 [Parabacteroides merdae ATCC
           43184]
 gi|154089140|gb|EDN88184.1| hypothetical protein PARMER_00480 [Parabacteroides merdae ATCC
           43184]
          Length = 114

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 76/110 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G+YG RKN    AK   ++   YA+RDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYYGARKNVWTVAKNTWEKGLTYAFRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  ++YS+ +  LH AGI ++RKVL+DLA+   ++FK IV
Sbjct: 61  WIQRINAAARLEGMSYSRLMGALHAAGIEINRKVLADLAMNHPEAFKAIV 110


>gi|237742398|ref|ZP_04572879.1| LSU ribosomal protein L20P [Fusobacterium sp. 4_1_13]
 gi|229430046|gb|EEO40258.1| LSU ribosomal protein L20P [Fusobacterium sp. 4_1_13]
          Length = 116

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G++   +HK+VLK+AKGF G   +  + AK A  R+  +A RDR+V KR  R LWI
Sbjct: 2   RVKTGIIRRKRHKRVLKAAKGFRGASGDAFKQAKQATRRAMAFATRDRKVNKRRMRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RIN+A R+  ++YS  +NGL KAGI+LDRKVL+D+A+     F K+VE ++S L
Sbjct: 62  TRINSAARMNGVSYSVLMNGLKKAGILLDRKVLADIALNNAAEFTKLVEAAKSAL 116


>gi|239827994|ref|YP_002950618.1| 50S ribosomal protein L20 [Geobacillus sp. WCH70]
 gi|259646188|sp|C5D636|RL20_GEOSW RecName: Full=50S ribosomal protein L20
 gi|239808287|gb|ACS25352.1| ribosomal protein L20 [Geobacillus sp. WCH70]
          Length = 119

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    R A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R++ L+YS+F++GL  AG+ ++RK+L+DLA+    +F ++ +L+++ L
Sbjct: 61  WIARINAAARMHGLSYSRFMHGLKLAGVEVNRKMLADLAVNDQAAFAQLADLAKANL 117


>gi|302874882|ref|YP_003843515.1| 50S ribosomal protein L20 [Clostridium cellulovorans 743B]
 gi|307690501|ref|ZP_07632947.1| 50S ribosomal protein L20 [Clostridium cellulovorans 743B]
 gi|302577739|gb|ADL51751.1| ribosomal protein L20 [Clostridium cellulovorans 743B]
          Length = 118

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + S  KHKKVLK AKG+YG +    R A   V R+ + AY  RR+KKRDFR L
Sbjct: 1   MARVKRAMNSRKKHKKVLKLAKGYYGAKSKLFRTANETVIRALRNAYVGRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL  AGI ++RK+LS++AI    +F ++V ++++ +
Sbjct: 61  WIARINAAARMNGLSYSRFMNGLKVAGIDMNRKMLSEIAIHDPKAFTELVAVAKANI 117


>gi|167040675|ref|YP_001663660.1| 50S ribosomal protein L20 [Thermoanaerobacter sp. X514]
 gi|289578710|ref|YP_003477337.1| ribosomal protein L20 [Thermoanaerobacter italicus Ab9]
 gi|297544944|ref|YP_003677246.1| 50S ribosomal protein L20 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|300914716|ref|ZP_07132032.1| ribosomal protein L20 [Thermoanaerobacter sp. X561]
 gi|307724050|ref|YP_003903801.1| 50S ribosomal protein L20 [Thermoanaerobacter sp. X513]
 gi|226730467|sp|B0K3L3|RL20_THEPX RecName: Full=50S ribosomal protein L20
 gi|166854915|gb|ABY93324.1| ribosomal protein L20 [Thermoanaerobacter sp. X514]
 gi|289528423|gb|ADD02775.1| ribosomal protein L20 [Thermoanaerobacter italicus Ab9]
 gi|296842719|gb|ADH61235.1| ribosomal protein L20 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|300889651|gb|EFK84797.1| ribosomal protein L20 [Thermoanaerobacter sp. X561]
 gi|307581111|gb|ADN54510.1| ribosomal protein L20 [Thermoanaerobacter sp. X513]
          Length = 119

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG++G +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MARVKFGKVTRRRRKKILKLAKGYWGAKSKLFRVANQAVMKSLMYAYIGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + ++YS+FINGL KAGI ++RK+LS++AI    +F+++V +++  L
Sbjct: 61  WITRINAAARAHGISYSRFINGLKKAGIEINRKMLSEMAIHDEKAFEELVNIAKQHL 117


>gi|40062533|gb|AAR37478.1| ribosomal protein L20 [uncultured marine bacterium 106]
          Length = 118

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 82/115 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKR V +  + K + K+AKG+ G R   +R  K AVDRS++ +YRDR+VKKRDFR LWI
Sbjct: 2   RVKRAVHARKRKKSLFKAAKGYRGGRSRLLRTVKDAVDRSRESSYRDRKVKKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAAVR++ +NYSQFI GL  A I +DR+ L+ LA+ +   F ++ E ++++L
Sbjct: 62  VRINAAVRLHGMNYSQFIYGLKAADIEMDRRTLAYLAMEEPTLFAQVAEEAKTKL 116


>gi|300173540|ref|YP_003772706.1| 50S ribosomal protein L20 [Leuconostoc gasicomitatum LMG 18811]
 gi|299887919|emb|CBL91887.1| 50S ribosomal protein L20 [Leuconostoc gasicomitatum LMG 18811]
          Length = 139

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 84/118 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G VS A+ KK++K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVSRARRKKIVKLAKGYRGQRRINFKVAKQQVWKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG+ L+RK+L+D+A+T  D+F K+ + ++S L  D
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGVELNRKMLADIAVTDFDTFSKLADQAKSALAAD 119


>gi|27262224|gb|AAN87393.1| LSU ribosomal protein L20P [Heliobacillus mobilis]
          Length = 118

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G +S  +HKK+LK A+G+        R A  +V ++ QYAY  RR KK DFR L
Sbjct: 1   MARVKTGPMSRKRHKKILKLARGYRNAHSKLFRTAHQSVMKALQYAYAHRRKKKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  +NGL KAG+V++RK+L+DLA+  L +F K+V++++ +L
Sbjct: 61  WITRINAAARMNGISYSNMMNGLKKAGVVVNRKMLADLAVNDLPAFAKLVDVAKGQL 117


>gi|167752691|ref|ZP_02424818.1| hypothetical protein ALIPUT_00948 [Alistipes putredinis DSM 17216]
 gi|167659760|gb|EDS03890.1| hypothetical protein ALIPUT_00948 [Alistipes putredinis DSM 17216]
          Length = 114

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 74/111 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK AKG +G R N    AK  V++  QYAY  R++KKR FRSL
Sbjct: 1   MPRSVNAVASRARRKKVLKLAKGNFGSRGNVWTVAKNTVEKGLQYAYAHRQLKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAAVR   + YSQFI  L+  GIVL+RKVL+DLA+ +  +F+ IV 
Sbjct: 61  WIMRINAAVRAQGMTYSQFIGKLNAKGIVLNRKVLADLAMNEPKAFEAIVN 111


>gi|194335334|ref|YP_002017128.1| ribosomal protein L20 [Pelodictyon phaeoclathratiforme BU-1]
 gi|226730432|sp|B4SB90|RL20_PELPB RecName: Full=50S ribosomal protein L20
 gi|194307811|gb|ACF42511.1| ribosomal protein L20 [Pelodictyon phaeoclathratiforme BU-1]
          Length = 115

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M +    V S A+ K+VLK AKGF+G R N +   K AVD+++QYAYRDRRVKKR FRSL
Sbjct: 1   MPKANNAVASKARRKRVLKKAKGFWGSRGNILTVVKHAVDKAEQYAYRDRRVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+    YS+ IN + K  + +DRK L+++A+    +F  IV+
Sbjct: 61  WIMRINAAARLNGTTYSRMINAMLKKNVEIDRKALAEIAVKDPAAFTVIVK 111


>gi|330995388|ref|ZP_08319298.1| ribosomal protein L20 [Paraprevotella xylaniphila YIT 11841]
 gi|329575883|gb|EGG57407.1| ribosomal protein L20 [Paraprevotella xylaniphila YIT 11841]
          Length = 114

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+L   +G++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKILGLTRGYFGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  ++YSQ +  LHKAGI ++RKVL+DLA+   ++FK +V
Sbjct: 61  WIQRINAAARLEGMSYSQLMGALHKAGIEINRKVLADLAMNHPEAFKAVV 110


>gi|317487456|ref|ZP_07946243.1| ribosomal protein L20 [Bilophila wadsworthia 3_1_6]
 gi|316921315|gb|EFV42614.1| ribosomal protein L20 [Bilophila wadsworthia 3_1_6]
          Length = 117

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 81/115 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ +  +HKK L  AKGF G R    R A+ AV+RS  YA+  R+ +KR+FR LWI
Sbjct: 2   RVKRGLAAHRRHKKYLDMAKGFRGGRSRLYRTAREAVERSLAYAFVGRKQRKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R   L+YS+ + GL +AG+ L+RKVL+DLA+ Q + F K+VEL++++L
Sbjct: 62  LRINAGARENGLSYSKLMFGLAQAGVALNRKVLADLAVRQKEDFAKLVELAKTKL 116


>gi|295135447|ref|YP_003586123.1| 50S ribosomal protein L20 [Zunongwangia profunda SM-A87]
 gi|294983462|gb|ADF53927.1| 50S ribosomal protein L20 [Zunongwangia profunda SM-A87]
          Length = 114

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AV+++  Y+YRDR+ KKR+FRSL
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGYFGRRKNVWTVAKNAVEKAMLYSYRDRKAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R   ++YSQF+  +    I L+RKVL+DLA+   ++FK IV+
Sbjct: 61  WIMRINAAARQQGMSYSQFMGKVKANEIGLNRKVLADLAMNHPEAFKAIVD 111


>gi|289426534|ref|ZP_06428277.1| ribosomal protein L20 [Propionibacterium acnes SK187]
 gi|295130949|ref|YP_003581612.1| ribosomal protein L20 [Propionibacterium acnes SK137]
 gi|289153262|gb|EFD01980.1| ribosomal protein L20 [Propionibacterium acnes SK187]
 gi|291376999|gb|ADE00854.1| ribosomal protein L20 [Propionibacterium acnes SK137]
 gi|313763450|gb|EFS34814.1| ribosomal protein L20 [Propionibacterium acnes HL013PA1]
 gi|313793836|gb|EFS41865.1| ribosomal protein L20 [Propionibacterium acnes HL110PA1]
 gi|313801226|gb|EFS42484.1| ribosomal protein L20 [Propionibacterium acnes HL110PA2]
 gi|313808090|gb|EFS46567.1| ribosomal protein L20 [Propionibacterium acnes HL087PA2]
 gi|313811440|gb|EFS49154.1| ribosomal protein L20 [Propionibacterium acnes HL083PA1]
 gi|313813591|gb|EFS51305.1| ribosomal protein L20 [Propionibacterium acnes HL025PA1]
 gi|313816632|gb|EFS54346.1| ribosomal protein L20 [Propionibacterium acnes HL059PA1]
 gi|313819729|gb|EFS57443.1| ribosomal protein L20 [Propionibacterium acnes HL046PA2]
 gi|313822262|gb|EFS59976.1| ribosomal protein L20 [Propionibacterium acnes HL036PA1]
 gi|313823744|gb|EFS61458.1| ribosomal protein L20 [Propionibacterium acnes HL036PA2]
 gi|313826066|gb|EFS63780.1| ribosomal protein L20 [Propionibacterium acnes HL063PA1]
 gi|313829639|gb|EFS67353.1| ribosomal protein L20 [Propionibacterium acnes HL063PA2]
 gi|313831179|gb|EFS68893.1| ribosomal protein L20 [Propionibacterium acnes HL007PA1]
 gi|313834840|gb|EFS72554.1| ribosomal protein L20 [Propionibacterium acnes HL056PA1]
 gi|313840043|gb|EFS77757.1| ribosomal protein L20 [Propionibacterium acnes HL086PA1]
 gi|314914609|gb|EFS78440.1| ribosomal protein L20 [Propionibacterium acnes HL005PA4]
 gi|314919434|gb|EFS83265.1| ribosomal protein L20 [Propionibacterium acnes HL050PA1]
 gi|314920658|gb|EFS84489.1| ribosomal protein L20 [Propionibacterium acnes HL050PA3]
 gi|314924558|gb|EFS88389.1| ribosomal protein L20 [Propionibacterium acnes HL036PA3]
 gi|314930428|gb|EFS94259.1| ribosomal protein L20 [Propionibacterium acnes HL067PA1]
 gi|314954517|gb|EFS98923.1| ribosomal protein L20 [Propionibacterium acnes HL027PA1]
 gi|314957362|gb|EFT01465.1| ribosomal protein L20 [Propionibacterium acnes HL002PA1]
 gi|314962174|gb|EFT06275.1| ribosomal protein L20 [Propionibacterium acnes HL002PA2]
 gi|314963803|gb|EFT07903.1| ribosomal protein L20 [Propionibacterium acnes HL082PA1]
 gi|314968368|gb|EFT12467.1| ribosomal protein L20 [Propionibacterium acnes HL037PA1]
 gi|314974058|gb|EFT18154.1| ribosomal protein L20 [Propionibacterium acnes HL053PA1]
 gi|314976762|gb|EFT20857.1| ribosomal protein L20 [Propionibacterium acnes HL045PA1]
 gi|314978783|gb|EFT22877.1| ribosomal protein L20 [Propionibacterium acnes HL072PA2]
 gi|314984484|gb|EFT28576.1| ribosomal protein L20 [Propionibacterium acnes HL005PA1]
 gi|314986661|gb|EFT30753.1| ribosomal protein L20 [Propionibacterium acnes HL005PA2]
 gi|314990776|gb|EFT34867.1| ribosomal protein L20 [Propionibacterium acnes HL005PA3]
 gi|315079655|gb|EFT51645.1| ribosomal protein L20 [Propionibacterium acnes HL053PA2]
 gi|315081116|gb|EFT53092.1| ribosomal protein L20 [Propionibacterium acnes HL078PA1]
 gi|315083437|gb|EFT55413.1| ribosomal protein L20 [Propionibacterium acnes HL027PA2]
 gi|315087004|gb|EFT58980.1| ribosomal protein L20 [Propionibacterium acnes HL002PA3]
 gi|315089179|gb|EFT61155.1| ribosomal protein L20 [Propionibacterium acnes HL072PA1]
 gi|315095233|gb|EFT67209.1| ribosomal protein L20 [Propionibacterium acnes HL038PA1]
 gi|315099078|gb|EFT71054.1| ribosomal protein L20 [Propionibacterium acnes HL059PA2]
 gi|315100541|gb|EFT72517.1| ribosomal protein L20 [Propionibacterium acnes HL046PA1]
 gi|315108911|gb|EFT80887.1| ribosomal protein L20 [Propionibacterium acnes HL030PA2]
 gi|327329568|gb|EGE71327.1| ribosomal protein L20 [Propionibacterium acnes HL096PA3]
 gi|327329587|gb|EGE71345.1| ribosomal protein L20 [Propionibacterium acnes HL096PA2]
 gi|327444367|gb|EGE91021.1| ribosomal protein L20 [Propionibacterium acnes HL043PA2]
 gi|327444568|gb|EGE91222.1| ribosomal protein L20 [Propionibacterium acnes HL043PA1]
 gi|327446240|gb|EGE92894.1| ribosomal protein L20 [Propionibacterium acnes HL013PA2]
 gi|327452175|gb|EGE98829.1| ribosomal protein L20 [Propionibacterium acnes HL092PA1]
 gi|327452808|gb|EGE99462.1| ribosomal protein L20 [Propionibacterium acnes HL087PA3]
 gi|327457885|gb|EGF04540.1| ribosomal protein L20 [Propionibacterium acnes HL083PA2]
 gi|328752002|gb|EGF65618.1| ribosomal protein L20 [Propionibacterium acnes HL020PA1]
 gi|328755366|gb|EGF68982.1| ribosomal protein L20 [Propionibacterium acnes HL087PA1]
 gi|328757791|gb|EGF71407.1| ribosomal protein L20 [Propionibacterium acnes HL025PA2]
 gi|328760150|gb|EGF73727.1| ribosomal protein L20 [Propionibacterium acnes HL099PA1]
 gi|332675829|gb|AEE72645.1| 50S ribosomal protein L20 [Propionibacterium acnes 266]
          Length = 123

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 83/123 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL  A G+ G+R    R AK     S  Y++RDRR KK DFRSL
Sbjct: 1   MARVKRSVNAKKKRREVLDQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FINGL  AG+ +DRK+L++LA++ +++F  +VE++++    +
Sbjct: 61  WIQRINAASRAQGMTYNRFINGLKNAGVEVDRKMLAELAVSDINAFNSLVEVAKASQPQN 120

Query: 121 VAS 123
            A+
Sbjct: 121 AAA 123


>gi|53712979|ref|YP_098971.1| 50S ribosomal protein L20 [Bacteroides fragilis YCH46]
 gi|60681191|ref|YP_211335.1| 50S ribosomal protein L20 [Bacteroides fragilis NCTC 9343]
 gi|253563043|ref|ZP_04840500.1| 50S ribosomal protein L20 [Bacteroides sp. 3_2_5]
 gi|265763076|ref|ZP_06091644.1| ribosomal protein L20 [Bacteroides sp. 2_1_16]
 gi|60390336|sp|Q64VN9|RL20_BACFR RecName: Full=50S ribosomal protein L20
 gi|81315740|sp|Q5LEQ3|RL20_BACFN RecName: Full=50S ribosomal protein L20
 gi|52215844|dbj|BAD48437.1| 50S ribosomal protein L20 [Bacteroides fragilis YCH46]
 gi|60492625|emb|CAH07397.1| putative 50S ribosomal protein L20 [Bacteroides fragilis NCTC 9343]
 gi|251946819|gb|EES87101.1| 50S ribosomal protein L20 [Bacteroides sp. 3_2_5]
 gi|263255684|gb|EEZ27030.1| ribosomal protein L20 [Bacteroides sp. 2_1_16]
 gi|301162680|emb|CBW22227.1| putative 50S ribosomal protein L20 [Bacteroides fragilis 638R]
          Length = 116

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 54/106 (50%), Positives = 75/106 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+LK  +G++G RKN    AK   ++   YA+RDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKARRKKILKLTRGYFGARKNVWTVAKNTWEKGLTYAFRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAA R+  ++YS+ + GLHKAGI ++RKVL+DLA+   ++F
Sbjct: 61  WIQRINAAARLEGMSYSKLMGGLHKAGIEINRKVLADLAVNHPEAF 106


>gi|188586436|ref|YP_001917981.1| LSU ribosomal protein L20P [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226730426|sp|B2A5N9|RL20_NATTJ RecName: Full=50S ribosomal protein L20
 gi|179351123|gb|ACB85393.1| LSU ribosomal protein L20P [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 117

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 80/114 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G     +HKKVLK AKG+ G + N  R A   V +S  YAYRDR+ +KR+FR L
Sbjct: 1   MPRVKTGTNRRRRHKKVLKLAKGYRGTKGNLFRIANQQVMKSLTYAYRDRKQRKREFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R   ++Y++FINGL KAG+ ++RK+L+D+A+    +F ++V+L++
Sbjct: 61  WISRINAACRQNGISYNKFINGLKKAGVEINRKMLADMAVNDEQAFGELVDLAK 114


>gi|317124677|ref|YP_004098789.1| 50S ribosomal protein L20P [Intrasporangium calvum DSM 43043]
 gi|315588765|gb|ADU48062.1| LSU ribosomal protein L20P [Intrasporangium calvum DSM 43043]
          Length = 128

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 59/119 (49%), Positives = 77/119 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDRR KK DFR L
Sbjct: 1   MARVKRAVNAQKKRRVVLERASGYRGQRSRLYRKAKEQVTHSLGYAYRDRRAKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAA R   + Y++F+ GL  AG+ +DRK+L+DLA+    +F  +VE+SR  + V
Sbjct: 61  WIQRINAAARANGMTYNRFMQGLKAAGVEVDRKILADLAVNDAPAFAALVEISRVNVPV 119


>gi|218779647|ref|YP_002430965.1| 50S ribosomal protein L20 [Desulfatibacillum alkenivorans AK-01]
 gi|226730387|sp|B8FFU2|RL20_DESAA RecName: Full=50S ribosomal protein L20
 gi|218761031|gb|ACL03497.1| ribosomal protein L20 [Desulfatibacillum alkenivorans AK-01]
          Length = 116

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 75/111 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG  +  + KKVLK AKGF G      R A   VDR+  YAYRDRR KKRDFR+LWI
Sbjct: 2   RVKRGFKARRRRKKVLKLAKGFRGGHSKLYRTAADTVDRALMYAYRDRRQKKRDFRALWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
            RINA  R+  L+YS+FI GL +A + LDRKVL++LAI+    F +I  L+
Sbjct: 62  ARINAGARMNGLSYSKFIYGLKQADVALDRKVLAELAISDPACFAEITSLA 112


>gi|283851376|ref|ZP_06368658.1| ribosomal protein L20 [Desulfovibrio sp. FW1012B]
 gi|283573326|gb|EFC21304.1| ribosomal protein L20 [Desulfovibrio sp. FW1012B]
          Length = 117

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 78/115 (67%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVKRG  +  +HKK LK AKG+ G R      A+   +RS  YAYRDR+ +KR  R LW
Sbjct: 1   MRVKRGQAAHKRHKKYLKMAKGYVGARSKLYETAREVAERSLVYAYRDRKQRKRQMRKLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           I RINAA R   L+YS F+ GL  AG+ LDRKVL+D+A+ + D F+K+VEL++S+
Sbjct: 61  IIRINAAARENGLSYSVFMRGLILAGVELDRKVLADMAVREKDGFQKLVELAKSK 115


>gi|119952986|ref|YP_945195.1| 50S ribosomal protein L20 [Borrelia turicatae 91E135]
 gi|254800302|sp|A1QYY3|RL20_BORT9 RecName: Full=50S ribosomal protein L20
 gi|119861757|gb|AAX17525.1| LSU ribosomal protein L20P [Borrelia turicatae 91E135]
          Length = 115

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 78/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V  A+ KK+LK  KGF+G +K+  + AK  + +   YA RDR+ +KRDFRSL
Sbjct: 1   MARVKNGIVHVARRKKILKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRKTRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RI+AA+    +NYS+F   L K+ I L+RK+LS+LAI  +++FKKIV
Sbjct: 61  WIVRISAALTGMGINYSKFFESLKKSNIKLNRKILSNLAIEDIETFKKIV 110


>gi|332522613|ref|ZP_08398865.1| ribosomal protein L20 [Streptococcus porcinus str. Jelinkova 176]
 gi|332313877|gb|EGJ26862.1| ribosomal protein L20 [Streptococcus porcinus str. Jelinkova 176]
          Length = 119

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+T    F  + + ++++L
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVTDAAGFTALADAAKNKL 117


>gi|327402297|ref|YP_004343135.1| 50S ribosomal protein L20P [Fluviicola taffensis DSM 16823]
 gi|327317805|gb|AEA42297.1| LSU ribosomal protein L20P [Fluviicola taffensis DSM 16823]
          Length = 115

 Score =  114 bits (284), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ K  +K AKG+YGRRKN    AK A+++   YAY  R+ KKR+FRSL
Sbjct: 1   MPRSVNHVASRARRKNFMKLAKGYYGRRKNVWTVAKNAIEKGLNYAYEGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  RV+ ++YSQF+  ++K+ I L+RKVL+DLA+   ++FK +V+
Sbjct: 61  WIMRINAGARVHGMSYSQFMGAVNKSDIELNRKVLADLAMNHPEAFKAVVD 111


>gi|224282679|ref|ZP_03646001.1| 50S ribosomal protein L20 [Bifidobacterium bifidum NCIMB 41171]
 gi|310287138|ref|YP_003938396.1| LSU ribosomal protein L20P [Bifidobacterium bifidum S17]
 gi|311064001|ref|YP_003970726.1| 50S ribosomal protein L20P RplT [Bifidobacterium bifidum PRL2010]
 gi|313139837|ref|ZP_07802030.1| 50S ribosomal protein L20 [Bifidobacterium bifidum NCIMB 41171]
 gi|309251074|gb|ADO52822.1| LSU ribosomal protein L20P [Bifidobacterium bifidum S17]
 gi|310866320|gb|ADP35689.1| RplT LSU ribosomal protein L20P [Bifidobacterium bifidum PRL2010]
 gi|313132347|gb|EFR49964.1| 50S ribosomal protein L20 [Bifidobacterium bifidum NCIMB 41171]
          Length = 127

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 59/121 (48%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LA++  ++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAVSDPETFKAIVEQAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|298373535|ref|ZP_06983524.1| ribosomal protein L20 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298274587|gb|EFI16139.1| ribosomal protein L20 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 117

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 80/115 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G++G R+N    AK   ++  QYAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYFGARRNVWTIAKNTWEKGLQYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAA R+   +YSQ +  LHKAGI ++RKVL+DLA+   ++F  IV+ +++
Sbjct: 61  WIQRINAAARLEGYSYSQLMGALHKAGITINRKVLADLALNNKEAFVAIVKQAKN 115


>gi|27468271|ref|NP_764908.1| 50S ribosomal protein L20 [Staphylococcus epidermidis ATCC 12228]
 gi|57867161|ref|YP_188816.1| 50S ribosomal protein L20 [Staphylococcus epidermidis RP62A]
 gi|242242942|ref|ZP_04797387.1| 50S ribosomal protein L20 [Staphylococcus epidermidis W23144]
 gi|251811072|ref|ZP_04825545.1| 50S ribosomal protein L20 [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875901|ref|ZP_06284768.1| ribosomal protein L20 [Staphylococcus epidermidis SK135]
 gi|293366373|ref|ZP_06613052.1| 50S ribosomal protein L20 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|31563117|sp|Q8CS77|RL20_STAES RecName: Full=50S ribosomal protein L20
 gi|81819376|sp|Q5HNM5|RL20_STAEQ RecName: Full=50S ribosomal protein L20
 gi|27315817|gb|AAO04952.1|AE016748_186 50S ribosomal protein L20 [Staphylococcus epidermidis ATCC 12228]
 gi|57637819|gb|AAW54607.1| ribosomal protein L20 [Staphylococcus epidermidis RP62A]
 gi|242233543|gb|EES35855.1| 50S ribosomal protein L20 [Staphylococcus epidermidis W23144]
 gi|251805407|gb|EES58064.1| 50S ribosomal protein L20 [Staphylococcus epidermidis BCM-HMP0060]
 gi|281294926|gb|EFA87453.1| ribosomal protein L20 [Staphylococcus epidermidis SK135]
 gi|291319498|gb|EFE59865.1| 50S ribosomal protein L20 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|319400994|gb|EFV89213.1| ribosomal protein L20 [Staphylococcus epidermidis FRI909]
 gi|329724652|gb|EGG61158.1| ribosomal protein L20 [Staphylococcus epidermidis VCU144]
 gi|329733767|gb|EGG70093.1| ribosomal protein L20 [Staphylococcus epidermidis VCU045]
 gi|329737341|gb|EGG73595.1| ribosomal protein L20 [Staphylococcus epidermidis VCU028]
          Length = 118

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDISYSRLMNGLKKAEIDINRKMLSEIAISDDKAFAELVSKAKEAL 117


>gi|257462308|ref|ZP_05626723.1| 50S ribosomal protein L20 [Fusobacterium sp. D12]
 gi|317059975|ref|ZP_07924460.1| LSU ribosomal protein L20P [Fusobacterium sp. D12]
 gi|313685651|gb|EFS22486.1| LSU ribosomal protein L20P [Fusobacterium sp. D12]
          Length = 116

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 76/113 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G+V   +HKK+LK+AKGF G   +  + AK A  ++  Y+ RDR+V KR  R LWI
Sbjct: 2   RVKTGIVRRRRHKKILKAAKGFRGASGDAFKQAKQATMKAMAYSTRDRKVNKRRMRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
            RIN+A R+  L YS F+NGL KAGI LDRKVL+DLA+     F K+ E +++
Sbjct: 62  TRINSAARLNGLTYSVFMNGLKKAGIELDRKVLADLALNNAAEFAKLAETAKA 114


>gi|261368267|ref|ZP_05981150.1| ribosomal protein L20 [Subdoligranulum variabile DSM 15176]
 gi|282569782|gb|EFB75317.1| ribosomal protein L20 [Subdoligranulum variabile DSM 15176]
          Length = 117

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K   ++  +  K LK AKG+YG +    R AK AV +S  YA+  R++KKR FR+L
Sbjct: 1   MARIKGATMTHKRRAKTLKLAKGYYGSKSKHFRMAKQAVMKSGNYAFVGRKLKKRQFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RIN AVR   +NYS F+NGL KAGI L+RK+LS++AI    SF  +VE ++  L
Sbjct: 61  WITRINNAVRAQGMNYSTFMNGLKKAGIELNRKMLSEMAIHDAASFNALVETAKKAL 117


>gi|325279136|ref|YP_004251678.1| 50S ribosomal protein L20 [Odoribacter splanchnicus DSM 20712]
 gi|324310945|gb|ADY31498.1| 50S ribosomal protein L20 [Odoribacter splanchnicus DSM 20712]
          Length = 118

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  V + A+ KKVLK  KG +G RKN    AK   ++   YA+RDRR KK +FR+L
Sbjct: 1   MPRAKNAVAARARRKKVLKQTKGNFGARKNVWTVAKNTYEKGLTYAFRDRRKKKSEFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR+  L+YS+F+  +HKA + ++RKVL+DLA+   ++FK +V
Sbjct: 61  WIQRINAAVRLEGLSYSKFMGLIHKADVDMNRKVLADLAMNHPEAFKAVV 110


>gi|237739652|ref|ZP_04570133.1| LSU ribosomal protein L20P [Fusobacterium sp. 2_1_31]
 gi|262066668|ref|ZP_06026280.1| ribosomal protein L20 [Fusobacterium periodonticum ATCC 33693]
 gi|229423260|gb|EEO38307.1| LSU ribosomal protein L20P [Fusobacterium sp. 2_1_31]
 gi|291379627|gb|EFE87145.1| ribosomal protein L20 [Fusobacterium periodonticum ATCC 33693]
          Length = 116

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 78/115 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G++   +HK+VLK+AKGF G   +  + AK A  ++  Y+ RDR+V KR  R LWI
Sbjct: 2   RVKTGIIRRKRHKRVLKAAKGFRGASGDAFKQAKQATRKAMAYSTRDRKVNKRKMRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RIN+A R+  ++YS  INGL KAGI LDRKVL+D+A+     F K+VE ++S L
Sbjct: 62  TRINSAARMNGVSYSVLINGLKKAGIELDRKVLADIALNNAAEFTKLVETAKSAL 116


>gi|94986658|ref|YP_594591.1| 50S ribosomal protein L20 [Lawsonia intracellularis PHE/MN1-00]
 gi|166219656|sp|Q1MRV6|RL20_LAWIP RecName: Full=50S ribosomal protein L20
 gi|94730907|emb|CAJ54270.1| ribosomal protein L20 [Lawsonia intracellularis PHE/MN1-00]
          Length = 117

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 83/116 (71%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVKRG  +  +HKK L+ AKGF G R    R A+ AV+RS  YAY  R+ +KR+FR LW
Sbjct: 1   MRVKRGFSAHRRHKKYLEMAKGFRGGRSRLYRTAREAVERSLVYAYIGRKQRKREFRKLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RINA  R + L+YS+ + GL +AGI+L+RK+L++LA+ Q + F K+VE++++++
Sbjct: 61  ILRINAGAREHGLSYSKMMAGLSQAGIMLNRKILAELAVKQKEDFAKLVEIAKNQV 116


>gi|297182030|gb|ADI18205.1| ribosomal protein l20 [uncultured delta proteobacterium
           HF0200_39N20]
          Length = 118

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 82/115 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R K  V S  + K + K+AKG+ G R   +R  K AVDR+++Y+YRDR+V+KRDFR LWI
Sbjct: 2   RAKLAVHSRKRKKSLFKAAKGYRGGRSRLLRTVKDAVDRAREYSYRDRKVRKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAAVR + +NYSQFI+GL  A I +DRK L+ LA+ + + F ++ + ++++L
Sbjct: 62  VRINAAVREHGMNYSQFIHGLKAAKIEMDRKTLAYLAMEEPELFAQVAQTAKTKL 116


>gi|223044107|ref|ZP_03614146.1| ribosomal protein L20 [Staphylococcus capitis SK14]
 gi|314933833|ref|ZP_07841198.1| ribosomal protein L20 [Staphylococcus caprae C87]
 gi|222442501|gb|EEE48607.1| ribosomal protein L20 [Staphylococcus capitis SK14]
 gi|313653983|gb|EFS17740.1| ribosomal protein L20 [Staphylococcus caprae C87]
          Length = 118

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDISYSRLMNGLKKAEIDINRKMLSEIAISDDKAFGELVTKAKEAL 117


>gi|289427781|ref|ZP_06429492.1| ribosomal protein L20 [Propionibacterium acnes J165]
 gi|289159045|gb|EFD07238.1| ribosomal protein L20 [Propionibacterium acnes J165]
          Length = 123

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 83/123 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL  A G+ G+R    R AK     S  Y++RDRR KK DFRSL
Sbjct: 1   MARVKRSVNAKKKRREVLDQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++F+NGL  AG+ +DRK+L++LA++ +++F  +VE++++    +
Sbjct: 61  WIQRINAASRAQGMTYNRFVNGLKNAGVEVDRKMLAELAVSDINAFNSLVEVAKASQPQN 120

Query: 121 VAS 123
            A+
Sbjct: 121 AAA 123


>gi|309811064|ref|ZP_07704862.1| ribosomal protein L20 [Dermacoccus sp. Ellin185]
 gi|308435028|gb|EFP58862.1| ribosomal protein L20 [Dermacoccus sp. Ellin185]
          Length = 124

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDRR KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRTVLEQASGYRGQRSRLYRKAKEQVTHSLGYAYRDRRAKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++FI GL  AGI +DR++L++LA+    +F K+VE++++ +   
Sbjct: 61  WIQRINAAARLNGMTYNRFIQGLKVAGIEVDRRMLAELAVNDAPAFAKLVEIAKANVPAQ 120

Query: 121 VAS 123
             +
Sbjct: 121 TPA 123


>gi|255526050|ref|ZP_05392973.1| ribosomal protein L20 [Clostridium carboxidivorans P7]
 gi|296187097|ref|ZP_06855495.1| ribosomal protein L20 [Clostridium carboxidivorans P7]
 gi|255510236|gb|EET86553.1| ribosomal protein L20 [Clostridium carboxidivorans P7]
 gi|296048291|gb|EFG87727.1| ribosomal protein L20 [Clostridium carboxidivorans P7]
          Length = 119

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   HKK+LK AKG+YG +    + A   V R+ + AY  R++KKRDFR L
Sbjct: 1   MARVKRAVNARKYHKKILKLAKGYYGGKSKLFKTANETVIRALRNAYVGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NG+  AGI ++RK+LS++AI    SF ++VE+++ ++
Sbjct: 61  WIARINAATRISGLSYSRFMNGMKLAGININRKMLSEIAINDPKSFAELVEIAKKQI 117


>gi|228475205|ref|ZP_04059931.1| ribosomal protein L20 [Staphylococcus hominis SK119]
 gi|314936217|ref|ZP_07843564.1| ribosomal protein L20 [Staphylococcus hominis subsp. hominis C80]
 gi|228270816|gb|EEK12218.1| ribosomal protein L20 [Staphylococcus hominis SK119]
 gi|313654836|gb|EFS18581.1| ribosomal protein L20 [Staphylococcus hominis subsp. hominis C80]
          Length = 118

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDISYSRLMNGLKKADININRKMLSEIAISDDKAFGELVSKAKDAL 117


>gi|282877702|ref|ZP_06286517.1| ribosomal protein L20 [Prevotella buccalis ATCC 35310]
 gi|281300274|gb|EFA92628.1| ribosomal protein L20 [Prevotella buccalis ATCC 35310]
          Length = 114

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+  ++LK  KG++G RKN    AK   ++   YAYRDRR KKR FRSL
Sbjct: 1   MPRSVNHVASKARRTRILKQTKGYFGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+  ++YS  +  L+KAGI ++RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAAARLEGMSYSTLMGALNKAGIEINRKVLADLAVNNPEAFKAIVD 111


>gi|288818985|ref|YP_003433333.1| ribosomal protein L20 [Hydrogenobacter thermophilus TK-6]
 gi|288788385|dbj|BAI70132.1| ribosomal protein L20 [Hydrogenobacter thermophilus TK-6]
 gi|308752570|gb|ADO46053.1| ribosomal protein L20 [Hydrogenobacter thermophilus TK-6]
          Length = 118

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/112 (50%), Positives = 79/112 (70%)

Query: 6   RGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRI 65
           +G  S    KK+LK AKGF G+RKN  R AK  V R+ QY YRDRR +KR+FR LWI RI
Sbjct: 4   KGPSSRKFKKKILKLAKGFRGQRKNVYRRAKEYVFRALQYQYRDRRQRKREFRKLWIARI 63

Query: 66  NAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           NAAVR Y ++YS+F+ G+ KAGI L+RKV++D+A+   + F +++  ++  L
Sbjct: 64  NAAVRPYGMSYSKFMAGIKKAGIDLNRKVMADMAVRDPEGFAQLISRAKEAL 115


>gi|229543586|ref|ZP_04432646.1| ribosomal protein L20 [Bacillus coagulans 36D1]
 gi|229328006|gb|EEN93681.1| ribosomal protein L20 [Bacillus coagulans 36D1]
          Length = 117

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYYGSKHTLFKVANQQVMKSYMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL +AGI ++RK+L+DLA+    +F ++   +++ L
Sbjct: 61  WITRINAAARINGLSYSRLMHGLKQAGIEVNRKMLADLAVNDAQAFAELANKAKAAL 117


>gi|289643247|ref|ZP_06475373.1| ribosomal protein L20 [Frankia symbiont of Datisca glomerata]
 gi|289506952|gb|EFD27925.1| ribosomal protein L20 [Frankia symbiont of Datisca glomerata]
          Length = 189

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y+YRDRR +K DFR L
Sbjct: 63  MARVKRAVNAQKKRRTVLEQASGYRGQRSRLYRKAKEQVLHSMTYSYRDRRARKGDFRQL 122

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L Y++F+ GL  AG+ +DRK+LSDLA+T   +F  +VE++R+ L
Sbjct: 123 WITRINAAARQNGLTYNRFVQGLRLAGVEVDRKILSDLAVTDPAAFTALVEVARAAL 179


>gi|21674938|ref|NP_663003.1| 50S ribosomal protein L20 [Chlorobium tepidum TLS]
 gi|25009072|sp|Q8KAM7|RL20_CHLTE RecName: Full=50S ribosomal protein L20
 gi|21648167|gb|AAM73345.1| ribosomal protein L20 [Chlorobium tepidum TLS]
          Length = 115

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 79/113 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M +    V S A+ K++LK AKG++G R N +   K AVD+++QYAYRDRRVKKR+FRSL
Sbjct: 1   MPKSTNSVASKARRKRILKKAKGYWGSRGNVLTVVKHAVDKAEQYAYRDRRVKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAA R   ++YS+ ++ +HK  I +DRK L+++A+    +F  IV+ +
Sbjct: 61  WIMRINAAARQNGVSYSRLMDAIHKKNIEIDRKALAEIAVKDPAAFSLIVKTA 113


>gi|254446938|ref|ZP_05060405.1| ribosomal protein L20 [gamma proteobacterium HTCC5015]
 gi|198263077|gb|EDY87355.1| ribosomal protein L20 [gamma proteobacterium HTCC5015]
          Length = 119

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QY+YRDRR +KR FR L
Sbjct: 1   MARVKRGVTARARHKKVLAKAKGYYGARSRVYRVAKQAVIKAGQYSYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YSQF+NGL KA I LDRKVL+DLA+    +F ++VE ++S L
Sbjct: 61  WIVRINAGARSNGLSYSQFMNGLKKAEIALDRKVLADLAVNDKATFTQLVEKAKSSL 117


>gi|313890634|ref|ZP_07824262.1| ribosomal protein L20 [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121151|gb|EFR44262.1| ribosomal protein L20 [Streptococcus pseudoporcinus SPIN 20026]
          Length = 119

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+T    F  + + ++ +L
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVTDAAGFTALADAAKDKL 117


>gi|302760143|ref|XP_002963494.1| hypothetical protein SELMODRAFT_227421 [Selaginella moellendorffii]
 gi|302813038|ref|XP_002988205.1| hypothetical protein SELMODRAFT_271988 [Selaginella moellendorffii]
 gi|300143937|gb|EFJ10624.1| hypothetical protein SELMODRAFT_271988 [Selaginella moellendorffii]
 gi|300168762|gb|EFJ35365.1| hypothetical protein SELMODRAFT_227421 [Selaginella moellendorffii]
          Length = 119

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 54/97 (55%), Positives = 73/97 (75%)

Query: 17  VLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNY 76
           +LK A+GF GR KN IR A+  V+++ QYAYRDRR KKRD RSLWI RINA  R+Y L Y
Sbjct: 6   ILKLARGFRGRAKNCIRIARERVEKALQYAYRDRRSKKRDMRSLWIMRINAGARIYGLRY 65

Query: 77  SQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           S F++GL++  I L+RKVLS++A+ +  SFK + ++S
Sbjct: 66  SNFMHGLNRENIQLNRKVLSEIAMNEPYSFKCLADIS 102


>gi|269956118|ref|YP_003325907.1| 50S ribosomal protein L20 [Xylanimonas cellulosilytica DSM 15894]
 gi|269304799|gb|ACZ30349.1| ribosomal protein L20 [Xylanimonas cellulosilytica DSM 15894]
          Length = 128

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  YAYRDR+VKK DFR L
Sbjct: 1   MARVKRAVNAQKKRRTTLERASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKVKKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++F+ GL  AG+ +DR++L++LA+  + +F  +VE++++ L  D
Sbjct: 61  WIQRINAAARAQGLTYNRFVQGLGLAGVEVDRRMLAELAVNDIAAFNALVEVAKAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|15895626|ref|NP_348975.1| 50S ribosomal protein L20 [Clostridium acetobutylicum ATCC 824]
 gi|20978632|sp|Q97GK7|RL20_CLOAB RecName: Full=50S ribosomal protein L20
 gi|15025370|gb|AAK80315.1|AE007736_5 Ribosomal protein L20 [Clostridium acetobutylicum ATCC 824]
 gi|325509774|gb|ADZ21410.1| 50S ribosomal protein L20 [Clostridium acetobutylicum EA 2018]
          Length = 119

 Score =  113 bits (283), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   H+KVLK AKG+YG +    + A  +V R+ + AY  RR++KRDFR L
Sbjct: 1   MARVKRAVNARKNHRKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRRLRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FING+  AGI ++RK+LS++AI    +F ++VE+++ ++
Sbjct: 61  WIARINAATRINGLSYSKFINGIKLAGIDMNRKMLSEIAINDPKAFSELVEVAKKQI 117


>gi|296271844|ref|YP_003654475.1| 50S ribosomal protein L20 [Arcobacter nitrofigilis DSM 7299]
 gi|296096019|gb|ADG91969.1| ribosomal protein L20 [Arcobacter nitrofigilis DSM 7299]
          Length = 119

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 70/95 (73%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVK G+V   +HKKVLK+A+GF+  R    R AK  ++RS  YAYRDRR KKRD R L
Sbjct: 1  MPRVKTGIVRRRRHKKVLKAARGFFAGRSKHFRKAKEQLERSLVYAYRDRRQKKRDIRKL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVL 95
          WI RINAA R+ D+NYS+F+NG+  AGI LDRK+L
Sbjct: 61 WIIRINAACRLNDINYSRFMNGVKLAGIELDRKIL 95


>gi|325479666|gb|EGC82758.1| ribosomal protein L20 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 114

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 77/114 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HKKVLK AKG+YG +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKKVLKQAKGYYGSKSLLFRTANQAVMKSLNYAYIGRKHRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R+    YS+ + GL KA I ++RK+L++LA+   + F K+VEL++
Sbjct: 61  WIARINAAARLNGTTYSKLMGGLKKANIDINRKMLAELAVNNPEEFAKLVELAK 114


>gi|257126072|ref|YP_003164186.1| 50S ribosomal protein L20 [Leptotrichia buccalis C-1013-b]
 gi|257050011|gb|ACV39195.1| ribosomal protein L20 [Leptotrichia buccalis C-1013-b]
          Length = 114

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKKVLK AKG+ G  K   + A  AV ++  YA   R++KKR  R L
Sbjct: 1   MPRVKTGIVRRKRHKKVLKEAKGYRGAIKTNYKKANEAVKKAMAYATEHRKLKKRKMREL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+  ++YS+ +NGL KAGI LDRKVL+DLA+     F K+VE
Sbjct: 61  WIIRINAAARLNGISYSRLMNGLKKAGIELDRKVLADLALNNPAEFAKLVE 111


>gi|261337540|ref|ZP_05965424.1| ribosomal protein L20 [Bifidobacterium gallicum DSM 20093]
 gi|270277946|gb|EFA23800.1| ribosomal protein L20 [Bifidobacterium gallicum DSM 20093]
          Length = 127

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ AKG+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRSVNAKKKRRVVLERAKGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L++LA++  D+FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAELAVSDADTFKAIVEQAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|294673349|ref|YP_003573965.1| 50S ribosomal protein L20 [Prevotella ruminicola 23]
 gi|294473009|gb|ADE82398.1| ribosomal protein L20 [Prevotella ruminicola 23]
          Length = 114

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G++G RKN    AK   ++   YAYRDRR KKR+FRSL
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYFGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R   ++YS  +  L KAGI ++RKVL+DLA+   ++FK IVE
Sbjct: 61  WIQRINAAARQEGMSYSVLMGNLAKAGIEINRKVLADLAMNNPEAFKAIVE 111


>gi|227547606|ref|ZP_03977655.1| ribosomal protein L20 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|322689457|ref|YP_004209191.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           157F]
 gi|227211861|gb|EEI79757.1| ribosomal protein L20 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|320460793|dbj|BAJ71413.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           157F]
          Length = 127

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L+++A++  D+FK IV+ +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAEIAVSDPDTFKTIVDAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|32265944|ref|NP_859976.1| 50S ribosomal protein L20 [Helicobacter hepaticus ATCC 51449]
 gi|39931803|sp|Q7VJ06|RL20_HELHP RecName: Full=50S ribosomal protein L20
 gi|32261993|gb|AAP77042.1| ribosomal protein L20 [Helicobacter hepaticus ATCC 51449]
          Length = 117

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 81/115 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK GVV   +HKK+LK A+GFY  R+   R AK  ++RS  YA+RDR+ KKRDFR LWI
Sbjct: 2   RVKTGVVRRRRHKKILKLARGFYSGRRKHFRKAKEQLERSMCYAFRDRKQKKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA ++  ++YS+FI+ L  A I LDRK L+D+A+  +++F  ++   +++L
Sbjct: 62  TRINAACKMNGVSYSRFIHALKLANIELDRKTLADMAMNDINAFNAVLASVKNKL 116


>gi|239637524|ref|ZP_04678496.1| ribosomal protein L20 [Staphylococcus warneri L37603]
 gi|239596742|gb|EEQ79267.1| ribosomal protein L20 [Staphylococcus warneri L37603]
          Length = 118

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARKHDISYSRLMNGLKKADIDINRKMLSEIAISDDKAFGELVSKAKDAL 117


>gi|301059169|ref|ZP_07200109.1| ribosomal protein L20 [delta proteobacterium NaphS2]
 gi|300446717|gb|EFK10542.1| ribosomal protein L20 [delta proteobacterium NaphS2]
          Length = 114

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 77/113 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  + KK+LK+A+GF G      R A+ AV R+  Y YRDRRV+KR+FR L
Sbjct: 1   MPRVKRGFKARRRRKKILKAARGFRGGHSKQYRTAETAVIRAGMYEYRDRRVRKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAA + + L+YS+ +  L+KAG+ LDRKVL+D+A+     F ++  ++
Sbjct: 61  WIVRINAAAKAHGLSYSRLMGALNKAGVALDRKVLADMAVNDPAGFARLAAMA 113


>gi|149179189|ref|ZP_01857756.1| 50S ribosomal protein L20 [Planctomyces maris DSM 8797]
 gi|148841962|gb|EDL56358.1| 50S ribosomal protein L20 [Planctomyces maris DSM 8797]
          Length = 118

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (66%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RV++G       K++ K A+G  G R   +R  K  + RS+ YAYRDRRV+KR+FR+LW+
Sbjct: 2   RVRKGAARRRAKKRLFKEARGNVGGRSKLLRTVKETLIRSRVYAYRDRRVRKREFRALWV 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RI AA R    NYSQFINGL KAGI L+RK LS+LAI Q   F +IV+ S++ L
Sbjct: 62  TRITAACRARGTNYSQFINGLTKAGITLNRKSLSELAIYQPQIFDEIVKASQAAL 116


>gi|110598679|ref|ZP_01386944.1| ribosomal protein L20 [Chlorobium ferrooxidans DSM 13031]
 gi|110339732|gb|EAT58242.1| ribosomal protein L20 [Chlorobium ferrooxidans DSM 13031]
          Length = 115

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M +    V S A+ K+VLK AKGF+G R N +   K AVD+++QYAYRDRR KKR+FR+L
Sbjct: 1   MPKANNAVASRARRKRVLKKAKGFWGSRGNILTVVKHAVDKAEQYAYRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+    YS+ +N + K  + +DRK L+++A+    +F +IV+
Sbjct: 61  WIMRINAAARLNGTTYSRLVNAMLKKNVEIDRKALAEIAVKDPAAFTQIVK 111


>gi|52081387|ref|YP_080178.1| 50S ribosomal protein L20 [Bacillus licheniformis ATCC 14580]
 gi|52786763|ref|YP_092592.1| 50S ribosomal protein L20 [Bacillus licheniformis ATCC 14580]
 gi|319647295|ref|ZP_08001517.1| 50S ribosomal protein L20 [Bacillus sp. BT1B_CT2]
 gi|81825224|sp|Q65GB5|RL20_BACLD RecName: Full=50S ribosomal protein L20
 gi|52004598|gb|AAU24540.1| ribosomal protein L20 [Bacillus licheniformis ATCC 14580]
 gi|52349265|gb|AAU41899.1| RplT [Bacillus licheniformis ATCC 14580]
 gi|317390642|gb|EFV71447.1| 50S ribosomal protein L20 [Bacillus sp. BT1B_CT2]
          Length = 119

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L++F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLNAFNQLADAAKAQL 117


>gi|147678288|ref|YP_001212503.1| 50S ribosomal protein L20 [Pelotomaculum thermopropionicum SI]
 gi|189041873|sp|A5D0U4|RL20_PELTS RecName: Full=50S ribosomal protein L20
 gi|146274385|dbj|BAF60134.1| ribosomal protein L20 [Pelotomaculum thermopropionicum SI]
          Length = 117

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  VVS  +HKK+LK AKG+ G +    R A   V +S  YAYRDR+ +KRDFR L
Sbjct: 1   MPRAKSSVVSRKRHKKILKLAKGYRGAKSKLYRIANQQVMKSLVYAYRDRKARKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+ +NGL  AG+ ++RK+L+D+A+    +F ++VE+++++L
Sbjct: 61  WITRINAAARMNGISYSRLMNGLKLAGVDINRKMLADMAVNDAQAFGRLVEIAKAKL 117


>gi|332830450|gb|EGK03078.1| 50S ribosomal protein L20 [Dysgonomonas gadei ATCC BAA-286]
 gi|332885361|gb|EGK05610.1| 50S ribosomal protein L20 [Dysgonomonas mossii DSM 22836]
          Length = 114

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KKVLK  +G+YG RKN    AK   ++   YA+RDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASRNRRKKVLKLTRGYYGARKNVWTVAKNTWEKGLTYAFRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+  ++YS+ +  LHK G+ ++RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAAARLEGMSYSRLMGALHKNGVEINRKVLADLAMNHPEAFKAIVD 111


>gi|294783291|ref|ZP_06748615.1| ribosomal protein L20 [Fusobacterium sp. 1_1_41FAA]
 gi|294480169|gb|EFG27946.1| ribosomal protein L20 [Fusobacterium sp. 1_1_41FAA]
          Length = 116

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 78/115 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G++   +HK+VLK+AKGF G   +  + AK A  ++  Y+ RDR+V KR  R LWI
Sbjct: 2   RVKTGIIRRKRHKRVLKAAKGFRGASGDAFKQAKQATRKAMAYSTRDRKVNKRRMRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RIN+A R+  ++YS  INGL KAGI LDRKVL+D+A+     F K+VE ++S L
Sbjct: 62  TRINSAARMNGVSYSVLINGLKKAGIELDRKVLADIALNNAAEFTKLVETAKSAL 116


>gi|251772031|gb|EES52603.1| ribosomal protein L20 [Leptospirillum ferrodiazotrophum]
          Length = 117

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  + A+ KK+L  AKG++G R    R+A+  V++   YAYRDR+  KR FR L
Sbjct: 1   MPRVKGGPQTRARRKKILDLAKGYWGGRSRLYRSARHTVEKGLTYAYRDRKANKRQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R   ++YS+ I+GL K GI LDRK+L+DLA+ Q   F  ++E
Sbjct: 61  WIQRINAACRPQGISYSRLISGLKKLGIGLDRKILADLALNQPAVFSDLLE 111


>gi|295397491|ref|ZP_06807574.1| 50S ribosomal protein L20 [Aerococcus viridans ATCC 11563]
 gi|294974291|gb|EFG50035.1| 50S ribosomal protein L20 [Aerococcus viridans ATCC 11563]
          Length = 119

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK LK +KG++G +    + AK AV +S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRRRRKKYLKLSKGYFGAKSKLYKTAKQAVMKSYTYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  INGL  A I ++RK+L++LA+   D+F  I E +++ L
Sbjct: 61  WITRINAAARMNGMSYSTLINGLKVANIDMNRKMLAELAVNDADAFAAICEQAKAAL 117


>gi|310658435|ref|YP_003936156.1| 50S ribosomal protein L20 [Clostridium sticklandii DSM 519]
 gi|308825213|emb|CBH21251.1| 50S ribosomal subunit protein L20 [Clostridium sticklandii]
          Length = 119

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+ + +  KHKK+LK AKGF G R    R A A V ++ ++AY  R++KKRDFR +
Sbjct: 1   MARVKKALNARKKHKKILKLAKGFRGGRSKLFRPANAFVMKALKHAYSGRKLKKRDFRQM 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R++ L+YS+F+NGL  +GI L+RK+LS++AI     F+ +V  ++  L
Sbjct: 61  WIARINAGTRMHGLSYSRFMNGLKISGINLNRKMLSEMAINDPQGFENLVNTAKKAL 117


>gi|227833182|ref|YP_002834889.1| 50S ribosomal protein L20 [Corynebacterium aurimucosum ATCC 700975]
 gi|255324639|ref|ZP_05365756.1| ribosomal protein L20 [Corynebacterium tuberculostearicum SK141]
 gi|262184168|ref|ZP_06043589.1| 50S ribosomal protein L20 [Corynebacterium aurimucosum ATCC 700975]
 gi|311740494|ref|ZP_07714321.1| 50S ribosomal protein L20 [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|254800314|sp|C3PGJ7|RL20_CORA7 RecName: Full=50S ribosomal protein L20
 gi|227454198|gb|ACP32951.1| 50S ribosomal protein L20 [Corynebacterium aurimucosum ATCC 700975]
 gi|255298545|gb|EET77845.1| ribosomal protein L20 [Corynebacterium tuberculostearicum SK141]
 gi|311304014|gb|EFQ80090.1| 50S ribosomal protein L20 [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 127

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A I +DRK+L++LA+   ++F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLRLAEIEVDRKILAELAVNDFEAFSALCEAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|311747148|ref|ZP_07720933.1| ribosomal protein L20 [Algoriphagus sp. PR1]
 gi|126578857|gb|EAZ83021.1| ribosomal protein L20 [Algoriphagus sp. PR1]
          Length = 114

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK+ +G++GR  N    AK   ++  QYAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNAVASRARRKKVLKATRGYFGRGSNVWTVAKNKYEKGLQYAYRDRKQKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R + ++YSQ +  L K G+ L+RKVL+DLA+    +FK +VE
Sbjct: 61  WIQRINAGAREHGVSYSQLMGLLKKGGVELNRKVLADLAMNHPSAFKAVVE 111


>gi|304394036|ref|ZP_07375959.1| ribosomal protein L20 [Ahrensia sp. R2A130]
 gi|303293476|gb|EFL87853.1| ribosomal protein L20 [Ahrensia sp. R2A130]
          Length = 134

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 80/104 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK AKG+YG R+  I+ A+ AV+++ QY YRDR+ +KRDFR L
Sbjct: 1   MARVKRGVTSHAKHKKVLKKAKGYYGARRTQIKVARQAVEKAAQYQYRDRKARKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLD 104
           W QR+NAA R + L YS+ I+G+ KAGI +DRK LSD+AI Q +
Sbjct: 61  WTQRLNAAAREHGLTYSRLIDGMTKAGIEVDRKNLSDMAINQPE 104


>gi|193211790|ref|YP_001997743.1| 50S ribosomal protein L20 [Chlorobaculum parvum NCIB 8327]
 gi|226730372|sp|B3QRM1|RL20_CHLP8 RecName: Full=50S ribosomal protein L20
 gi|193085267|gb|ACF10543.1| ribosomal protein L20 [Chlorobaculum parvum NCIB 8327]
          Length = 115

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M +    V S A+ K++L  AKG++G R N +   K AVD+++QYAYRDRRVKKR FRSL
Sbjct: 1   MPKSTNSVASKARRKRILNKAKGYWGSRGNVLTVVKHAVDKAEQYAYRDRRVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R   ++YS+ ++ +HK  I +DRK L+++A+   ++F  IV+
Sbjct: 61  WIMRINAAARQNGVSYSRLMDAIHKKNIEIDRKALAEIAVKDPEAFAMIVK 111


>gi|300933425|ref|ZP_07148681.1| 50S ribosomal protein L20 [Corynebacterium resistens DSM 45100]
          Length = 127

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL SAKG+ G+R    R AK  +  S+ Y +RDRR +K DFR L
Sbjct: 1   MARVKRSVNAKKKRREVLNSAKGYRGQRSRLYRKAKEQMLHSKTYEFRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I GL  A I +DRK+L++LA+   D+F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIQGLRLAEIEVDRKMLAELAVNDFDAFSALCEAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|317153727|ref|YP_004121775.1| 50S ribosomal protein L20 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943978|gb|ADU63029.1| ribosomal protein L20 [Desulfovibrio aespoeensis Aspo-2]
          Length = 117

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 79/113 (69%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVKRGVV+  +HKK LK AKG+ G      R A+  V+++  +A+RDR+ KKR+FR LW
Sbjct: 1   MRVKRGVVAKKRHKKYLKMAKGYRGAGSRLYRTARERVEKALCHAFRDRKAKKREFRKLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           I RINAA R+  ++YS+ ++GL KAGI L+RKVL+D+A+     F KI E ++
Sbjct: 61  IMRINAAARINGMSYSRLMDGLKKAGIELNRKVLADMAVRDPQVFAKIAEAAK 113


>gi|189345702|ref|YP_001942231.1| 50S ribosomal protein L20 [Chlorobium limicola DSM 245]
 gi|226730371|sp|B3EEB8|RL20_CHLL2 RecName: Full=50S ribosomal protein L20
 gi|189339849|gb|ACD89252.1| ribosomal protein L20 [Chlorobium limicola DSM 245]
          Length = 115

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M +    V S A+ K++LK AKGF+G R N +   K AVD+++QYAYRDRR KKR FRSL
Sbjct: 1   MPKANNAVASRARRKRILKKAKGFWGSRGNILTVVKHAVDKAEQYAYRDRRAKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+    YS+ ++ + K  + +DRKVL+++A+    +F +IV+
Sbjct: 61  WIMRINAAARLNGTTYSRLVDAMSKKSVEIDRKVLAEIAVKDPAAFTQIVK 111


>gi|326693740|ref|ZP_08230745.1| 50S ribosomal protein L20 [Leuconostoc argentinum KCTC 3773]
          Length = 139

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 84/118 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ KK++K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVTRARRKKMVKLAKGYRGQRRINFKVAKQQVWKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG+ L+RK+L+D+A+T  D+F K+ E +++ L  D
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGVELNRKMLADIAVTDFDTFAKLAEQAKAALASD 119


>gi|262369837|ref|ZP_06063164.1| 50S ribosomal protein L20 [Acinetobacter johnsonii SH046]
 gi|262314876|gb|EEY95916.1| 50S ribosomal protein L20 [Acinetobacter johnsonii SH046]
          Length = 119

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVQAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+ I GL KA +++DR+VL+D+A+    +F  +   ++  L
Sbjct: 61  WIARINAGARLNGLSYSRMIAGLKKAQVIIDRRVLADIAMHDAVAFAALASKAKDAL 117


>gi|238809866|dbj|BAH69656.1| hypothetical protein [Mycoplasma fermentans PG18]
          Length = 118

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 82/114 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           + RVK G V+ A+ KK LK AKG++G +    + AK AV +S  YA+RDR+  KR+FR L
Sbjct: 2   IMRVKGGTVTRARRKKWLKLAKGYFGHKSIGYKVAKQAVVKSWTYAFRDRKQIKREFRKL 61

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R   L+YS+FINGL +A + ++RK+LS+LAI++  +F  +++++R
Sbjct: 62  WIARINAATRAEGLSYSKFINGLKRANVTINRKMLSELAISEPKTFAMLIKIAR 115


>gi|238021047|ref|ZP_04601473.1| hypothetical protein GCWU000324_00944 [Kingella oralis ATCC 51147]
 gi|237868027|gb|EEP69033.1| hypothetical protein GCWU000324_00944 [Kingella oralis ATCC 51147]
          Length = 118

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHKKVIALAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+F+NGL +A I LDRKVL+DLA+    +F ++VE +++ L
Sbjct: 61  WIARINAGARLNGLSYSKFMNGLKRAAIELDRKVLADLAVFDKAAFAQLVEKAKAAL 117


>gi|203284109|ref|YP_002221849.1| 50S ribosomal protein L20 [Borrelia duttonii Ly]
 gi|203287647|ref|YP_002222662.1| 50S ribosomal protein L20 [Borrelia recurrentis A1]
 gi|226730359|sp|B5RL14|RL20_BORDL RecName: Full=50S ribosomal protein L20
 gi|226730362|sp|B5RR07|RL20_BORRA RecName: Full=50S ribosomal protein L20
 gi|201083552|gb|ACH93143.1| 50S ribosomal protein L20 [Borrelia duttonii Ly]
 gi|201084867|gb|ACH94441.1| 50S ribosomal protein L20 [Borrelia recurrentis A1]
          Length = 115

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V  A+ K++LK  KGF+G +K+  + AK  + +   YA RDR+ +KRD RSL
Sbjct: 1   MARVKNGIVHVARRKRILKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRKTRKRDLRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RI+AA+    +NYS+F  GL K  I L+RK+LS+LAI  ++SFKKIV
Sbjct: 61  WIVRISAALTGMGINYSRFFEGLRKLNIKLNRKILSNLAIEDIESFKKIV 110


>gi|297569213|ref|YP_003690557.1| ribosomal protein L20 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925128|gb|ADH85938.1| ribosomal protein L20 [Desulfurivibrio alkaliphilus AHT2]
          Length = 116

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 74/115 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R  RG  +  + KKVLK A G+ G R    R+A  AVDR+  YAYRDRR KKRDFRSL
Sbjct: 1   MPRAARGFKARRRRKKVLKQASGYVGGRHRLYRSATEAVDRALNYAYRDRRQKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RI AA   +   YS+ + GL KAG+ LDRKVL++LAI     F  +V+ S+S
Sbjct: 61  WIVRIGAAAHEHGTTYSRLMGGLKKAGVDLDRKVLANLAIMDPAGFAAVVQTSQS 115


>gi|194333010|ref|YP_002014870.1| 50S ribosomal protein L20 [Prosthecochloris aestuarii DSM 271]
 gi|226730435|sp|B4S3C9|RL20_PROA2 RecName: Full=50S ribosomal protein L20
 gi|194310828|gb|ACF45223.1| ribosomal protein L20 [Prosthecochloris aestuarii DSM 271]
          Length = 115

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 78/113 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  V S A+ K++L  AKG++G R   +  AK AVD+++QYAYRDRRVKKR FR+L
Sbjct: 1   MPRSKNAVASRARKKRILNKAKGYWGSRGTILTVAKHAVDKAEQYAYRDRRVKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAA R+   +YS+ +  +HK  I ++RK L+++A+    +F +IV+ +
Sbjct: 61  WIMRINAAARLNGTSYSRLMEAMHKKNIDINRKALAEIAVKDPSAFSQIVKTA 113


>gi|302335528|ref|YP_003800735.1| LSU ribosomal protein L20P [Olsenella uli DSM 7084]
 gi|301319368|gb|ADK67855.1| LSU ribosomal protein L20P [Olsenella uli DSM 7084]
          Length = 121

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 76/117 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V    K + +++  KG+YG    T R  K     S QY YRDRR KKRD R+L
Sbjct: 1   MARVKRAVAGRKKRQTLVERTKGYYGTSSRTFRGMKEQAQHSMQYQYRDRRNKKRDIRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+ DL+YS+F++GL  AG+ LDRKVL+ +A     +F+ + E++R  L
Sbjct: 61  WIQRINAAARMNDLSYSKFMHGLKLAGVDLDRKVLAQIAYDDDTAFRDLAEVARKAL 117


>gi|227501818|ref|ZP_03931867.1| 50S ribosomal protein L20 [Corynebacterium accolens ATCC 49725]
 gi|306835996|ref|ZP_07468988.1| 50S ribosomal protein L20 [Corynebacterium accolens ATCC 49726]
 gi|227077843|gb|EEI15806.1| 50S ribosomal protein L20 [Corynebacterium accolens ATCC 49725]
 gi|304568162|gb|EFM43735.1| 50S ribosomal protein L20 [Corynebacterium accolens ATCC 49726]
          Length = 127

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A + +DRK+L++LA+   ++F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLRLAEVEVDRKILAELAVNDFEAFSALCETAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|257066830|ref|YP_003153086.1| 50S ribosomal protein L20 [Anaerococcus prevotii DSM 20548]
 gi|256798710|gb|ACV29365.1| ribosomal protein L20 [Anaerococcus prevotii DSM 20548]
          Length = 117

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HKKVLK AKG+YG +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKKVLKQAKGYYGSKSLLFRTANQAVMKSLNYAYIGRKHRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAA R+   +YS+F+  L KA I ++RK+L++LA+   + F K+VEL+
Sbjct: 61  WIARINAAARLNGTSYSKFMGNLKKANIDINRKMLAELAVNNPEEFAKLVELA 113


>gi|291563632|emb|CBL42448.1| LSU ribosomal protein L20P [butyrate-producing bacterium SS3/4]
          Length = 118

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  +H +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKRHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+ GL +AG+V++RKVLSD+AI   + F K+ EL++++L
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKQAGVVMNRKVLSDMAINDAEGFAKLAELAKTKL 117


>gi|297565685|ref|YP_003684657.1| 50S ribosomal protein L20 [Meiothermus silvanus DSM 9946]
 gi|296850134|gb|ADH63149.1| ribosomal protein L20 [Meiothermus silvanus DSM 9946]
          Length = 116

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K GVV   KHKK+LK AKGF+G R  T+R A+  +      ++ DRR KK ++R L
Sbjct: 1   MPRAKTGVVRRRKHKKILKLAKGFWGLRSKTVRKARETLFSGAMRSFNDRREKKNEYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAAVR + ++YS F+ GL KAGI +DRK+L+DLA+ + ++F ++V
Sbjct: 61  WIVRINAAVRQHGMSYSVFMGGLKKAGIEIDRKLLADLAVREPEAFAQLV 110


>gi|153955808|ref|YP_001396573.1| 50S ribosomal protein L20 [Clostridium kluyveri DSM 555]
 gi|219856175|ref|YP_002473297.1| hypothetical protein CKR_2832 [Clostridium kluyveri NBRC 12016]
 gi|189041856|sp|A5N256|RL20_CLOK5 RecName: Full=50S ribosomal protein L20
 gi|254800313|sp|B9E5V8|RL20_CLOK1 RecName: Full=50S ribosomal protein L20
 gi|146348666|gb|EDK35202.1| RplT [Clostridium kluyveri DSM 555]
 gi|219569899|dbj|BAH07883.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 119

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   H+K+LK AKG+YG +    + A  +V R+ + AY  R++KKRDFR L
Sbjct: 1   MARVKRAVNARKHHRKILKLAKGYYGGKSKLFKTANESVIRALRNAYVGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+  AGI ++RK+LS++AI    +F ++V++++++L V
Sbjct: 61  WIVRINAAARINGLSYSKFMNGIKTAGININRKMLSEIAINDPKTFTELVQVAKAQLNV 119


>gi|308189884|ref|YP_003922815.1| 50S ribosomal protein L20 [Mycoplasma fermentans JER]
 gi|319777082|ref|YP_004136733.1| 50S ribosomal protein l20 [Mycoplasma fermentans M64]
 gi|464625|sp|Q05427|RL20_MYCFE RecName: Full=50S ribosomal protein L20
 gi|150151|gb|AAA25415.1| ribosomal protein L20 [Mycoplasma fermentans]
 gi|307624626|gb|ADN68931.1| 50S ribosomal protein L20 [Mycoplasma fermentans JER]
 gi|318038157|gb|ADV34356.1| 50S ribosomal protein L20 [Mycoplasma fermentans M64]
          Length = 116

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 81/112 (72%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ KK LK AKG++G +    + AK AV +S  YA+RDR+  KR+FR LWI
Sbjct: 2   RVKGGTVTRARRKKWLKLAKGYFGHKSIGYKVAKQAVVKSWTYAFRDRKQIKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
            RINAA R   L+YS+FINGL +A + ++RK+LS+LAI++  +F  +++++R
Sbjct: 62  ARINAATRAEGLSYSKFINGLKRANVTINRKMLSELAISEPKTFAMLIKIAR 113


>gi|172058197|ref|YP_001814657.1| 50S ribosomal protein L20 [Exiguobacterium sibiricum 255-15]
 gi|171990718|gb|ACB61640.1| ribosomal protein L20 [Exiguobacterium sibiricum 255-15]
          Length = 119

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KK LK AKG+YG +    + AK  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYTTRQRRKKQLKLAKGYYGSKHTLFKVAKQQVMKSLMYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+T   +F  + + ++++L
Sbjct: 61  WITRINAAARINGLSYSRMMHGLKLAGIDVNRKMLADLAVTDATAFASLADTAKAKL 117


>gi|281357058|ref|ZP_06243548.1| ribosomal protein L20 [Victivallis vadensis ATCC BAA-548]
 gi|281316616|gb|EFB00640.1| ribosomal protein L20 [Victivallis vadensis ATCC BAA-548]
          Length = 116

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RV   V S  + K+ L+ AKGFYG     IR    AVD++  +AY+ R+ KK+ +R L
Sbjct: 1   MSRVTYAVPSRKRRKRTLEMAKGFYGNSSKNIRTVYDAVDKALVHAYKGRKQKKQQYRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R  ++NYSQF+NGL KA I L+RKVL+DLA+ +   FK +VE
Sbjct: 61  WIVRINAACRALNVNYSQFMNGLKKANIELNRKVLADLAVNEPAEFKALVE 111


>gi|227494666|ref|ZP_03924982.1| 50S ribosomal protein L20 [Actinomyces coleocanis DSM 15436]
 gi|226831848|gb|EEH64231.1| 50S ribosomal protein L20 [Actinomyces coleocanis DSM 15436]
          Length = 126

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y+YRDRRV+KR+ R L
Sbjct: 1   MARVKRAVNAQKKRRVVLERASGYRGQRSRLYRKAKEQVTHSMVYSYRDRRVRKREMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAAVR   + Y++FI GL  AGI +DR++LS+LAI+   +F  +VE +R  L  D
Sbjct: 61  WITRINAAVRENGMTYNRFIQGLALAGIEVDRRMLSELAISDPAAFTALVEAARKALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|167751465|ref|ZP_02423592.1| hypothetical protein EUBSIR_02461 [Eubacterium siraeum DSM 15702]
 gi|167655273|gb|EDR99402.1| hypothetical protein EUBSIR_02461 [Eubacterium siraeum DSM 15702]
 gi|291530274|emb|CBK95859.1| LSU ribosomal protein L20P [Eubacterium siraeum 70/3]
 gi|291557089|emb|CBL34206.1| LSU ribosomal protein L20P [Eubacterium siraeum V10Sc8a]
          Length = 117

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K  + +  +  K LK AKG++G +    + AK AV +S QYAY  RR+KKRDFR L
Sbjct: 1   MARIKGALATRKRRNKTLKLAKGYWGGKSRLFKTAKEAVWKSGQYAYISRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA ++   NYS FINGL KA I L+RK+LS++AI     F  +VE +++ L
Sbjct: 61  WIARINAACKMNGTNYSTFINGLKKANIGLNRKMLSEIAINDPAGFTALVEKAKAAL 117


>gi|157693290|ref|YP_001487752.1| 50S ribosomal protein L20 [Bacillus pumilus SAFR-032]
 gi|194017159|ref|ZP_03055771.1| ribosomal protein L20 [Bacillus pumilus ATCC 7061]
 gi|166984688|sp|A8FG25|RL20_BACP2 RecName: Full=50S ribosomal protein L20
 gi|157682048|gb|ABV63192.1| ribosomal protein L20 [Bacillus pumilus SAFR-032]
 gi|194011027|gb|EDW20597.1| ribosomal protein L20 [Bacillus pumilus ATCC 7061]
          Length = 119

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G VS  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVSRQRRKKVLKLAKGYFGSKHRLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L +F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLSAFNQLADAAKAQL 117


>gi|297181831|gb|ADI18010.1| ribosomal protein l20 [uncultured delta proteobacterium
           HF0200_19J16]
          Length = 118

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 81/115 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R K  V S  + K + K+AKG+ G R   +R  K AVDR+++Y+YRDR+V+KRDFR LWI
Sbjct: 2   RAKLAVHSRKRKKSLFKAAKGYRGGRSRLLRTVKDAVDRAREYSYRDRKVRKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAAVR + +NYSQFI GL  A I +DRK L+ LA+ + + F ++ + ++++L
Sbjct: 62  VRINAAVREHGMNYSQFIYGLKAAKIEMDRKTLAYLAMEEPELFAQVAQTAKTKL 116


>gi|229824397|ref|ZP_04450466.1| hypothetical protein GCWU000282_01718 [Catonella morbi ATCC 51271]
 gi|229786197|gb|EEP22311.1| hypothetical protein GCWU000282_01718 [Catonella morbi ATCC 51271]
          Length = 117

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+ LK AKG+YG +    + AK  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYVTRQRRKRTLKLAKGYYGAKHLLFKTAKQQVMKSYMYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  +NGL KAG+ ++RK+L+DLA+    +F  +VE ++  L
Sbjct: 61  WITRINAAARMNGISYSVLMNGLKKAGVEVNRKMLADLAVHDAAAFTALVEQAKKAL 117


>gi|261749263|ref|YP_003256948.1| 50S ribosomal protein L20 [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
 gi|261497355|gb|ACX83805.1| 50S ribosomal protein L20 [Blattabacterium sp. (Periplaneta
           americana) str. BPLAN]
          Length = 115

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 72/111 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  K KK+LK AKGFYG R      AK AV++S  YA+  R+ KKRDF+SL
Sbjct: 1   MPRSTNAVSSRRKRKKILKYAKGFYGARSKVYTVAKNAVEKSFSYAFSGRKKKKRDFKSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R+Y ++YS F+  L    I L+RK LSD ++   D+FKKIVE
Sbjct: 61  WIQRINAGARIYGMSYSVFMKKLSDKNIKLNRKFLSDFSMNDPDTFKKIVE 111


>gi|183602464|ref|ZP_02963830.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219683222|ref|YP_002469605.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241191182|ref|YP_002968576.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241196588|ref|YP_002970143.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|254800300|sp|B8DSQ0|RL20_BIFA0 RecName: Full=50S ribosomal protein L20
 gi|183218383|gb|EDT89028.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219620872|gb|ACL29029.1| ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240249574|gb|ACS46514.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240251142|gb|ACS48081.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|289177292|gb|ADC84538.1| LSU ribosomal protein L20P [Bifidobacterium animalis subsp. lactis
           BB-12]
 gi|295794175|gb|ADG33710.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           V9]
          Length = 127

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ AKG+ G+R    R AK  +  S  Y YRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTVLERAKGYRGQRSRLYRKAKEQLLHSFNYNYRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRIN AVR   + Y++FI GL  AGI LDR+ L++LA+   D+FK IVE +++ L  D
Sbjct: 61  WIQRINIAVRNEGITYNRFIQGLRLAGIELDRRALAELAVNDPDTFKTIVEQAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|154687019|ref|YP_001422180.1| 50S ribosomal protein L20 [Bacillus amyloliquefaciens FZB42]
 gi|166219606|sp|A7Z7H3|RL20_BACA2 RecName: Full=50S ribosomal protein L20
 gi|154352870|gb|ABS74949.1| RplT [Bacillus amyloliquefaciens FZB42]
          Length = 119

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G VS  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVSRQRRKKVLKLAKGYFGSKHRLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L +F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLTAFNQLADAAKAQL 117


>gi|18310874|ref|NP_562808.1| 50S ribosomal protein L20 [Clostridium perfringens str. 13]
 gi|110800475|ref|YP_696572.1| 50S ribosomal protein L20 [Clostridium perfringens ATCC 13124]
 gi|110803986|ref|YP_699170.1| 50S ribosomal protein L20 [Clostridium perfringens SM101]
 gi|168206057|ref|ZP_02632062.1| ribosomal protein L20 [Clostridium perfringens E str. JGS1987]
 gi|168211662|ref|ZP_02637287.1| ribosomal protein L20 [Clostridium perfringens B str. ATCC 3626]
 gi|168215518|ref|ZP_02641143.1| ribosomal protein L20 [Clostridium perfringens NCTC 8239]
 gi|169343623|ref|ZP_02864622.1| ribosomal protein L20 [Clostridium perfringens C str. JGS1495]
 gi|182626155|ref|ZP_02953915.1| ribosomal protein L20 [Clostridium perfringens D str. JGS1721]
 gi|20978574|sp|Q8XJ69|RL20_CLOPE RecName: Full=50S ribosomal protein L20
 gi|123148628|sp|Q0TP68|RL20_CLOP1 RecName: Full=50S ribosomal protein L20
 gi|123341669|sp|Q0SRT7|RL20_CLOPS RecName: Full=50S ribosomal protein L20
 gi|18145556|dbj|BAB81598.1| 50S ribosomal protein L20 [Clostridium perfringens str. 13]
 gi|110675122|gb|ABG84109.1| 50S ribosomal protein L20 [Clostridium perfringens ATCC 13124]
 gi|110684487|gb|ABG87857.1| 50S ribosomal protein L20 [Clostridium perfringens SM101]
 gi|169298183|gb|EDS80273.1| ribosomal protein L20 [Clostridium perfringens C str. JGS1495]
 gi|170662466|gb|EDT15149.1| ribosomal protein L20 [Clostridium perfringens E str. JGS1987]
 gi|170710359|gb|EDT22541.1| ribosomal protein L20 [Clostridium perfringens B str. ATCC 3626]
 gi|177908592|gb|EDT71117.1| ribosomal protein L20 [Clostridium perfringens D str. JGS1721]
 gi|182382110|gb|EDT79589.1| ribosomal protein L20 [Clostridium perfringens NCTC 8239]
          Length = 119

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   HKKVLK AKG+YG +    + A  +V R+ + AY  RR+KKRD+R L
Sbjct: 1   MARVKRAVNARKNHKKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRRLKKRDYRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NG+  AG+ ++RK+LS++AI    +F  +VEL++  L
Sbjct: 61  WIARINAATRMNGLSYSRFMNGMKLAGVDINRKMLSEIAINDPKAFADLVELAKKHL 117


>gi|297182831|gb|ADI18983.1| ribosomal protein l20 [uncultured delta proteobacterium
           HF0010_10I05]
          Length = 119

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KR V +  K    LK+AKG+ G R    R  K AV+R+++Y+YRDR+V+KRD+R L
Sbjct: 1   MARIKRAVHARKKKNAYLKAAKGYRGGRGRLWRTVKDAVERAREYSYRDRKVRKRDYRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAAVR + L+YS F++ L  AGI LDRK L+DLA      F K+VE
Sbjct: 61  WIMRINAAVREHGLSYSVFMHSLKNAGIELDRKSLADLAYENPAEFAKLVE 111


>gi|332969046|gb|EGK08086.1| inorganic pyrophosphatase [Kingella kingae ATCC 23330]
          Length = 118

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHKKVIALAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL +A I LDRKVL+DLA+    +F ++VE +++ L
Sbjct: 61  WIARINAGARQNGLSYSKFMNGLKRAAIALDRKVLADLAVFDKAAFAQLVEKAKAAL 117


>gi|332297583|ref|YP_004439505.1| 50S ribosomal protein L20 [Treponema brennaborense DSM 12168]
 gi|332180686|gb|AEE16374.1| 50S ribosomal protein L20 [Treponema brennaborense DSM 12168]
          Length = 119

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R   G     +  K+LK AKGF GRR    +AAK AV +S  +AY DRR +K D RSL
Sbjct: 1   MSRAIDGTKRKNRRAKILKLAKGFTGRRSTNYKAAKDAVVKSLTHAYVDRRDRKGDMRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   L+YS+FI GL KAG++++RK LS++AI   D+FK +VE ++  L
Sbjct: 61  WITRINAAVREEGLSYSRFIEGLTKAGVLINRKALSNMAIEDQDAFKAVVETAKKAL 117


>gi|296119684|ref|ZP_06838242.1| ribosomal protein L20 [Corynebacterium ammoniagenes DSM 20306]
 gi|295967567|gb|EFG80834.1| ribosomal protein L20 [Corynebacterium ammoniagenes DSM 20306]
          Length = 127

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK+AKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKTAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A I +DRK+L++LA+   ++F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLRLAEIEVDRKILAELAVNDFEAFSALCEAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|240168028|ref|ZP_04746687.1| 50S ribosomal protein L20 [Mycobacterium kansasii ATCC 12478]
          Length = 129

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSVLKASKGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+A+T   +F  +VE++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAVTDPAAFTALVEVARAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|16079937|ref|NP_390763.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221310827|ref|ZP_03592674.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221315152|ref|ZP_03596957.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221320070|ref|ZP_03601364.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221324352|ref|ZP_03605646.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|296331563|ref|ZP_06874032.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675478|ref|YP_003867150.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|321312419|ref|YP_004204706.1| 50S ribosomal protein L20 [Bacillus subtilis BSn5]
 gi|2500289|sp|P55873|RL20_BACSU RecName: Full=50S ribosomal protein L20
 gi|1770009|emb|CAA99618.1| ribosomal protein L20 [Bacillus subtilis]
 gi|2635350|emb|CAB14845.1| ribosomal protein L20 [Bacillus subtilis subsp. subtilis str. 168]
 gi|291485319|dbj|BAI86394.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. natto BEST195]
 gi|296151158|gb|EFG92038.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413722|gb|ADM38841.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|320018693|gb|ADV93679.1| 50S ribosomal protein L20 [Bacillus subtilis BSn5]
          Length = 119

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L +F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLTAFNQLADAAKAQL 117


>gi|317057705|ref|YP_004106172.1| 50S ribosomal protein L20 [Ruminococcus albus 7]
 gi|315449974|gb|ADU23538.1| ribosomal protein L20 [Ruminococcus albus 7]
          Length = 117

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  +  K LK AKG++G +    + AK AV +S QYAY  R+ KKRDFR L
Sbjct: 1   MARVKGAMMTRKRRNKTLKLAKGYFGAKSKHFKMAKQAVMKSGQYAYIGRKQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NG++KAGI L+RK+LS++AI+    F  IVE +++ L
Sbjct: 61  WITRISAACKMNGINYSTFMNGVNKAGINLNRKMLSEIAISDPAGFTAIVEQAKAAL 117


>gi|229496070|ref|ZP_04389792.1| ribosomal protein L20 [Porphyromonas endodontalis ATCC 35406]
 gi|229316966|gb|EEN82877.1| ribosomal protein L20 [Porphyromonas endodontalis ATCC 35406]
          Length = 114

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G+YG R+N    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYYGARRNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA R+  ++YS+ +  LH  GI ++RKVL+DLA+    +FK IVE
Sbjct: 61  WIQRINAAARMEGMSYSRLMGALHSKGIEINRKVLADLAMNNPAAFKAIVE 111


>gi|308174581|ref|YP_003921286.1| 50S ribosomal protein L20 [Bacillus amyloliquefaciens DSM 7]
 gi|311069380|ref|YP_003974303.1| 50S ribosomal protein L20 [Bacillus atrophaeus 1942]
 gi|307607445|emb|CBI43816.1| ribosomal protein L20 [Bacillus amyloliquefaciens DSM 7]
 gi|310869897|gb|ADP33372.1| 50S ribosomal protein L20 [Bacillus atrophaeus 1942]
 gi|328554504|gb|AEB24996.1| 50S ribosomal protein L20 [Bacillus amyloliquefaciens TA208]
 gi|328912909|gb|AEB64505.1| ribosomal protein L20 [Bacillus amyloliquefaciens LL3]
          Length = 119

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L +F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLTAFNQLADAAKAQL 117


>gi|330752456|emb|CBL87406.1| ribosomal protein L20 [uncultured Flavobacteria bacterium]
          Length = 114

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AVD++  YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGYFGRRKNVWTVAKNAVDKAMLYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R + ++YSQF+  L    I L+RKVL+DLA+    +F+ +++
Sbjct: 61  WIMRINAGARQHGMSYSQFMGKLKANNIDLNRKVLADLAMNDPKAFEAVIK 111


>gi|187918062|ref|YP_001883625.1| 50S ribosomal protein L20 [Borrelia hermsii DAH]
 gi|226730360|sp|B2RZP9|RL20_BORHD RecName: Full=50S ribosomal protein L20
 gi|119860910|gb|AAX16705.1| LSU ribosomal protein L20P [Borrelia hermsii DAH]
          Length = 115

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 78/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V  A+ K++LK  KGF+G +K+  + AK  + +   YA RDR+ +KRDFRSL
Sbjct: 1   MARVKNGIVHVARRKRLLKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRKARKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RI+AA+    + YS+F  GL K+ I L+RK+LS+LAI  +++FKKIV
Sbjct: 61  WIVRISAALTGMGITYSRFFEGLKKSNIKLNRKILSNLAIEDIETFKKIV 110


>gi|304373305|ref|YP_003856514.1| 50S ribosomal protein L20 [Mycoplasma hyorhinis HUB-1]
 gi|304309496|gb|ADM21976.1| 50S ribosomal protein L20 [Mycoplasma hyorhinis HUB-1]
 gi|330723821|gb|AEC46191.1| 50S ribosomal protein L20 [Mycoplasma hyorhinis MCLD]
          Length = 119

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/108 (52%), Positives = 77/108 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ ++ KK LK AKG++G +    + AK AV +S  YA+RDR+  KRDFR LWI
Sbjct: 2   RVKGGTVTRSRRKKWLKLAKGYWGHKSVGYKVAKQAVVKSWTYAFRDRKQVKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
            RINAA R   L+YSQ +NGL K+ I ++RK+LS+LAI + ++F KIV
Sbjct: 62  SRINAASRSLGLSYSQLVNGLKKSNIEINRKMLSELAINEPETFAKIV 109


>gi|291544308|emb|CBL17417.1| LSU ribosomal protein L20P [Ruminococcus sp. 18P13]
          Length = 118

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  + +  +  K LK AKG++G +    + AK AV +S  YAY  R+ KKRDFR+L
Sbjct: 1   MARVKGAMATRKRRNKTLKLAKGYWGNKSKHFKMAKQAVMKSGNYAYIGRKQKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NG  KAGI L+RK+LS++AI     F KI E +++ L
Sbjct: 61  WITRISAACKLNGMNYSTFMNGCKKAGITLNRKMLSEIAINDAAGFTKITEQAKAAL 117


>gi|259046986|ref|ZP_05737387.1| 50S ribosomal protein L20 [Granulicatella adiacens ATCC 49175]
 gi|259036429|gb|EEW37684.1| 50S ribosomal protein L20 [Granulicatella adiacens ATCC 49175]
          Length = 119

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  +  +VLK AKG+YG +    + AK AV +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRRRRNRVLKLAKGYYGAKSKLFKTAKQAVMKSYMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIARINAAARLNGLSYSKLMHGLKLAGIEMNRKMLADLAVNDAAAFTVLADKAKEAL 117


>gi|38233752|ref|NP_939519.1| 50S ribosomal protein L20 [Corynebacterium diphtheriae NCTC 13129]
 gi|60390473|sp|Q6NHH5|RL20_CORDI RecName: Full=50S ribosomal protein L20
 gi|38200013|emb|CAE49682.1| 50S ribosomal protein L20 [Corynebacterium diphtheriae]
          Length = 127

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 78/121 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K +++LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSLNAKKKRREILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  A I +DRKVL+DLA+    +F  I E +++ L  D
Sbjct: 61  WITRINAAARMNDITYNRLIQGLRLAEIEVDRKVLADLAVNDFAAFSAICEAAKAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|331701567|ref|YP_004398526.1| 50S ribosomal protein L20 [Lactobacillus buchneri NRRL B-30929]
 gi|329128910|gb|AEB73463.1| 50S ribosomal protein L20 [Lactobacillus buchneri NRRL B-30929]
          Length = 118

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ K+VLK AKG+ G +    + AK  V +SQ YA+RDRR  K +FR L
Sbjct: 1   MPRVKGGTVTHARRKRVLKLAKGYRGGKSRLFKTAKDQVMKSQVYAFRDRRNNKGNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ DL+YSQF++GL  A I ++RK+L+DLA++  ++FK + + ++  L
Sbjct: 61  WIARINAAARLNDLSYSQFMHGLKLANIDMNRKMLADLAVSDTEAFKALTDEAKKAL 117


>gi|154500002|ref|ZP_02038040.1| hypothetical protein BACCAP_03659 [Bacteroides capillosus ATCC
           29799]
 gi|150271600|gb|EDM98857.1| hypothetical protein BACCAP_03659 [Bacteroides capillosus ATCC
           29799]
          Length = 118

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  +  KVLK AKG++G +    + AK  V +S +YAY  RR+KKRDFR L
Sbjct: 1   MARVKGAMMTRKRRNKVLKLAKGYWGAKSKHFKMAKEQVMKSLKYAYTGRRLKKRDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NGL KAG+ ++RK+L++LA+    +F  + E+++++L
Sbjct: 61  WITRISAACKMNGMNYSTFMNGLKKAGVEINRKMLAELAVNDKAAFTALTEMAKAQL 117


>gi|325677952|ref|ZP_08157594.1| ribosomal protein L20 [Ruminococcus albus 8]
 gi|324110506|gb|EGC04680.1| ribosomal protein L20 [Ruminococcus albus 8]
          Length = 117

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  +  K LK AKG++G +    + AK AV +S QYAY  R+ KKRDFR L
Sbjct: 1   MARVKGAMMTRKRRNKTLKLAKGYFGAKSKHFKMAKQAVMKSGQYAYIGRKQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NG++KAGI L+RK+LS++AI+    F  IVE +++ L
Sbjct: 61  WITRISAACKMNGINYSSFMNGVNKAGINLNRKMLSEIAISDPAGFTAIVEKAKAAL 117


>gi|283797709|ref|ZP_06346862.1| ribosomal protein L20 [Clostridium sp. M62/1]
 gi|291074605|gb|EFE11969.1| ribosomal protein L20 [Clostridium sp. M62/1]
 gi|295092065|emb|CBK78172.1| LSU ribosomal protein L20P [Clostridium cf. saccharolyticum K10]
          Length = 118

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+ + +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKKHNRVLKLAKGYRGARSKQYRIAKQSVMRALKSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+ GL  AG+ ++RKVLSD+AI+  + F K+ EL++S+L
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLAGVEMNRKVLSDMAISDAEGFAKLAELAKSKL 117


>gi|325568473|ref|ZP_08144840.1| 50S ribosomal protein L20 [Enterococcus casseliflavus ATCC 12755]
 gi|325158242|gb|EGC70395.1| 50S ribosomal protein L20 [Enterococcus casseliflavus ATCC 12755]
          Length = 121

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + SR  L
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDATAFTALADQSRQAL 117


>gi|295698323|ref|YP_003602978.1| ribosomal protein L20 [Candidatus Riesia pediculicola USDA]
 gi|291157425|gb|ADD79870.1| ribosomal protein L20 [Candidatus Riesia pediculicola USDA]
          Length = 117

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG  + AKHKKV+  AKG+YG R    R+A  AV +S QY+YRDRR +K D R L
Sbjct: 1   MTRVKRGTFAHAKHKKVIDQAKGYYGARSRNYRSAFQAVIKSGQYSYRDRRRRKTDMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R Y L+YS+ I  L  + I+++RK+LS++AI+    F  +V+
Sbjct: 61  WISRINAESRKYGLSYSRLIEMLKNSSIIINRKILSEIAISNKKFFSYLVK 111


>gi|227548137|ref|ZP_03978186.1| 50S ribosomal protein L20 [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227079799|gb|EEI17762.1| 50S ribosomal protein L20 [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 128

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     SQ YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSQTYAYRDRRKRKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++ I+GL  A + +DRK+L+DLA+    +F  I E+++  L  D
Sbjct: 61  WIQRINAAARMNGITYNRLIHGLKLAEVEVDRKILADLAVNDFATFSAICEVAKKALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|311742380|ref|ZP_07716189.1| 50S ribosomal protein L20 [Aeromicrobium marinum DSM 15272]
 gi|311314008|gb|EFQ83916.1| 50S ribosomal protein L20 [Aeromicrobium marinum DSM 15272]
          Length = 130

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++ L+ AKG+ G+R    R AK  V  S  Y YRDR+ KK DFR L
Sbjct: 1   MARVKRSVNAQKKRRETLERAKGYRGQRSRLYRKAKEQVIHSHVYNYRDRKAKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI G+  AG+ +DRK L++LA+ +  +F  +V+L++  L  D
Sbjct: 61  WIQRINAAVRAEGMTYNRFIQGIKAAGVEVDRKNLAELAVHEPAAFSALVQLAKDNLPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|89893015|ref|YP_516502.1| 50S ribosomal protein L20 [Desulfitobacterium hafniense Y51]
 gi|219666286|ref|YP_002456721.1| 50S ribosomal protein L20 [Desulfitobacterium hafniense DCB-2]
 gi|122484064|sp|Q251I4|RL20_DESHY RecName: Full=50S ribosomal protein L20
 gi|254800318|sp|B8FZK2|RL20_DESHD RecName: Full=50S ribosomal protein L20
 gi|89332463|dbj|BAE82058.1| 50S ribosomal protein L20 [Desulfitobacterium hafniense Y51]
 gi|219536546|gb|ACL18285.1| ribosomal protein L20 [Desulfitobacterium hafniense DCB-2]
          Length = 120

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV    +HKKVLK AKGF G +    R A   V +S  YAY  RR KK DFR L
Sbjct: 1   MARVKRGVTKHQRHKKVLKLAKGFRGAKSKLYRPANEQVMKSLAYAYAHRRDKKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ +NGL  AG+ ++RK+L+DLAI    +F ++V ++++++
Sbjct: 61  WIARINAAARLNGLSYSRMMNGLKIAGVSVNRKMLADLAINDAAAFTELVNVAKAQV 117


>gi|222152875|ref|YP_002562052.1| 50S ribosomal protein L20 [Streptococcus uberis 0140J]
 gi|254800343|sp|B9DU42|RL20_STRU0 RecName: Full=50S ribosomal protein L20
 gi|222113688|emb|CAR41626.1| 50S ribosomal protein L20 [Streptococcus uberis 0140J]
          Length = 119

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+     F  + + ++ +L
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLADIEVNRKMLADLAVNDAAGFTALADAAKDKL 117


>gi|219681503|ref|YP_002467888.1| 50S ribosomal protein L20 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|257471184|ref|ZP_05635183.1| 50S ribosomal protein L20 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|254800305|sp|B8D8S9|RL20_BUCA5 RecName: Full=50S ribosomal protein L20
 gi|219624346|gb|ACL30501.1| 50S ribosomal protein L20 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
          Length = 118

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/118 (57%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARIKRGVVAHARHKKILKQAKGYYGARSRIYRVAHQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAAVR   ++YS FI GL KA I +DRK+LSD+AI  L SF  +V+ ++  LL
Sbjct: 61  WISRINAAVRQSKMSYSNFIFGLKKASINIDRKILSDIAIFDLLSFNALVKKAKEALL 118


>gi|302035781|ref|YP_003796103.1| 50S ribosomal protein L20 [Candidatus Nitrospira defluvii]
 gi|300603845|emb|CBK40177.1| 50S ribosomal protein L20 [Candidatus Nitrospira defluvii]
          Length = 122

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G  +  + KK LK AKG YG +    R+A  +VD+ Q YAY  R+ +KRDFR L
Sbjct: 1   MPRTKGGPKTRQRRKKRLKLAKGQYGAKSRLFRSATESVDKGQAYAYVGRKHRKRDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA R++ + YS+F+N L KA I+LDRKVLSD+AI  +  F+K+V +++ +L
Sbjct: 61  WIARISAATRLHGIAYSRFMNALKKANILLDRKVLSDMAIRDMAGFEKLVGVAKQQL 117


>gi|228469292|ref|ZP_04054318.1| ribosomal protein L20 [Porphyromonas uenonis 60-3]
 gi|228309191|gb|EEK17793.1| ribosomal protein L20 [Porphyromonas uenonis 60-3]
          Length = 115

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 75/115 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G+ G R+N    AK   ++   YAYRDR+ KKR FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYIGARRNVWTVAKNGWEKGLTYAYRDRKNKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAA R+  ++YS  +  LHK GI ++RKVL+DLA+   ++FK I E +R 
Sbjct: 61  WIQRINAAARLEGMSYSTLMGALHKQGIEINRKVLADLAMNNPEAFKSICEKARG 115


>gi|254974301|ref|ZP_05270773.1| 50S ribosomal protein L20 [Clostridium difficile QCD-66c26]
 gi|255091698|ref|ZP_05321176.1| 50S ribosomal protein L20 [Clostridium difficile CIP 107932]
 gi|255313426|ref|ZP_05355009.1| 50S ribosomal protein L20 [Clostridium difficile QCD-76w55]
 gi|255516113|ref|ZP_05383789.1| 50S ribosomal protein L20 [Clostridium difficile QCD-97b34]
 gi|255649209|ref|ZP_05396111.1| 50S ribosomal protein L20 [Clostridium difficile QCD-37x79]
 gi|255654728|ref|ZP_05400137.1| 50S ribosomal protein L20 [Clostridium difficile QCD-23m63]
 gi|260682384|ref|YP_003213669.1| 50S ribosomal protein L20 [Clostridium difficile CD196]
 gi|260685983|ref|YP_003217116.1| 50S ribosomal protein L20 [Clostridium difficile R20291]
 gi|296878206|ref|ZP_06902218.1| 50S ribosomal protein L20 [Clostridium difficile NAP07]
 gi|306519313|ref|ZP_07405660.1| 50S ribosomal protein L20 [Clostridium difficile QCD-32g58]
 gi|260208547|emb|CBA61209.1| 50S ribosomal protein L20 [Clostridium difficile CD196]
 gi|260211999|emb|CBE02533.1| 50S ribosomal protein L20 [Clostridium difficile R20291]
 gi|296430775|gb|EFH16610.1| 50S ribosomal protein L20 [Clostridium difficile NAP07]
          Length = 118

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+ + +  KHKK+LK AKGF G R    R A   V ++ + AY  R++KKRDFR L
Sbjct: 1   MARVKKAMNARKKHKKILKLAKGFRGSRSKLYRPANTFVMKALKNAYIGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+  ++YS+ +NGL  +GI ++RK+LS++AI   + F K+ E+++++L
Sbjct: 61  WIQRINAAARMNGISYSRLMNGLKLSGIEVNRKMLSEMAIQDPEGFAKLAEVAKAKL 117


>gi|262374870|ref|ZP_06068104.1| ribosomal protein L20 [Acinetobacter lwoffii SH145]
 gi|262309883|gb|EEY91012.1| ribosomal protein L20 [Acinetobacter lwoffii SH145]
          Length = 119

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVQAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA +++DR+VL+D+A+    +F  +   ++  L
Sbjct: 61  WIARINAGARQNGLSYSRMIAGLKKAQVIIDRRVLADIAMHDAIAFAALASKAKDAL 117


>gi|297844610|ref|XP_002890186.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297336028|gb|EFH66445.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 126

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 74/100 (74%)

Query: 15  KKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDL 74
           K++ K AKGF GR KN IR A+  V+++ QY+YRDRR KKR+ R LWI+RINA  R + +
Sbjct: 4   KEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQHGV 63

Query: 75  NYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           NY  FI+GL K  I L+RKVLS+L++ +  SFK +V++SR
Sbjct: 64  NYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSR 103


>gi|328957062|ref|YP_004374448.1| 50S ribosomal protein L20 [Carnobacterium sp. 17-4]
 gi|328673386|gb|AEB29432.1| 50S ribosomal protein L20 [Carnobacterium sp. 17-4]
          Length = 120

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG+YG +    + AK  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKILKLAKGYYGSKHILFKTAKQQVMKSYTYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ +++YS F++GL  A I ++RK+L+++A+T   +F  + E +++ L
Sbjct: 61  WIARINAAARLNNMSYSTFMHGLKLAEIDVNRKMLAEIAVTDAAAFTALAEQAKTAL 117


>gi|332667068|ref|YP_004449856.1| 50S ribosomal protein L20 [Haliscomenobacter hydrossis DSM 1100]
 gi|332335882|gb|AEE52983.1| 50S ribosomal protein L20 [Haliscomenobacter hydrossis DSM 1100]
          Length = 114

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK A+GF+G R   +  AK A+D++  YAYRDR+ KKR +R L
Sbjct: 1   MPRSVNAVASRARRKKVLKGARGFFGARSKVLTVAKNALDKAMGYAYRDRKAKKRAYRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R++ ++YS+ ++ L K+ + L+RKVL+DLA+   D+FK IVE
Sbjct: 61  WIARINAGARMHGVSYSRLMHHLAKSDVQLNRKVLADLALNHADAFKAIVE 111


>gi|297626568|ref|YP_003688331.1| 50S ribosomal protein L20 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296922333|emb|CBL56905.1| 50S ribosomal protein L20 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 123

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 78/114 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++L SA G+ G+R    R AK  V  S  Y++RDR+ +K DFRSL
Sbjct: 1   MARVKRAVNAHKKRREILDSASGYRGQRSRLYRKAKEQVLHSATYSFRDRKARKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R   + Y++FINGL  AG+  DRK+L+DLA+   D+F  +V++++
Sbjct: 61  WIQRINAACRAEGMTYNRFINGLKNAGVGADRKMLADLAVFDSDAFAALVKVAK 114


>gi|227501360|ref|ZP_03931409.1| ribosomal protein L20 [Anaerococcus tetradius ATCC 35098]
 gi|227216459|gb|EEI81869.1| ribosomal protein L20 [Anaerococcus tetradius ATCC 35098]
          Length = 114

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 78/114 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HKKVLK AKG+YG +    + A  AV +S  YA+  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKKVLKQAKGYYGSKSLLFKTANQAVMKSLAYAFIGRKHRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R+   +YS+ + GL KA I ++RK+L++LAI   + F K+VEL++
Sbjct: 61  WIARINAAARLNGTSYSKLMGGLKKANIEINRKMLAELAINNPEEFAKLVELAK 114


>gi|320353539|ref|YP_004194878.1| 50S ribosomal protein L20P [Desulfobulbus propionicus DSM 2032]
 gi|320122041|gb|ADW17587.1| LSU ribosomal protein L20P [Desulfobulbus propionicus DSM 2032]
          Length = 117

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 74/113 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV RG  +  +  KVL  AKGF G +    + A  AVDR+  YAYRDRRVKKR+FR L
Sbjct: 1   MPRVTRGFKARRRRNKVLTLAKGFRGGKHRLFKTAAEAVDRALCYAYRDRRVKKREFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAA +    +YS+ INGL K  I LDRKVLS+LAI   ++F  +V+ S
Sbjct: 61  WIARINAAAKQNGTSYSRLINGLSKNSIELDRKVLSNLAIVDPNAFSAVVKAS 113


>gi|256372441|ref|YP_003110265.1| ribosomal protein L20 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256009025|gb|ACU54592.1| ribosomal protein L20 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 122

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 75/113 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + S    + VL+ A+G+YG +  + RAA   V  S QYAYRDRR +K +FR L
Sbjct: 1   MARVKRSLHSRKHRRAVLELARGYYGNKSRSYRAAHEQVMHSLQYAYRDRRARKGEFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WIQRINAA R     YS+F+ GL +AG+ LDR+VL+DLA+    +F  +V L+
Sbjct: 61  WIQRINAAARAEGTTYSRFMAGLRRAGVGLDRRVLADLAVRSPGAFGALVRLA 113


>gi|291295769|ref|YP_003507167.1| 50S ribosomal protein L20 [Meiothermus ruber DSM 1279]
 gi|290470728|gb|ADD28147.1| ribosomal protein L20 [Meiothermus ruber DSM 1279]
          Length = 115

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 78/115 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K GVV   KHK +LK AKGFYG R  ++R A+  +      ++ DRR +K D R L
Sbjct: 1   MPRAKTGVVRRRKHKAILKRAKGFYGLRSKSVRKARETLFSGAMRSFNDRRKRKGDMRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R + L+YS F++GL KAGI LDRK+L+D+A+ Q ++F ++V  +R+
Sbjct: 61  WIVRINAAARQHGLSYSVFMHGLKKAGIELDRKILADIAVRQPEAFAELVNKARA 115


>gi|15219330|ref|NP_173118.1| ribosomal protein L20 family protein [Arabidopsis thaliana]
 gi|21554397|gb|AAM63502.1| ribosomal protein L20, putative [Arabidopsis thaliana]
 gi|88011169|gb|ABD38912.1| At1g16740 [Arabidopsis thaliana]
 gi|332191370|gb|AEE29491.1| Ribosomal protein L20 [Arabidopsis thaliana]
          Length = 126

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 74/100 (74%)

Query: 15  KKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDL 74
           K++ K AKGF GR KN IR A+  V+++ QY+YRDRR KKR+ R LWI+RINA  R + +
Sbjct: 4   KEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKREMRGLWIERINAGSRQHGV 63

Query: 75  NYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           NY  FI+GL K  I L+RKVLS+L++ +  SFK +V++SR
Sbjct: 64  NYGNFIHGLMKENIQLNRKVLSELSMHEPYSFKALVDVSR 103


>gi|313887180|ref|ZP_07820876.1| ribosomal protein L20 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332300496|ref|YP_004442417.1| 50S ribosomal protein L20 [Porphyromonas asaccharolytica DSM 20707]
 gi|312923409|gb|EFR34222.1| ribosomal protein L20 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332177559|gb|AEE13249.1| 50S ribosomal protein L20 [Porphyromonas asaccharolytica DSM 20707]
          Length = 115

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 74/115 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G+ G R N    AK   ++  +YAYRDR+ KKR FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYIGARSNVWTVAKNGWEKGLKYAYRDRKNKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAA R+  + YS  +  LHK GI ++RKVL+DLA+   ++FK I E +R 
Sbjct: 61  WIQRINAAARLEGMTYSTLMGALHKQGIEINRKVLADLAMNNPEAFKSICEKARG 115


>gi|227505048|ref|ZP_03935097.1| 50S ribosomal protein L20 [Corynebacterium striatum ATCC 6940]
 gi|227198412|gb|EEI78460.1| 50S ribosomal protein L20 [Corynebacterium striatum ATCC 6940]
          Length = 127

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 79/120 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A I +DRK+L++LA+   ++F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLRLAEIEVDRKILAELAVNDFEAFSALCEAAKAALPED 120


>gi|157370387|ref|YP_001478376.1| 50S ribosomal protein L20 [Serratia proteamaculans 568]
 gi|270261560|ref|ZP_06189833.1| 50S ribosomal protein L20 [Serratia odorifera 4Rx13]
 gi|166984769|sp|A8GDQ8|RL20_SERP5 RecName: Full=50S ribosomal protein L20
 gi|157322151|gb|ABV41248.1| ribosomal protein L20 [Serratia proteamaculans 568]
 gi|270045044|gb|EFA18135.1| 50S ribosomal protein L20 [Serratia odorifera 4Rx13]
          Length = 118

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA RV  L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARVNGLSYSKFINGLKKASIEIDRKILADIAVFDKVAFGALVEKAKAAL 117


>gi|229817385|ref|ZP_04447667.1| hypothetical protein BIFANG_02647 [Bifidobacterium angulatum DSM
           20098]
 gi|229785174|gb|EEP21288.1| hypothetical protein BIFANG_02647 [Bifidobacterium angulatum DSM
           20098]
          Length = 127

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LA++  ++FK IV  ++  L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAVSDPETFKAIVAEAKKALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|123442192|ref|YP_001006173.1| 50S ribosomal protein L20 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238757780|ref|ZP_04618963.1| 50S ribosomal protein L20 [Yersinia aldovae ATCC 35236]
 gi|238765298|ref|ZP_04626225.1| 50S ribosomal protein L20 [Yersinia kristensenii ATCC 33638]
 gi|332161614|ref|YP_004298191.1| 50S ribosomal protein L20 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|166220805|sp|A1JMK7|RL20_YERE8 RecName: Full=50S ribosomal protein L20
 gi|122089153|emb|CAL11995.1| 50S ribosomal protein L20 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238696471|gb|EEP89261.1| 50S ribosomal protein L20 [Yersinia kristensenii ATCC 33638]
 gi|238704023|gb|EEP96557.1| 50S ribosomal protein L20 [Yersinia aldovae ATCC 35236]
 gi|318605895|emb|CBY27393.1| LSU ribosomal protein L20p [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665844|gb|ADZ42488.1| 50S ribosomal protein L20 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861022|emb|CBX71294.1| 50S ribosomal protein L20 [Yersinia enterocolitica W22703]
          Length = 118

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R  D++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNDMSYSKFINGLKKASIEIDRKILADIAVFDKVAFSALVEKAKAAL 117


>gi|150016447|ref|YP_001308701.1| 50S ribosomal protein L20 [Clostridium beijerinckii NCIMB 8052]
 gi|189041855|sp|A6LTR5|RL20_CLOB8 RecName: Full=50S ribosomal protein L20
 gi|149902912|gb|ABR33745.1| ribosomal protein L20 [Clostridium beijerinckii NCIMB 8052]
          Length = 119

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR   S   HKKVLK AKG+YG +    + A  +V R+ + +Y  R+ KKRD+RSL
Sbjct: 1   MARVKRAKNSRKNHKKVLKLAKGYYGGKSKLYKTANESVIRALRNSYVGRKNKKRDYRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ +L+YS+F+NG+  AGI ++RK+LS++AI    +F ++VE+++ +L
Sbjct: 61  WIARINAATRINNLSYSKFMNGIKLAGIDINRKMLSEIAINDPKAFTELVEVAKKQL 117


>gi|25028067|ref|NP_738121.1| 50S ribosomal protein L20 [Corynebacterium efficiens YS-314]
 gi|259505619|ref|ZP_05748521.1| inorganic diphosphatase [Corynebacterium efficiens YS-314]
 gi|31563164|sp|Q8FTQ0|RL20_COREF RecName: Full=50S ribosomal protein L20
 gi|23493351|dbj|BAC18321.1| putative 50S ribosomal protein L20 [Corynebacterium efficiens
           YS-314]
 gi|259166784|gb|EEW51338.1| inorganic diphosphatase [Corynebacterium efficiens YS-314]
          Length = 128

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 78/121 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++ I GL  A I +DRK+L+DLA+    +F  I E +++ L  D
Sbjct: 61  WIQRINAAARMNGITYNRLIQGLRLAEIEVDRKILADLAVNDFAAFSAICEAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|307718471|ref|YP_003874003.1| 50S ribosomal protein L20 [Spirochaeta thermophila DSM 6192]
 gi|306532196|gb|ADN01730.1| 50S ribosomal protein L20 [Spirochaeta thermophila DSM 6192]
 gi|315187009|gb|EFU20766.1| LSU ribosomal protein L20P [Spirochaeta thermophila DSM 6578]
          Length = 119

 Score =  110 bits (276), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/119 (47%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R   G     + KK+LK AKGF+GRRK+  R AK AV ++  Y+YRDR+ +KR+FR L
Sbjct: 1   MPRAIDGTRRKDRRKKILKLAKGFWGRRKSNFRTAKDAVAKALVYSYRDRKYRKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RI+AA R   + YS+FI GL K+ I ++RKVLS++AI    +FK++V  ++  L V
Sbjct: 61  WIARISAACREEGMTYSRFIEGLRKSNIAINRKVLSNMAIEDPQAFKELVATAKKALEV 119


>gi|229180891|ref|ZP_04308226.1| 50S ribosomal protein L20 [Bacillus cereus 172560W]
 gi|228602448|gb|EEK59934.1| 50S ribosomal protein L20 [Bacillus cereus 172560W]
          Length = 118

 Score =  110 bits (276), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKNTLFKVANQQVMKSLMYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  +++S +
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKNAGIEVNRKMLADLAVHDEKAFAELATVAKSNI 117


>gi|116495178|ref|YP_806912.1| 50S ribosomal protein L20 [Lactobacillus casei ATCC 334]
 gi|191638686|ref|YP_001987852.1| 50S ribosomal protein L20 [Lactobacillus casei BL23]
 gi|227534806|ref|ZP_03964855.1| 50S ribosomal protein L20 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239632059|ref|ZP_04675090.1| 50S ribosomal protein L20 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301066741|ref|YP_003788764.1| 50S ribosomal protein L20 [Lactobacillus casei str. Zhang]
 gi|122263405|sp|Q038A2|RL20_LACC3 RecName: Full=50S ribosomal protein L20
 gi|226730412|sp|B3WF43|RL20_LACCB RecName: Full=50S ribosomal protein L20
 gi|116105328|gb|ABJ70470.1| LSU ribosomal protein L20P [Lactobacillus casei ATCC 334]
 gi|190712988|emb|CAQ66994.1| 50S ribosomal protein L20 [Lactobacillus casei BL23]
 gi|227187562|gb|EEI67629.1| 50S ribosomal protein L20 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239526524|gb|EEQ65525.1| 50S ribosomal protein L20 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300439148|gb|ADK18914.1| Ribosomal protein L20 [Lactobacillus casei str. Zhang]
 gi|327382727|gb|AEA54203.1| 50S ribosomal protein L20 [Lactobacillus casei LC2W]
 gi|327385914|gb|AEA57388.1| 50S ribosomal protein L20 [Lactobacillus casei BD-II]
          Length = 118

 Score =  110 bits (276), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+ G +    +AA A V  S +YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYRGAKHLLFKAANAQVMVSYRYAFRDRRAKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YS+ ++GL  A + ++RK+L+DLA++  D FK + + ++  L
Sbjct: 61  WIARINAAARMNDISYSKLMHGLKVANVDMNRKMLADLAVSDPDGFKAVADTAKKAL 117


>gi|15616748|ref|NP_239960.1| 50S ribosomal protein L20 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219682059|ref|YP_002468443.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|11134527|sp|P57228|RL20_BUCAI RecName: Full=50S ribosomal protein L20
 gi|254800306|sp|B8D733|RL20_BUCAT RecName: Full=50S ribosomal protein L20
 gi|25295349|pir||F84944 50S ribosomal protein L20 [imported] - Buchnera sp. (strain APS)
 gi|10038811|dbj|BAB12846.1| 50S ribosomal protein L20 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219621792|gb|ACL29948.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|311085872|gb|ADP65954.1| 50S ribosomal protein L20 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086443|gb|ADP66524.1| 50S ribosomal protein L20 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087025|gb|ADP67105.1| 50S ribosomal protein L20 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087591|gb|ADP67670.1| 50S ribosomal protein L20 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 118

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/118 (56%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARIKRGVIAHARHKKILKQAKGYYGARSRIYRVAHQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAAVR   ++YS FI GL KA I +DRK+LSD+AI  L SF  +V+ ++  LL
Sbjct: 61  WISRINAAVRQSKMSYSNFIFGLKKASINIDRKILSDIAIFDLLSFNALVKKAKEALL 118


>gi|296110551|ref|YP_003620932.1| ribosomal protein L20 [Leuconostoc kimchii IMSNU 11154]
 gi|295832082|gb|ADG39963.1| ribosomal protein L20 [Leuconostoc kimchii IMSNU 11154]
          Length = 139

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 84/118 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G VS A+ KK++K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVSRARRKKIVKLAKGYRGQRRINFKVAKQQVWKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG+ L+RK+L+++A+T  D+F K+ + +++ L  D
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGVELNRKMLAEIAVTDFDTFSKLADQAKAALASD 119


>gi|118617268|ref|YP_905600.1| 50S ribosomal protein L20 [Mycobacterium ulcerans Agy99]
 gi|166219666|sp|A0PP60|RL20_MYCUA RecName: Full=50S ribosomal protein L20
 gi|118569378|gb|ABL04129.1| 50S ribosomal protein L20 RplT [Mycobacterium ulcerans Agy99]
          Length = 129

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAHKKRRSVLKASKGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+AIT   +F  +V+++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAITDPAAFTALVDVARAALPED 120

Query: 121 VAS 123
           V++
Sbjct: 121 VSA 123


>gi|37522353|ref|NP_925730.1| 50S ribosomal protein L20 [Gloeobacter violaceus PCC 7421]
 gi|39931741|sp|Q7NGV3|RL20_GLOVI RecName: Full=50S ribosomal protein L20
 gi|35213353|dbj|BAC90725.1| 50S ribosomal protein L20 [Gloeobacter violaceus PCC 7421]
          Length = 119

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 78/115 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+  + KK+LK AKGF G       AA   V ++ + AYR RR KKRDFRSL
Sbjct: 1   MVRVKRGNVARKRRKKILKLAKGFRGSHSKLFTAANQQVMKALRNAYRHRRTKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINA  R   L+YS+ I+GLHKA + L+RK+L+ LA+T  ++F ++  +++S
Sbjct: 61  WIVRINAQARTEGLSYSRLIDGLHKADVALNRKMLAQLAVTDPEAFAEVARVAKS 115


>gi|255008480|ref|ZP_05280606.1| 50S ribosomal protein L20 [Bacteroides fragilis 3_1_12]
 gi|313146208|ref|ZP_07808401.1| 50S ribosomal protein L20 [Bacteroides fragilis 3_1_12]
 gi|313134975|gb|EFR52335.1| 50S ribosomal protein L20 [Bacteroides fragilis 3_1_12]
          Length = 116

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 73/104 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+LK  +G++G RKN    AK   ++   YA+RDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKARRKKILKLTRGYFGARKNVWTVAKNTWEKGLTYAFRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLD 104
           WIQRINAA R+  ++YS+ + GLHKAGI ++RKVL+DLA+   +
Sbjct: 61  WIQRINAAARLEGMSYSKLMGGLHKAGIEINRKVLADLAVNHPE 104


>gi|76576279|gb|ABA53853.1| L20 [Leptospira biflexa serovar Patoc]
          Length = 138

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 78/122 (63%), Gaps = 2/122 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R   G +   + KKVL  AKGF G R    R AK+AV ++ Q+AYRDRR KK +FR L
Sbjct: 1   MPRAVNGTIHKNRRKKVLAKAKGFRGGRSKLFRTAKSAVMKAGQWAYRDRRKKKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR--SRLL 118
           WI RINAAVR   ++YS+FI+ L   GI LDRK L+DLA    + F  IVE  +  S+L+
Sbjct: 61  WITRINAAVRENGMSYSKFIHALKTHGINLDRKTLADLAYNHKEVFNAIVEKPKSLSKLV 120

Query: 119 VD 120
           +D
Sbjct: 121 LD 122


>gi|313203701|ref|YP_004042358.1| LSU ribosomal protein l20p [Paludibacter propionicigenes WB4]
 gi|312443017|gb|ADQ79373.1| LSU ribosomal protein L20P [Paludibacter propionicigenes WB4]
          Length = 116

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + K++L   +G++G R+N    AK   ++  QYAYRDR+ KKR FR+L
Sbjct: 1   MPRSVNHVASRKRRKRILSLTRGYFGGRRNVWTVAKNTWEKGLQYAYRDRKNKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  ++YS+ +  LHKAGI ++RKVL+DLA+   ++FK IV
Sbjct: 61  WIQRINAAARLEGMSYSKLMGALHKAGIEMNRKVLADLAMNHPEAFKAIV 110


>gi|253577271|ref|ZP_04854590.1| 50S ribosomal protein L20 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843385|gb|EES71414.1| 50S ribosomal protein L20 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 119

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK AKG++G +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGFVVRRRHKKVLKLAKGYFGSKHRIFKTANEQVMKSLLYAYRDRRAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A + ++RK+L+DLA+  L++F  +  +++ ++
Sbjct: 61  WIVRINAAARMNGLSYSKLMHGLKLADVNINRKMLADLAVNDLNAFNSLAAVAKEKI 117


>gi|283955668|ref|ZP_06373161.1| hypothetical protein C1336_000040079 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|283792893|gb|EFC31669.1| hypothetical protein C1336_000040079 [Campylobacter jejuni subsp.
           jejuni 1336]
          Length = 117

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 82/111 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GFY  R+   R AK  ++RS  YAYRDRR KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSLVYAYRDRRRKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+ DL+YS+FINGL KAGI LDRK+L+DLA+    +F KI E
Sbjct: 61  WIVRINAACRLNDLSYSRFINGLKKAGIELDRKILADLAMNDSAAFAKIAE 111


>gi|332367207|gb|EGJ44943.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK1059]
          Length = 119

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/106 (54%), Positives = 74/106 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+   ++F
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDAEAF 106


>gi|294056504|ref|YP_003550162.1| ribosomal protein L20 [Coraliomargarita akajimensis DSM 45221]
 gi|293615837|gb|ADE55992.1| ribosomal protein L20 [Coraliomargarita akajimensis DSM 45221]
          Length = 120

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 73/110 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R   G  + A+ KKVLK AKG++G +    R AK AVDR++ YAYRDRR KK +FR L
Sbjct: 1   MPRATNGPATLARRKKVLKKAKGYFGNKSRLFRYAKDAVDRAEVYAYRDRRKKKSEFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINA  R   +NYS+F+ G+  AGI +DRK LS+LAI    +F  ++
Sbjct: 61  WIVRINAICRANGINYSRFMRGIKAAGIEMDRKQLSELAIHDEPAFLALI 110


>gi|255087502|ref|XP_002505674.1| predicted protein [Micromonas sp. RCC299]
 gi|226520944|gb|ACO66932.1| predicted protein [Micromonas sp. RCC299]
          Length = 115

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 72/99 (72%)

Query: 13  KHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVY 72
           K +K+ K AKGF GR KNTIR A+  V+++ QYAYRDR+ KKRDFR LWIQ+INA  R +
Sbjct: 2   KAEKIFKLAKGFRGRAKNTIRIARNRVEKALQYAYRDRKAKKRDFRGLWIQQINAGTREH 61

Query: 73  DLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            + Y +FI+GL    I L+RK+L+DLA  +  SFK +V+
Sbjct: 62  GIGYGEFISGLKDENIQLNRKMLADLAQNEPYSFKALVD 100


>gi|50955432|ref|YP_062720.1| 50S ribosomal protein L20 [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|60390368|sp|Q6ADC9|RL20_LEIXX RecName: Full=50S ribosomal protein L20
 gi|50951914|gb|AAT89615.1| 50S ribosomal protein L20 [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 130

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A+G+ G+R    R AK  V  S  YAYRDRR KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAEGYRGQRSRLYRKAKEQVTHSLVYAYRDRRQKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +  +F  +VE ++  L  D
Sbjct: 61  WIQRINAASRANGLTYNRFIQGLGLAGVEVDRRILAELAVNEPATFTALVETAKKALPAD 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|317129888|ref|YP_004096170.1| ribosomal protein L20 [Bacillus cellulosilyticus DSM 2522]
 gi|315474836|gb|ADU31439.1| ribosomal protein L20 [Bacillus cellulosilyticus DSM 2522]
          Length = 119

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+ G +    ++A+  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGYVARRRRKKVLKLAKGYVGSKHRLFKSAQVQVMKSLLYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+Y++F++GL ++GI ++RK+L+D+AI    +F ++ E ++S L
Sbjct: 61  WITRINAAARINGLSYNRFMHGLKQSGIEMNRKMLADIAIHDEKAFAELAEKAKSGL 117


>gi|126698266|ref|YP_001087163.1| 50S ribosomal protein L20 [Clostridium difficile 630]
 gi|255099799|ref|ZP_05328776.1| 50S ribosomal protein L20 [Clostridium difficile QCD-63q42]
 gi|255305684|ref|ZP_05349856.1| 50S ribosomal protein L20 [Clostridium difficile ATCC 43255]
 gi|123066950|sp|Q189N4|RL20_CLOD6 RecName: Full=50S ribosomal protein L20
 gi|115249703|emb|CAJ67520.1| 50S ribosomal protein L20 [Clostridium difficile]
          Length = 118

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+ + +  KHKK+LK AKGF G R    R A   V ++ + AY  R++KKRDFR L
Sbjct: 1   MARVKKAMNARKKHKKILKLAKGFRGSRSKLYRPANTFVMKALKNAYIGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+  ++YS+ +NGL  +G+ ++RK+LS++AI   + F K+ E+++++L
Sbjct: 61  WIQRINAAARMNGISYSRLMNGLKLSGVEVNRKMLSEMAIQDPEGFAKLAEVAKAKL 117


>gi|329116076|ref|ZP_08244793.1| ribosomal protein L20 [Streptococcus parauberis NCFD 2020]
 gi|326906481|gb|EGE53395.1| ribosomal protein L20 [Streptococcus parauberis NCFD 2020]
          Length = 119

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV+  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVARKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+     F  + + ++++L
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVHDAAGFTALADAAKNKL 117


>gi|227537390|ref|ZP_03967439.1| ribosomal protein L20 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300772851|ref|ZP_07082720.1| 50S ribosomal protein L20 [Sphingobacterium spiritivorum ATCC
           33861]
 gi|227242768|gb|EEI92783.1| ribosomal protein L20 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300759022|gb|EFK55849.1| 50S ribosomal protein L20 [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 114

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+LK AKG+YG R      AK  V++  QYAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNAVASRRRRKKILKLAKGYYGSRSKVYTIAKNTVEKGLQYAYRDRKTKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R + ++YSQ I  L+   I L+RKVL+DLA+   D+FK +V+
Sbjct: 61  WIQRINAGSRQHGISYSQLIGKLNAKNIGLNRKVLADLALNNPDAFKAVVD 111


>gi|262341226|ref|YP_003284081.1| 50S ribosomal protein L20 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272563|gb|ACY40471.1| 50S ribosomal protein L20 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 117

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 77/111 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+L+SAKGFYG R      AK AV++S  YA+  R+ KKRDFRSL
Sbjct: 1   MPRSTNAVSSRRRRKKILRSAKGFYGSRSKVYTVAKNAVEKSFVYAFSGRKKKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA VR Y ++YS+F+  L    I ++RK+LSDL++ ++++ KK+V+
Sbjct: 61  WIQRINAGVRQYGMSYSEFMKKLSDNKIQINRKILSDLSMNEINNLKKLVD 111


>gi|257440570|ref|ZP_05616325.1| ribosomal protein L20 [Faecalibacterium prausnitzii A2-165]
 gi|257196893|gb|EEU95177.1| ribosomal protein L20 [Faecalibacterium prausnitzii A2-165]
          Length = 116

 Score =  110 bits (276), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K   ++  + KK+LK AKGFYG +    + AK  V +S  YA   RR+KKR FR+L
Sbjct: 1   MARIKGATMTHKRRKKMLKLAKGFYGCKSKHFKMAKQQVMKSGNYALAGRRMKKRQFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RIN AVR   +NYS F+ GL KAGI L+RK+LS++AI    SF  +VE
Sbjct: 61  WICRINNAVRPLGMNYSTFMAGLKKAGIELNRKMLSEMAINDPQSFAALVE 111


>gi|311115048|ref|YP_003986269.1| 50S ribosomal protein L20 [Gardnerella vaginalis ATCC 14019]
 gi|310946542|gb|ADP39246.1| 50S ribosomal protein L20 [Gardnerella vaginalis ATCC 14019]
          Length = 127

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLDRASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L++LA++ +++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAELAVSDVETFKAIVEAAKAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|29345835|ref|NP_809338.1| 50S ribosomal protein L20 [Bacteroides thetaiotaomicron VPI-5482]
 gi|153808046|ref|ZP_01960714.1| hypothetical protein BACCAC_02332 [Bacteroides caccae ATCC 43185]
 gi|160883807|ref|ZP_02064810.1| hypothetical protein BACOVA_01779 [Bacteroides ovatus ATCC 8483]
 gi|237716081|ref|ZP_04546562.1| 50S ribosomal protein L20 [Bacteroides sp. D1]
 gi|237722134|ref|ZP_04552615.1| 50S ribosomal protein L20 [Bacteroides sp. 2_2_4]
 gi|253567822|ref|ZP_04845233.1| 50S ribosomal protein L20 [Bacteroides sp. 1_1_6]
 gi|255692013|ref|ZP_05415688.1| ribosomal protein L20 [Bacteroides finegoldii DSM 17565]
 gi|260170787|ref|ZP_05757199.1| 50S ribosomal protein L20 [Bacteroides sp. D2]
 gi|262407693|ref|ZP_06084241.1| ribosomal protein L20 [Bacteroides sp. 2_1_22]
 gi|293372834|ref|ZP_06619212.1| ribosomal protein L20 [Bacteroides ovatus SD CMC 3f]
 gi|294643800|ref|ZP_06721598.1| ribosomal protein L20 [Bacteroides ovatus SD CC 2a]
 gi|294808461|ref|ZP_06767214.1| ribosomal protein L20 [Bacteroides xylanisolvens SD CC 1b]
 gi|298384719|ref|ZP_06994279.1| ribosomal protein L20 [Bacteroides sp. 1_1_14]
 gi|298480841|ref|ZP_06999036.1| ribosomal protein L20 [Bacteroides sp. D22]
 gi|299149169|ref|ZP_07042230.1| ribosomal protein L20 [Bacteroides sp. 3_1_23]
 gi|315919122|ref|ZP_07915362.1| 50S ribosomal protein L20 [Bacteroides sp. D2]
 gi|31563110|sp|Q8AAN9|RL20_BACTN RecName: Full=50S ribosomal protein L20
 gi|29337728|gb|AAO75532.1| 50S ribosomal protein L20 [Bacteroides thetaiotaomicron VPI-5482]
 gi|149129655|gb|EDM20869.1| hypothetical protein BACCAC_02332 [Bacteroides caccae ATCC 43185]
 gi|156110892|gb|EDO12637.1| hypothetical protein BACOVA_01779 [Bacteroides ovatus ATCC 8483]
 gi|229443728|gb|EEO49519.1| 50S ribosomal protein L20 [Bacteroides sp. D1]
 gi|229447944|gb|EEO53735.1| 50S ribosomal protein L20 [Bacteroides sp. 2_2_4]
 gi|251841895|gb|EES69975.1| 50S ribosomal protein L20 [Bacteroides sp. 1_1_6]
 gi|260622259|gb|EEX45130.1| ribosomal protein L20 [Bacteroides finegoldii DSM 17565]
 gi|262354501|gb|EEZ03593.1| ribosomal protein L20 [Bacteroides sp. 2_1_22]
 gi|292632209|gb|EFF50809.1| ribosomal protein L20 [Bacteroides ovatus SD CMC 3f]
 gi|292640889|gb|EFF59109.1| ribosomal protein L20 [Bacteroides ovatus SD CC 2a]
 gi|294444389|gb|EFG13103.1| ribosomal protein L20 [Bacteroides xylanisolvens SD CC 1b]
 gi|295085230|emb|CBK66753.1| LSU ribosomal protein L20P [Bacteroides xylanisolvens XB1A]
 gi|298262998|gb|EFI05862.1| ribosomal protein L20 [Bacteroides sp. 1_1_14]
 gi|298272864|gb|EFI14430.1| ribosomal protein L20 [Bacteroides sp. D22]
 gi|298512836|gb|EFI36724.1| ribosomal protein L20 [Bacteroides sp. 3_1_23]
 gi|313692997|gb|EFS29832.1| 50S ribosomal protein L20 [Bacteroides sp. D2]
          Length = 116

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 73/104 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+LK  +G++G RKN    AK   ++   YA+RDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKARRKKILKLTRGYFGARKNVWTVAKNTWEKGLTYAFRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLD 104
           WIQRINAA R+  ++YS+ + GLHKAGI ++RKVL+DLA+   +
Sbjct: 61  WIQRINAAARLEGMSYSKLMGGLHKAGIEINRKVLADLAMNHPE 104


>gi|183982464|ref|YP_001850755.1| 50S ribosomal protein L20 RplT [Mycobacterium marinum M]
 gi|226730425|sp|B2HR14|RL20_MYCMM RecName: Full=50S ribosomal protein L20
 gi|183175790|gb|ACC40900.1| 50S ribosomal protein L20 RplT [Mycobacterium marinum M]
          Length = 129

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSVLKASKGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+AIT   +F  +V+++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAITDPAAFTALVDVARAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|297617664|ref|YP_003702823.1| ribosomal protein L20 [Syntrophothermus lipocalidus DSM 12680]
 gi|297145501|gb|ADI02258.1| ribosomal protein L20 [Syntrophothermus lipocalidus DSM 12680]
          Length = 117

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  +HKK+LK AKG+ G +    R AK  V +S  YAY  RR+KKRDFR L
Sbjct: 1   MPRVKGGVTTHRRHKKILKLAKGYRGAKSKLFRVAKQQVMKSGNYAYIHRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+ + GL  AG+ ++RKVL+DLA+   D+F ++  L++  L
Sbjct: 61  WIARINAAARNNGISYSRMMFGLKVAGVGINRKVLADLAVNDPDAFSELAALAKKNL 117


>gi|257468674|ref|ZP_05632768.1| 50S ribosomal protein L20 [Fusobacterium ulcerans ATCC 49185]
 gi|317062929|ref|ZP_07927414.1| LSU ribosomal protein L20P [Fusobacterium ulcerans ATCC 49185]
 gi|313688605|gb|EFS25440.1| LSU ribosomal protein L20P [Fusobacterium ulcerans ATCC 49185]
          Length = 105

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 72/104 (69%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G+V   KHKK+L++AKGF G   + I+ AK A  ++  Y+ RDR+V KR  RSLWI
Sbjct: 2   RVKTGIVRRRKHKKILQAAKGFRGASGDVIKQAKQATMKAAAYSTRDRKVNKRRMRSLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
            RIN+A R+  L YS  INGL +AGIVLDRKVL+D+A+     F
Sbjct: 62  IRINSAARINGLTYSTLINGLKRAGIVLDRKVLADIALNNAAEF 105


>gi|254361943|ref|ZP_04978074.1| ribosomal protein L20 [Mannheimia haemolytica PHL213]
 gi|261493659|ref|ZP_05990178.1| 50S ribosomal protein L20 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261494326|ref|ZP_05990820.1| 50S ribosomal protein L20 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153093490|gb|EDN74470.1| ribosomal protein L20 [Mannheimia haemolytica PHL213]
 gi|261309975|gb|EEY11184.1| 50S ribosomal protein L20 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261310659|gb|EEY11843.1| 50S ribosomal protein L20 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 117

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVVKAAQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|237667040|ref|ZP_04527024.1| ribosomal protein L20 [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|237655388|gb|EEP52944.1| ribosomal protein L20 [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 118

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR   S   HKKVLK AKG+YG +    + A  +V R+ + AY  R+ KKRD+RSL
Sbjct: 1   MARVKRAKNSRKNHKKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRKNKKRDYRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ +++YS+F+NG+  AGI ++RK+LS++AI    +F ++VE ++  L
Sbjct: 61  WIARINAAARMNEMSYSKFMNGIKLAGIEINRKMLSEIAINDPKAFAELVETAKKAL 117


>gi|148381084|ref|YP_001255625.1| ribosomal protein L20 [Clostridium botulinum A str. ATCC 3502]
 gi|153933539|ref|YP_001385457.1| 50S ribosomal protein L20 [Clostridium botulinum A str. ATCC 19397]
 gi|153937482|ref|YP_001388864.1| 50S ribosomal protein L20 [Clostridium botulinum A str. Hall]
 gi|153939362|ref|YP_001392412.1| 50S ribosomal protein L20 [Clostridium botulinum F str. Langeland]
 gi|170757574|ref|YP_001782769.1| 50S ribosomal protein L20 [Clostridium botulinum B1 str. Okra]
 gi|170761601|ref|YP_001788454.1| 50S ribosomal protein L20 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|187776943|ref|ZP_02993416.1| hypothetical protein CLOSPO_00487 [Clostridium sporogenes ATCC
           15579]
 gi|226950565|ref|YP_002805656.1| ribosomal protein L20 [Clostridium botulinum A2 str. Kyoto]
 gi|237796591|ref|YP_002864143.1| 50S ribosomal protein L20 [Clostridium botulinum Ba4 str. 657]
 gi|166219632|sp|A7FY84|RL20_CLOB1 RecName: Full=50S ribosomal protein L20
 gi|166219633|sp|A5I6L5|RL20_CLOBH RecName: Full=50S ribosomal protein L20
 gi|166219634|sp|A7GI02|RL20_CLOBL RecName: Full=50S ribosomal protein L20
 gi|226730378|sp|B1IMV0|RL20_CLOBK RecName: Full=50S ribosomal protein L20
 gi|226730379|sp|B1L0T4|RL20_CLOBM RecName: Full=50S ribosomal protein L20
 gi|254800311|sp|C1FKM7|RL20_CLOBJ RecName: Full=50S ribosomal protein L20
 gi|259646177|sp|C3KTJ7|RL20_CLOB6 RecName: Full=50S ribosomal protein L20
 gi|148290568|emb|CAL84697.1| 50S ribosomal protein L20 [Clostridium botulinum A str. ATCC 3502]
 gi|152929583|gb|ABS35083.1| 50S ribosomal protein L20 [Clostridium botulinum A str. ATCC 19397]
 gi|152933396|gb|ABS38895.1| 50S ribosomal protein L20 [Clostridium botulinum A str. Hall]
 gi|152935258|gb|ABS40756.1| 50S ribosomal protein L20 [Clostridium botulinum F str. Langeland]
 gi|169122786|gb|ACA46622.1| 50S ribosomal protein L20 [Clostridium botulinum B1 str. Okra]
 gi|169408590|gb|ACA57001.1| 50S ribosomal protein L20 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|187775602|gb|EDU39404.1| hypothetical protein CLOSPO_00487 [Clostridium sporogenes ATCC
           15579]
 gi|226841255|gb|ACO83921.1| ribosomal protein L20 [Clostridium botulinum A2 str. Kyoto]
 gi|229263696|gb|ACQ54729.1| 50S ribosomal protein L20 [Clostridium botulinum Ba4 str. 657]
 gi|295320402|gb|ADG00780.1| 50S ribosomal protein L20 [Clostridium botulinum F str. 230613]
 gi|322807445|emb|CBZ05019.1| LSU ribosomal protein L20p [Clostridium botulinum H04402 065]
          Length = 119

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  +HKKVLK AKG+YG +    + A  +V R+ + AY  R++KKRD+R L
Sbjct: 1   MARVKRAMNARKRHKKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRKLKKRDYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NG+  AGI ++RK+LS++AI    +F ++V++++ +L
Sbjct: 61  WIARINAATRMNGLSYSKFMNGIKNAGIDINRKMLSEIAINDPKAFAELVDVAKKQL 117


>gi|148377740|ref|YP_001256616.1| 50S ribosomal protein L20 [Mycoplasma agalactiae PG2]
 gi|291320425|ref|YP_003515688.1| 50S ribosomal protein L20 [Mycoplasma agalactiae]
 gi|313678437|ref|YP_004056177.1| 50S ribosomal protein L20 [Mycoplasma bovis PG45]
 gi|226730424|sp|A5IYR6|RL20_MYCAP RecName: Full=50S ribosomal protein L20
 gi|148291786|emb|CAL59175.1| 50S ribosomal protein L20 [Mycoplasma agalactiae PG2]
 gi|290752759|emb|CBH40734.1| 50S ribosomal protein L20 [Mycoplasma agalactiae]
 gi|312950761|gb|ADR25356.1| ribosomal protein L20 [Mycoplasma bovis PG45]
          Length = 116

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 81/112 (72%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ KK +K AKG++G +    + AK AV +S  YA+RDR+  KRD+R LWI
Sbjct: 2   RVKGGTVTRARRKKWIKLAKGYFGHKSIGYKVAKQAVVKSWTYAFRDRKQVKRDYRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
            RI+AAVR+  L+YS+FINGL K+ I ++RK+LS+LAI +   F +++ ++R
Sbjct: 62  SRISAAVRLEGLSYSKFINGLKKSNITINRKMLSELAINEPQVFSQLIAIAR 113


>gi|284006264|emb|CBA71500.1| 50S ribosomal protein L20 [Arsenophonus nasoniae]
          Length = 118

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+LSD+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILSDIAVFDKVAFAALVEKAKSAL 117


>gi|295100357|emb|CBK97902.1| LSU ribosomal protein L20P [Faecalibacterium prausnitzii L2-6]
          Length = 116

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K   ++  + KK+LK AKGFYG +    + AK  V +S  YA   RR+KKR FR+L
Sbjct: 1   MARIKGATMTHKRRKKMLKLAKGFYGCKSKHFKMAKQQVMKSGNYALAGRRMKKRQFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RIN AVR   +NYS F+ GL KAGI L+RK+LS++AI    SF  +VE
Sbjct: 61  WICRINNAVRPLGMNYSSFMAGLKKAGIELNRKMLSEMAINDPKSFAALVE 111


>gi|332295140|ref|YP_004437063.1| 50S ribosomal protein L20 [Thermodesulfobium narugense DSM 14796]
 gi|332178243|gb|AEE13932.1| 50S ribosomal protein L20 [Thermodesulfobium narugense DSM 14796]
          Length = 115

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/108 (52%), Positives = 76/108 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVLK  KGF G      R A   +  + +YA+ DRR KKR+FRSLWI
Sbjct: 2   RVKGGFVTRRRHKKVLKMTKGFRGSLHKLYRTANQHLLHALKYAFVDRRRKKREFRSLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
            RINAAVR Y L+YS+F+N L K+G+ +DRKVL+ +A++  + FKK+V
Sbjct: 62  VRINAAVREYGLSYSKFMNALKKSGLDIDRKVLAQMALSYPEQFKKVV 109


>gi|326792019|ref|YP_004309840.1| ribosomal protein L20 [Clostridium lentocellum DSM 5427]
 gi|326542783|gb|ADZ84642.1| ribosomal protein L20 [Clostridium lentocellum DSM 5427]
          Length = 118

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  +  +VLK AKG+ G +    R AK AV +S  YAY  R+++KR+FR L
Sbjct: 1   MARVKGGMSTKKRRNRVLKLAKGYRGAKSKQFRTAKQAVMKSLNYAYVGRKLRKREFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL  A + ++RK+LS+LAIT   +F ++VE +++ L
Sbjct: 61  WIARINAAARLNGLSYSRFMNGLKNANVNINRKMLSELAITNPAAFTQLVETAKANL 117


>gi|19552597|ref|NP_600599.1| 50S ribosomal protein L20 [Corynebacterium glutamicum ATCC 13032]
 gi|62390265|ref|YP_225667.1| 50S ribosomal protein L20 [Corynebacterium glutamicum ATCC 13032]
 gi|145295516|ref|YP_001138337.1| 50S ribosomal protein L20 [Corynebacterium glutamicum R]
 gi|23822038|sp|Q8NQP6|RL20_CORGL RecName: Full=50S ribosomal protein L20
 gi|166219637|sp|A4QDY3|RL20_CORGB RecName: Full=50S ribosomal protein L20
 gi|21324148|dbj|BAB98773.1| Ribosomal protein L20 [Corynebacterium glutamicum ATCC 13032]
 gi|41325602|emb|CAF21391.1| 50S RIBOSOMAL PROTEIN L20 [Corynebacterium glutamicum ATCC 13032]
 gi|140845436|dbj|BAF54435.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 127

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++LKSAKG+ G+R    R AK     S  Y+YRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREILKSAKGYRGQRSRLYRKAKEQWLHSMTYSYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++ I GL  A I +DRK+L+DLA+    +F  I E +++ L  D
Sbjct: 61  WIQRINAAARMNGITYNRLIQGLRLAEIEVDRKILADLAVNDFATFSAICEAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|160945995|ref|ZP_02093221.1| hypothetical protein FAEPRAM212_03528 [Faecalibacterium prausnitzii
           M21/2]
 gi|313115004|ref|ZP_07800497.1| ribosomal protein L20 [Faecalibacterium cf. prausnitzii KLE1255]
 gi|158443726|gb|EDP20731.1| hypothetical protein FAEPRAM212_03528 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103247|emb|CBL00791.1| LSU ribosomal protein L20P [Faecalibacterium prausnitzii SL3/3]
 gi|310622695|gb|EFQ06157.1| ribosomal protein L20 [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 116

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K   ++  + KK+LK AKGFYG +    + AK  V +S  YA   RR+KKR FR+L
Sbjct: 1   MARIKGATMTHKRRKKMLKLAKGFYGCKSKHFKMAKQQVMKSGNYALAGRRMKKRQFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RIN AVR   +NYS F+ GL KAGI L+RK+LS++AI    SF  +VE
Sbjct: 61  WICRINNAVRPLGMNYSTFMAGLKKAGIELNRKMLSEMAINDPKSFAALVE 111


>gi|227485252|ref|ZP_03915568.1| ribosomal protein L20 [Anaerococcus lactolyticus ATCC 51172]
 gi|227236712|gb|EEI86727.1| ribosomal protein L20 [Anaerococcus lactolyticus ATCC 51172]
          Length = 117

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 77/114 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KR V +  +HKKVLK AKG+YG +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARIKRAVNAKKRHKKVLKQAKGYYGSKSLLFRTANQAVMKSLSYAYIGRKHRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R+   +YS+ + GL KA I ++RK+L++LA+   + F K+VE ++
Sbjct: 61  WIARINAAARLNGTSYSKLMGGLKKANIDINRKMLAELAVNSPEEFAKLVEAAK 114


>gi|88855452|ref|ZP_01130116.1| 50S ribosomal protein L20 [marine actinobacterium PHSC20C1]
 gi|88815359|gb|EAR25217.1| 50S ribosomal protein L20 [marine actinobacterium PHSC20C1]
          Length = 128

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ AKG+ G+R    R AK  V  S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAKGYRGQRSRLYRKAKEQVTHSLVYAYRDRRARKGEFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL+ AG+ +DR++L+DLA+T+  +F  +V  +++ L  D
Sbjct: 61  WIQRINAASRANGLTYNRLIQGLNLAGVQVDRRILADLAVTEPATFASLVATAKAALPAD 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|170016927|ref|YP_001727846.1| ribosomal protein L20 [Leuconostoc citreum KM20]
 gi|215274801|sp|B1MY00|RL20_LEUCK RecName: Full=50S ribosomal protein L20
 gi|169803784|gb|ACA82402.1| Ribosomal protein L20 [Leuconostoc citreum KM20]
          Length = 139

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 84/118 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G VS A+ KK++K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVSRARRKKMVKLAKGYRGQRRINFKVAKQQVWKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG+ L+RK+L+++A+T  D+F K+ + +++ L  D
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGVELNRKMLAEIAVTDFDTFAKLADQAKAALASD 119


>gi|113461018|ref|YP_719085.1| 50S ribosomal protein L20 [Haemophilus somnus 129PT]
 gi|170717590|ref|YP_001784674.1| 50S ribosomal protein L20 [Haemophilus somnus 2336]
 gi|123132111|sp|Q0I3J1|RL20_HAES1 RecName: Full=50S ribosomal protein L20
 gi|189041867|sp|B0UU75|RL20_HAES2 RecName: Full=50S ribosomal protein L20
 gi|112823061|gb|ABI25150.1| LSU ribosomal protein L20P [Haemophilus somnus 129PT]
 gi|168825719|gb|ACA31090.1| ribosomal protein L20 [Haemophilus somnus 2336]
          Length = 117

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAATRQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKSAL 117


>gi|50365006|ref|YP_053431.1| 50S ribosomal protein L20 [Mesoplasma florum L1]
 gi|60390405|sp|Q6F1S6|RL20_MESFL RecName: Full=50S ribosomal protein L20
 gi|50363562|gb|AAT75547.1| 50S ribosomal protein L20 [Mesoplasma florum L1]
          Length = 120

 Score =  110 bits (274), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ K+ +K AKG+YG + ++ + A   V RS  YA+  R+ KKRDFR L
Sbjct: 1   MARVKFGKVTRARRKRWIKRAKGYYGTKHSSYKKAHEQVVRSMAYAFIGRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR Y L+YS+F+NGL  A I ++RK+LS+LAI+  + FK +V+ S   L
Sbjct: 61  WIVRINAAVRPYGLSYSKFMNGLKLANIDVNRKMLSELAISNPEQFKLLVDASNKAL 117


>gi|56964452|ref|YP_176183.1| 50S ribosomal protein L20 [Bacillus clausii KSM-K16]
 gi|60390297|sp|Q5WEI8|RL20_BACSK RecName: Full=50S ribosomal protein L20
 gi|56910695|dbj|BAD65222.1| 50S ribosomal protein L20 [Bacillus clausii KSM-K16]
          Length = 119

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    ++A+  V +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYVARRRRKKVLKLAKGYYGSKHTLFKSAQGQVMKSLQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F ++ + ++  L
Sbjct: 61  WITRINAAARLNGLSYSRLMHGLKLAEINVNRKMLADLAVNDEKAFAQLADKAKESL 117


>gi|294501486|ref|YP_003565186.1| 50S ribosomal protein L20 [Bacillus megaterium QM B1551]
 gi|295706834|ref|YP_003599909.1| 50S ribosomal protein L20 [Bacillus megaterium DSM 319]
 gi|294351423|gb|ADE71752.1| 50S ribosomal protein L20 [Bacillus megaterium QM B1551]
 gi|294804493|gb|ADF41559.1| 50S ribosomal protein L20 [Bacillus megaterium DSM 319]
          Length = 119

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKGF+G +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGFFGSKHRLYKVANQQVMKSHMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++   ++  L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLAGIEVNRKMLADLAVADEKAFAELATAAKKGL 117


>gi|269123272|ref|YP_003305849.1| 50S ribosomal protein L20 [Streptobacillus moniliformis DSM 12112]
 gi|268314598|gb|ACZ00972.1| ribosomal protein L20 [Streptobacillus moniliformis DSM 12112]
          Length = 116

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 73/115 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   KHKKVL  AKG+ G  K   + A  AV ++  YA   R++KKR  R L
Sbjct: 1   MPRVKTGIVRRKKHKKVLSEAKGYRGSTKTNYKKANEAVKKAMAYATEHRKLKKRTMREL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R   L+YS+F+NGL K  I LDRKVL++LA+     FK +VE  +S
Sbjct: 61  WIIRINAATRAEGLSYSKFMNGLKKLNIELDRKVLAELALNNSVEFKALVEKVKS 115


>gi|16273230|ref|NP_439471.1| 50S ribosomal protein L20 [Haemophilus influenzae Rd KW20]
 gi|32034415|ref|ZP_00134597.1| COG0292: Ribosomal protein L20 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|52425111|ref|YP_088248.1| 50S ribosomal protein L20 [Mannheimia succiniciproducens MBEL55E]
 gi|68249989|ref|YP_249101.1| 50S ribosomal protein L20 [Haemophilus influenzae 86-028NP]
 gi|126207713|ref|YP_001052938.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae L20]
 gi|145629399|ref|ZP_01785197.1| 50S ribosomal protein L20 [Haemophilus influenzae 22.1-21]
 gi|145630793|ref|ZP_01786571.1| 50S ribosomal protein L20 [Haemophilus influenzae R3021]
 gi|145633195|ref|ZP_01788926.1| 50S ribosomal protein L20 [Haemophilus influenzae 3655]
 gi|145634938|ref|ZP_01790645.1| 50S ribosomal protein L20 [Haemophilus influenzae PittAA]
 gi|145636196|ref|ZP_01791866.1| 50S ribosomal protein L20 [Haemophilus influenzae PittHH]
 gi|145638899|ref|ZP_01794507.1| 50S ribosomal protein L20 [Haemophilus influenzae PittII]
 gi|145641652|ref|ZP_01797229.1| 50S ribosomal protein L20 [Haemophilus influenzae R3021]
 gi|148826023|ref|YP_001290776.1| 50S ribosomal protein L20 [Haemophilus influenzae PittEE]
 gi|148826977|ref|YP_001291730.1| 50S ribosomal protein L20 [Haemophilus influenzae PittGG]
 gi|165975681|ref|YP_001651274.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|229845143|ref|ZP_04465278.1| 50S ribosomal protein L20 [Haemophilus influenzae 6P18H1]
 gi|229847479|ref|ZP_04467576.1| 50S ribosomal protein L20 [Haemophilus influenzae 7P49H1]
 gi|260581333|ref|ZP_05849149.1| ribosomal protein L20 [Haemophilus influenzae RdAW]
 gi|260582455|ref|ZP_05850246.1| ribosomal protein L20 [Haemophilus influenzae NT127]
 gi|260914008|ref|ZP_05920482.1| inorganic diphosphatase [Pasteurella dagmatis ATCC 43325]
 gi|303251653|ref|ZP_07337826.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303252804|ref|ZP_07338964.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307245037|ref|ZP_07527132.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307247210|ref|ZP_07529260.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307249438|ref|ZP_07531427.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307251755|ref|ZP_07533658.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307253991|ref|ZP_07535840.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307256251|ref|ZP_07538036.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307258446|ref|ZP_07540185.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307260683|ref|ZP_07542373.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307262815|ref|ZP_07544440.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|315634194|ref|ZP_07889483.1| inorganic diphosphatase [Aggregatibacter segnis ATCC 33393]
 gi|319776262|ref|YP_004138750.1| 50S ribosomal subunit protein L20 [Haemophilus influenzae F3047]
 gi|319897108|ref|YP_004135303.1| 50S ribosomal subunit protein l20 [Haemophilus influenzae F3031]
 gi|322514761|ref|ZP_08067786.1| inorganic pyrophosphatase [Actinobacillus ureae ATCC 25976]
 gi|325578414|ref|ZP_08148549.1| inorganic pyrophosphatase [Haemophilus parainfluenzae ATCC 33392]
 gi|329123402|ref|ZP_08251966.1| inorganic pyrophosphatase [Haemophilus aegyptius ATCC 11116]
 gi|1172988|sp|P44358|RL20_HAEIN RecName: Full=50S ribosomal protein L20
 gi|60390342|sp|Q65TP7|RL20_MANSM RecName: Full=50S ribosomal protein L20
 gi|81335587|sp|Q4QKK6|RL20_HAEI8 RecName: Full=50S ribosomal protein L20
 gi|166219601|sp|A3MYU7|RL20_ACTP2 RecName: Full=50S ribosomal protein L20
 gi|166219649|sp|A5UC92|RL20_HAEIE RecName: Full=50S ribosomal protein L20
 gi|166219650|sp|A5UEZ1|RL20_HAEIG RecName: Full=50S ribosomal protein L20
 gi|226730345|sp|B0BSM8|RL20_ACTPJ RecName: Full=50S ribosomal protein L20
 gi|1574780|gb|AAC22965.1| ribosomal protein L20 (rpL20) [Haemophilus influenzae Rd KW20]
 gi|52307163|gb|AAU37663.1| RplT protein [Mannheimia succiniciproducens MBEL55E]
 gi|68058188|gb|AAX88441.1| 50S ribosomal protein L20 [Haemophilus influenzae 86-028NP]
 gi|126096505|gb|ABN73333.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|144978242|gb|EDJ88006.1| 50S ribosomal protein L20 [Haemophilus influenzae 22.1-21]
 gi|144983675|gb|EDJ91135.1| 50S ribosomal protein L20 [Haemophilus influenzae R3021]
 gi|144986041|gb|EDJ92631.1| 50S ribosomal protein L20 [Haemophilus influenzae 3655]
 gi|145267804|gb|EDK07801.1| 50S ribosomal protein L20 [Haemophilus influenzae PittAA]
 gi|145270718|gb|EDK10651.1| 50S ribosomal protein L20 [Haemophilus influenzae PittHH]
 gi|145271871|gb|EDK11780.1| 50S ribosomal protein L20 [Haemophilus influenzae PittII]
 gi|145273699|gb|EDK13568.1| 50S ribosomal protein L20 [Haemophilus influenzae 22.4-21]
 gi|148716183|gb|ABQ98393.1| 50S ribosomal protein L20 [Haemophilus influenzae PittEE]
 gi|148718219|gb|ABQ99346.1| 50S ribosomal protein L20 [Haemophilus influenzae PittGG]
 gi|165875782|gb|ABY68830.1| ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|229809620|gb|EEP45347.1| 50S ribosomal protein L20 [Haemophilus influenzae 7P49H1]
 gi|229811979|gb|EEP47673.1| 50S ribosomal protein L20 [Haemophilus influenzae 6P18H1]
 gi|260092000|gb|EEW75947.1| ribosomal protein L20 [Haemophilus influenzae RdAW]
 gi|260094435|gb|EEW78332.1| ribosomal protein L20 [Haemophilus influenzae NT127]
 gi|260632095|gb|EEX50272.1| inorganic diphosphatase [Pasteurella dagmatis ATCC 43325]
 gi|301156310|emb|CBW15781.1| 50S ribosomal subunit protein L20 [Haemophilus parainfluenzae T3T1]
 gi|301170068|emb|CBW29672.1| 50S ribosomal subunit protein L20 [Haemophilus influenzae 10810]
 gi|302648365|gb|EFL78561.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302649495|gb|EFL79678.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306854061|gb|EFM86271.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306856268|gb|EFM88421.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306858512|gb|EFM90579.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306860756|gb|EFM92766.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306863054|gb|EFM94999.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306865250|gb|EFM97148.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306867488|gb|EFM99337.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306869604|gb|EFN01391.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306871830|gb|EFN03549.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|309750875|gb|ADO80859.1| 50S ribosomal protein L20 [Haemophilus influenzae R2866]
 gi|309973158|gb|ADO96359.1| 50S ribosomal protein L20 [Haemophilus influenzae R2846]
 gi|315477444|gb|EFU68187.1| inorganic diphosphatase [Aggregatibacter segnis ATCC 33393]
 gi|317432612|emb|CBY80973.1| 50S ribosomal subunit protein L20 [Haemophilus influenzae F3031]
 gi|317450853|emb|CBY87077.1| 50S ribosomal subunit protein L20 [Haemophilus influenzae F3047]
 gi|322119299|gb|EFX91419.1| inorganic pyrophosphatase [Actinobacillus ureae ATCC 25976]
 gi|325160150|gb|EGC72279.1| inorganic pyrophosphatase [Haemophilus parainfluenzae ATCC 33392]
 gi|327470984|gb|EGF16439.1| inorganic pyrophosphatase [Haemophilus aegyptius ATCC 11116]
          Length = 117

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|320093953|ref|ZP_08025782.1| inorganic diphosphatase [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319979111|gb|EFW10625.1| inorganic diphosphatase [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 126

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDR+ +K DFR L
Sbjct: 1   MARVKRSVNAKKKRRTVLEQASGYRGQRSRMYRKAKEQVTHSFVYAYRDRKARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL+ AG+ +DR++L++LA+ +  +F  +V++++  L  D
Sbjct: 61  WIQRINAASRAEGLTYNRFIQGLNLAGVEVDRRMLAELAVNEPAAFTALVKVAKEALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|15602469|ref|NP_245541.1| 50S ribosomal protein L20 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|14195120|sp|Q9CN41|RL20_PASMU RecName: Full=50S ribosomal protein L20
 gi|12720875|gb|AAK02688.1| RpL20 [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 117

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKSAL 117


>gi|325266385|ref|ZP_08133063.1| inorganic pyrophosphatase [Kingella denitrificans ATCC 33394]
 gi|324982178|gb|EGC17812.1| inorganic pyrophosphatase [Kingella denitrificans ATCC 33394]
          Length = 118

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  A G+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHKKVIALATGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL +A I LDRKVL+DLA+    +F ++VE +++ L
Sbjct: 61  WIARINAGARQNGLSYSKFMNGLKRAAIELDRKVLADLAVFDKPAFAQLVEKAKAAL 117


>gi|251792480|ref|YP_003007206.1| 50S ribosomal protein L20 [Aggregatibacter aphrophilus NJ8700]
 gi|247533873|gb|ACS97119.1| ribosomal protein L20 [Aggregatibacter aphrophilus NJ8700]
          Length = 117

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLRKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|303232510|ref|ZP_07319197.1| ribosomal protein L20 [Atopobium vaginae PB189-T1-4]
 gi|302481394|gb|EFL44467.1| ribosomal protein L20 [Atopobium vaginae PB189-T1-4]
          Length = 118

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 75/117 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR +    K + +++ +KG+YG    T R  K  V  S QYAYRDRR KKR+ R L
Sbjct: 1   MARVKRAMAGRKKRQTLVERSKGYYGVGSRTFRGMKEQVQHSLQYAYRDRRTKKREIRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA RV  L+YS F++GL  AG+ LDRKVL+ +A     +F  + E+++  L
Sbjct: 61  WIQRINAAARVNGLSYSTFMHGLKLAGVELDRKVLAQIAYEDEATFADLAEVAKKAL 117


>gi|293392220|ref|ZP_06636554.1| 50S ribosomal protein L20 [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952754|gb|EFE02873.1| 50S ribosomal protein L20 [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 117

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQSGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|288553674|ref|YP_003425609.1| 50S ribosomal protein L20 [Bacillus pseudofirmus OF4]
 gi|288544834|gb|ADC48717.1| 50S ribosomal protein L20 [Bacillus pseudofirmus OF4]
          Length = 119

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    ++A+  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYVARRRRKKVLKLAKGYFGSKHLLFKSAQGQVMKSLLYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+   ++F ++ E ++S L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLAEINVNRKILADLAVNDAEAFAQLAEKAKSSL 117


>gi|229087129|ref|ZP_04219279.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-44]
 gi|228696197|gb|EEL49032.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-44]
          Length = 118

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKNTLFKVANQQVMKSLMYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++   +++ L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKNAGIEVNRKMLADLAVHDEKAFAELATAAKNNL 117


>gi|114566619|ref|YP_753773.1| 50S ribosomal protein L20 [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122318330|sp|Q0AY02|RL20_SYNWW RecName: Full=50S ribosomal protein L20
 gi|114337554|gb|ABI68402.1| LSU ribosomal protein L20P [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 118

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 76/114 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV S  +HKK+LK AKG+ G +    R A   V +S QYAY  RR+KKRDFR L
Sbjct: 1   MPRVKGGVTSHKRHKKILKLAKGYRGSKSKLYRVANEQVMKSGQYAYIHRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R     YS+ ++GL  AG+ ++RK+L++LAI+    F ++ EL++
Sbjct: 61  WIARINAAARNNGTTYSRMVHGLKVAGVDINRKLLAELAISDPQGFTQLAELAK 114


>gi|322383964|ref|ZP_08057694.1| 50S ribosomal protein L20-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321151441|gb|EFX44628.1| 50S ribosomal protein L20-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 119

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G ++  +HKKVLK AKG++G +    + A A V +S  YAYRDRR +KRDFR L
Sbjct: 1   MARVKGGFITRRRHKKVLKLAKGYFGSKHRIFKTANAQVMKSLLYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+ ++GL  AGI ++RK+L+DLA+    +F  +   ++ ++
Sbjct: 61  WITRINAAARMNGISYSKMMHGLKLAGIEVNRKMLADLAVNDAKAFADLANAAKQKV 117


>gi|34540734|ref|NP_905213.1| 50S ribosomal protein L20 [Porphyromonas gingivalis W83]
 gi|39931716|sp|Q7MVQ8|RL20_PORGI RecName: Full=50S ribosomal protein L20
 gi|34397048|gb|AAQ66112.1| ribosomal protein L20 [Porphyromonas gingivalis W83]
          Length = 115

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYFGARKNVWTVAKNTWEKGLTYAYRDRKSKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  ++YS+ +  LH  GI ++RKVL+DLA+   ++F+ IV
Sbjct: 61  WIQRINAAARLEGMSYSRLMGALHANGIEINRKVLADLAMNHPEAFRAIV 110


>gi|24379170|ref|NP_721125.1| 50S ribosomal protein L20 [Streptococcus mutans UA159]
 gi|290580826|ref|YP_003485218.1| 50S ribosomal protein L20 [Streptococcus mutans NN2025]
 gi|31563128|sp|Q8DV20|RL20_STRMU RecName: Full=50S ribosomal protein L20
 gi|24377078|gb|AAN58431.1|AE014913_8 50S ribosomal protein L20 [Streptococcus mutans UA159]
 gi|254997725|dbj|BAH88326.1| 50S ribosomal protein L20 [Streptococcus mutans NN2025]
          Length = 119

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR +KRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ ++GL  A + ++RK+L+DLA+    +F  + + ++ +L
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEVEVNRKMLADLAVNDAAAFTVLADAAKEKL 117


>gi|28211882|ref|NP_782826.1| 50S ribosomal protein L20 [Clostridium tetani E88]
 gi|31563101|sp|Q891T2|RL20_CLOTE RecName: Full=50S ribosomal protein L20
 gi|28204324|gb|AAO36763.1| LSU ribosomal protein L20P [Clostridium tetani E88]
          Length = 119

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  KHKK+LK +KG++G +    + A  +V R+ + AY  R++KKRD+R L
Sbjct: 1   MARVKRAMNARKKHKKILKLSKGYFGGKSRLFKTANESVIRALRNAYTGRKLKKRDYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+F+NGL  AGI ++RK+LS++AI    +F ++VE ++ +L
Sbjct: 61  WIARINAATRANGLSYSRFMNGLKLAGIDMNRKMLSEIAINDPKAFSELVEAAKKQL 117


>gi|172040801|ref|YP_001800515.1| 50S ribosomal protein L20 [Corynebacterium urealyticum DSM 7109]
 gi|226730380|sp|B1VH40|RL20_CORU7 RecName: Full=50S ribosomal protein L20
 gi|171852105|emb|CAQ05081.1| 50S ribosomal protein L20 [Corynebacterium urealyticum DSM 7109]
          Length = 127

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL SAKG+ G+R    R AK  +  S+ YA+RDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREVLNSAKGYRGQRSRLYRKAKEQMLHSKTYAFRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R  D+ Y++ I GL  A I +DRKVL++LA++   +F  + E +++ L  D
Sbjct: 61  WIQRINAAARQNDMTYNRLIQGLKLAEIEVDRKVLAELAVSDAAAFTALCEAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|152979112|ref|YP_001344741.1| ribosomal protein L20 [Actinobacillus succinogenes 130Z]
 gi|171704304|sp|A6VPA9|RL20_ACTSZ RecName: Full=50S ribosomal protein L20
 gi|150840835|gb|ABR74806.1| ribosomal protein L20 [Actinobacillus succinogenes 130Z]
          Length = 117

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNSLSYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKSVL 117


>gi|300858364|ref|YP_003783347.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|300685818|gb|ADK28740.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302206079|gb|ADL10421.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis C231]
 gi|308276317|gb|ADO26216.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis I19]
          Length = 127

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K +++LK+AKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSLNAKKKRREILKAAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  A I +DRKVL+DLA+    +F  I E +++ L  D
Sbjct: 61  WITRINAAARMNDITYNRLIQGLRLAEIEVDRKVLADLAVNDFAAFSAICEAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|254821222|ref|ZP_05226223.1| 50S ribosomal protein L20 [Mycobacterium intracellulare ATCC 13950]
          Length = 131

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK++KG+ G+R    R AK     S QYAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSILKASKGYRGQRSRLYRKAKEQQLHSLQYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+A+    +F  +V+++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAVADPAAFTALVDIARAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|304439757|ref|ZP_07399655.1| 50S ribosomal protein L20 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371744|gb|EFM25352.1| 50S ribosomal protein L20 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 114

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 77/114 (67%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVKRGV +  +HKK+LK AKG++G +    R A  AV +S  Y +  R+ +KRDFR LW
Sbjct: 1   MRVKRGVNAKKRHKKILKQAKGYFGAKSKLFRPANQAVMKSLNYQFFGRKQRKRDFRQLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           I RINAA R   ++YS+FI GL K  + ++RK+LS++AI     F K+VEL+++
Sbjct: 61  IARINAACRQNGMSYSKFIAGLKKHEVEINRKMLSEIAINDPQGFAKLVELAKN 114


>gi|320547005|ref|ZP_08041306.1| 50S ribosomal protein L20 [Streptococcus equinus ATCC 9812]
 gi|320448407|gb|EFW89149.1| 50S ribosomal protein L20 [Streptococcus equinus ATCC 9812]
          Length = 119

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 73/106 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+    +F
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDATAF 106


>gi|302342266|ref|YP_003806795.1| ribosomal protein L20 [Desulfarculus baarsii DSM 2075]
 gi|301638879|gb|ADK84201.1| ribosomal protein L20 [Desulfarculus baarsii DSM 2075]
          Length = 116

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R KRG  +  +  K++K AKG  G R+   R AK  V R   YAYRDR+V+KR+FR L
Sbjct: 1   MPRAKRGFKARRRRNKIMKLAKGNVGGRRKLFRTAKETVHRGLVYAYRDRKVRKREFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAAVR + LNYS+FI GL KA + LDRKVL+DLA++
Sbjct: 61  WIVRINAAVREHGLNYSRFIYGLGKANVELDRKVLADLAVS 101


>gi|30022648|ref|NP_834279.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 14579]
 gi|30264643|ref|NP_847020.1| 50S ribosomal protein L20 [Bacillus anthracis str. Ames]
 gi|42783750|ref|NP_980997.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 10987]
 gi|47530114|ref|YP_021463.1| 50S ribosomal protein L20 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49187464|ref|YP_030716.1| 50S ribosomal protein L20 [Bacillus anthracis str. Sterne]
 gi|49481332|ref|YP_038619.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52140932|ref|YP_085894.1| 50S ribosomal protein L20 [Bacillus cereus E33L]
 gi|65321941|ref|ZP_00394900.1| COG0292: Ribosomal protein L20 [Bacillus anthracis str. A2012]
 gi|118479721|ref|YP_896872.1| 50S ribosomal protein L20 [Bacillus thuringiensis str. Al Hakam]
 gi|165871477|ref|ZP_02216124.1| ribosomal protein L20 [Bacillus anthracis str. A0488]
 gi|167641572|ref|ZP_02399819.1| ribosomal protein L20 [Bacillus anthracis str. A0193]
 gi|170708680|ref|ZP_02899118.1| ribosomal protein L20 [Bacillus anthracis str. A0389]
 gi|177653145|ref|ZP_02935432.1| ribosomal protein L20 [Bacillus anthracis str. A0174]
 gi|190569443|ref|ZP_03022323.1| ribosomal protein L20 [Bacillus anthracis Tsiankovskii-I]
 gi|196034550|ref|ZP_03101959.1| ribosomal protein L20 [Bacillus cereus W]
 gi|196047727|ref|ZP_03114929.1| ribosomal protein L20 [Bacillus cereus 03BB108]
 gi|206969475|ref|ZP_03230429.1| 50S ribosomal protein L20 [Bacillus cereus AH1134]
 gi|217962052|ref|YP_002340622.1| 50S ribosomal protein L20 [Bacillus cereus AH187]
 gi|218234716|ref|YP_002369368.1| 50S ribosomal protein L20 [Bacillus cereus B4264]
 gi|218899726|ref|YP_002448137.1| ribosomal protein L20 [Bacillus cereus G9842]
 gi|218905800|ref|YP_002453634.1| ribosomal protein L20 [Bacillus cereus AH820]
 gi|222098035|ref|YP_002532092.1| 50S ribosomal protein l20 [Bacillus cereus Q1]
 gi|225866550|ref|YP_002751928.1| 50S ribosomal protein L20 [Bacillus cereus 03BB102]
 gi|227817357|ref|YP_002817366.1| 50S ribosomal protein L20 [Bacillus anthracis str. CDC 684]
 gi|228903090|ref|ZP_04067226.1| 50S ribosomal protein L20 [Bacillus thuringiensis IBL 4222]
 gi|228910396|ref|ZP_04074211.1| 50S ribosomal protein L20 [Bacillus thuringiensis IBL 200]
 gi|228917212|ref|ZP_04080769.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228923316|ref|ZP_04086604.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228929620|ref|ZP_04092638.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935880|ref|ZP_04098690.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228941751|ref|ZP_04104298.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228948298|ref|ZP_04110581.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228954841|ref|ZP_04116861.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228960841|ref|ZP_04122476.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228967669|ref|ZP_04128690.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228974675|ref|ZP_04135241.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228981269|ref|ZP_04141569.1| 50S ribosomal protein L20 [Bacillus thuringiensis Bt407]
 gi|228987820|ref|ZP_04147929.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229019797|ref|ZP_04176600.1| 50S ribosomal protein L20 [Bacillus cereus AH1273]
 gi|229027590|ref|ZP_04183808.1| 50S ribosomal protein L20 [Bacillus cereus AH1272]
 gi|229048280|ref|ZP_04193848.1| 50S ribosomal protein L20 [Bacillus cereus AH676]
 gi|229072074|ref|ZP_04205283.1| 50S ribosomal protein L20 [Bacillus cereus F65185]
 gi|229076075|ref|ZP_04209043.1| 50S ribosomal protein L20 [Bacillus cereus Rock4-18]
 gi|229081825|ref|ZP_04214317.1| 50S ribosomal protein L20 [Bacillus cereus Rock4-2]
 gi|229093670|ref|ZP_04224770.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-42]
 gi|229099034|ref|ZP_04229968.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-29]
 gi|229105200|ref|ZP_04235849.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-28]
 gi|229112037|ref|ZP_04241580.1| 50S ribosomal protein L20 [Bacillus cereus Rock1-15]
 gi|229118064|ref|ZP_04247423.1| 50S ribosomal protein L20 [Bacillus cereus Rock1-3]
 gi|229124139|ref|ZP_04253331.1| 50S ribosomal protein L20 [Bacillus cereus 95/8201]
 gi|229129856|ref|ZP_04258822.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-Cer4]
 gi|229141298|ref|ZP_04269836.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST26]
 gi|229147131|ref|ZP_04275490.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST24]
 gi|229152767|ref|ZP_04280950.1| 50S ribosomal protein L20 [Bacillus cereus m1550]
 gi|229158176|ref|ZP_04286243.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 4342]
 gi|229163564|ref|ZP_04291514.1| 50S ribosomal protein L20 [Bacillus cereus R309803]
 gi|229186829|ref|ZP_04313984.1| 50S ribosomal protein L20 [Bacillus cereus BGSC 6E1]
 gi|229192773|ref|ZP_04319731.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 10876]
 gi|229198721|ref|ZP_04325419.1| 50S ribosomal protein L20 [Bacillus cereus m1293]
 gi|229602516|ref|YP_002868852.1| 50S ribosomal protein L20 [Bacillus anthracis str. A0248]
 gi|254686934|ref|ZP_05150792.1| 50S ribosomal protein L20 [Bacillus anthracis str. CNEVA-9066]
 gi|254724498|ref|ZP_05186281.1| 50S ribosomal protein L20 [Bacillus anthracis str. A1055]
 gi|254736681|ref|ZP_05194387.1| 50S ribosomal protein L20 [Bacillus anthracis str. Western North
           America USA6153]
 gi|254741719|ref|ZP_05199406.1| 50S ribosomal protein L20 [Bacillus anthracis str. Kruger B]
 gi|254754684|ref|ZP_05206719.1| 50S ribosomal protein L20 [Bacillus anthracis str. Vollum]
 gi|254757516|ref|ZP_05209543.1| 50S ribosomal protein L20 [Bacillus anthracis str. Australia 94]
 gi|296505046|ref|YP_003666746.1| 50S ribosomal protein L20 [Bacillus thuringiensis BMB171]
 gi|301056079|ref|YP_003794290.1| 50S ribosomal protein L20 [Bacillus anthracis CI]
 gi|39931863|sp|Q817H7|RL20_BACCR RecName: Full=50S ribosomal protein L20
 gi|39931870|sp|Q81L17|RL20_BACAN RecName: Full=50S ribosomal protein L20
 gi|60390325|sp|Q633M3|RL20_BACCZ RecName: Full=50S ribosomal protein L20
 gi|60390444|sp|Q6HCV7|RL20_BACHK RecName: Full=50S ribosomal protein L20
 gi|60390502|sp|Q72ZG4|RL20_BACC1 RecName: Full=50S ribosomal protein L20
 gi|166219607|sp|A0RJH2|RL20_BACAH RecName: Full=50S ribosomal protein L20
 gi|226730352|sp|B7JR80|RL20_BACC0 RecName: Full=50S ribosomal protein L20
 gi|226730353|sp|B7IJX1|RL20_BACC2 RecName: Full=50S ribosomal protein L20
 gi|226730354|sp|B7HF86|RL20_BACC4 RecName: Full=50S ribosomal protein L20
 gi|226730355|sp|B7HRL2|RL20_BACC7 RecName: Full=50S ribosomal protein L20
 gi|254800296|sp|C3PAG2|RL20_BACAA RecName: Full=50S ribosomal protein L20
 gi|254800297|sp|C3L8V1|RL20_BACAC RecName: Full=50S ribosomal protein L20
 gi|254800298|sp|C1EUR7|RL20_BACC3 RecName: Full=50S ribosomal protein L20
 gi|254800299|sp|B9J073|RL20_BACCQ RecName: Full=50S ribosomal protein L20
 gi|29898206|gb|AAP11480.1| LSU ribosomal protein L20P [Bacillus cereus ATCC 14579]
 gi|30259318|gb|AAP28506.1| 50S ribosomal protein L20 [Bacillus anthracis str. Ames]
 gi|42739680|gb|AAS43605.1| ribosomal protein L20 [Bacillus cereus ATCC 10987]
 gi|47505262|gb|AAT33938.1| ribosomal protein L20 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49181391|gb|AAT56767.1| ribosomal protein L20 [Bacillus anthracis str. Sterne]
 gi|49332888|gb|AAT63534.1| ribosomal protein L20 (50S ribosomal protein L20) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51974401|gb|AAU15951.1| ribosomal protein L20 (50S ribosomal protein L20) [Bacillus cereus
           E33L]
 gi|118418946|gb|ABK87365.1| LSU ribosomal protein L20P [Bacillus thuringiensis str. Al Hakam]
 gi|164712774|gb|EDR18304.1| ribosomal protein L20 [Bacillus anthracis str. A0488]
 gi|167510457|gb|EDR85856.1| ribosomal protein L20 [Bacillus anthracis str. A0193]
 gi|170126360|gb|EDS95249.1| ribosomal protein L20 [Bacillus anthracis str. A0389]
 gi|172081669|gb|EDT66740.1| ribosomal protein L20 [Bacillus anthracis str. A0174]
 gi|190559448|gb|EDV13453.1| ribosomal protein L20 [Bacillus anthracis Tsiankovskii-I]
 gi|195993092|gb|EDX57051.1| ribosomal protein L20 [Bacillus cereus W]
 gi|196021448|gb|EDX60153.1| ribosomal protein L20 [Bacillus cereus 03BB108]
 gi|206735163|gb|EDZ52331.1| 50S ribosomal protein L20 [Bacillus cereus AH1134]
 gi|217064563|gb|ACJ78813.1| ribosomal protein L20 [Bacillus cereus AH187]
 gi|218162673|gb|ACK62665.1| ribosomal protein L20 [Bacillus cereus B4264]
 gi|218535940|gb|ACK88338.1| ribosomal protein L20 [Bacillus cereus AH820]
 gi|218544691|gb|ACK97085.1| ribosomal protein L20 [Bacillus cereus G9842]
 gi|221242093|gb|ACM14803.1| ribosomal protein L20 (50S ribosomal protein L20) [Bacillus cereus
           Q1]
 gi|225790737|gb|ACO30954.1| 50S ribosomal protein L20 [Bacillus cereus 03BB102]
 gi|227007913|gb|ACP17656.1| 50S ribosomal protein L20 [Bacillus anthracis str. CDC 684]
 gi|228584743|gb|EEK42863.1| 50S ribosomal protein L20 [Bacillus cereus m1293]
 gi|228590612|gb|EEK48473.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 10876]
 gi|228596566|gb|EEK54231.1| 50S ribosomal protein L20 [Bacillus cereus BGSC 6E1]
 gi|228619946|gb|EEK76822.1| 50S ribosomal protein L20 [Bacillus cereus R309803]
 gi|228625134|gb|EEK81894.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 4342]
 gi|228630587|gb|EEK87233.1| 50S ribosomal protein L20 [Bacillus cereus m1550]
 gi|228636380|gb|EEK92851.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST24]
 gi|228642079|gb|EEK98372.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST26]
 gi|228653547|gb|EEL09419.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-Cer4]
 gi|228659441|gb|EEL15089.1| 50S ribosomal protein L20 [Bacillus cereus 95/8201]
 gi|228665287|gb|EEL20770.1| 50S ribosomal protein L20 [Bacillus cereus Rock1-3]
 gi|228671360|gb|EEL26661.1| 50S ribosomal protein L20 [Bacillus cereus Rock1-15]
 gi|228678126|gb|EEL32354.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-28]
 gi|228684262|gb|EEL38206.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-29]
 gi|228689757|gb|EEL43564.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-42]
 gi|228701413|gb|EEL53907.1| 50S ribosomal protein L20 [Bacillus cereus Rock4-2]
 gi|228706938|gb|EEL59143.1| 50S ribosomal protein L20 [Bacillus cereus Rock4-18]
 gi|228711008|gb|EEL62974.1| 50S ribosomal protein L20 [Bacillus cereus F65185]
 gi|228723005|gb|EEL74382.1| 50S ribosomal protein L20 [Bacillus cereus AH676]
 gi|228733709|gb|EEL84485.1| 50S ribosomal protein L20 [Bacillus cereus AH1272]
 gi|228741522|gb|EEL91719.1| 50S ribosomal protein L20 [Bacillus cereus AH1273]
 gi|228771868|gb|EEM20325.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228778469|gb|EEM26736.1| 50S ribosomal protein L20 [Bacillus thuringiensis Bt407]
 gi|228785078|gb|EEM33091.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228792045|gb|EEM39626.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228798863|gb|EEM45842.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228804830|gb|EEM51429.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228811285|gb|EEM57623.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228817963|gb|EEM64041.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228823648|gb|EEM69470.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830007|gb|EEM75626.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228836270|gb|EEM81623.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228842413|gb|EEM87504.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228849162|gb|EEM94001.1| 50S ribosomal protein L20 [Bacillus thuringiensis IBL 200]
 gi|228856499|gb|EEN01023.1| 50S ribosomal protein L20 [Bacillus thuringiensis IBL 4222]
 gi|229266924|gb|ACQ48561.1| 50S ribosomal protein L20 [Bacillus anthracis str. A0248]
 gi|296326098|gb|ADH09026.1| 50S ribosomal protein L20 [Bacillus thuringiensis BMB171]
 gi|300378248|gb|ADK07152.1| 50S ribosomal protein L20 [Bacillus cereus biovar anthracis str.
           CI]
 gi|324328466|gb|ADY23726.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar finitimus
           YBT-020]
 gi|326942356|gb|AEA18252.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKNTLFKVANQQVMKSLMYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  ++++ +
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKNAGIEVNRKMLADLAVHDEKAFAELATVAKNNI 117


>gi|296164542|ref|ZP_06847113.1| inorganic diphosphatase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295900142|gb|EFG79577.1| inorganic diphosphatase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 131

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAQKKRRSILKASKGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+AIT   +F  +V+++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAITDPAAFTALVDVARAALPDD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|54023884|ref|YP_118126.1| 50S ribosomal protein L20 [Nocardia farcinica IFM 10152]
 gi|60390313|sp|Q5YYH9|RL20_NOCFA RecName: Full=50S ribosomal protein L20
 gi|54015392|dbj|BAD56762.1| putative ribosomal protein L20 [Nocardia farcinica IFM 10152]
          Length = 126

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+++KG+ G+R    R AK     S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSILEASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++FI GL  AG+ +DRK L++LA++  ++F  +V ++++ L  D
Sbjct: 61  WIARINAAARLNDITYNRFIQGLKAAGVEVDRKNLAELAVSDAEAFAGLVAIAKAALPQD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|319637850|ref|ZP_07992616.1| 50S ribosomal protein L20 [Neisseria mucosa C102]
 gi|317401005|gb|EFV81660.1| 50S ribosomal protein L20 [Neisseria mucosa C102]
          Length = 119

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+KV   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKVFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F K+VE +++ L
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRAAIEIDRKVLADLAVFDKAAFAKLVEKAKAAL 117


>gi|297182917|gb|ADI19066.1| ribosomal protein l20 [uncultured delta proteobacterium
           HF0070_15B21]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKR V +  K K   ++AKG+ G R    R  K AV+RS++Y++RDR+ +KRDFR LWI
Sbjct: 2   RVKRAVHARKKKKAYFEAAKGYRGGRSRLWRTVKDAVERSREYSFRDRKARKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAAVR + +NYSQFI+ L +A I LDRK L+ +A+ + + F +I   ++ +L
Sbjct: 62  SRINAAVREHGMNYSQFIHALQRAEIDLDRKALAHIAMEEPEMFAQIAGQAKEQL 116


>gi|223993413|ref|XP_002286390.1| RL20, ribosomal protein 20 60S large ribosomal subunit
           [Thalassiosira pseudonana CCMP1335]
 gi|220977705|gb|EED96031.1| RL20, ribosomal protein 20 60S large ribosomal subunit
           [Thalassiosira pseudonana CCMP1335]
          Length = 106

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 74/104 (71%)

Query: 9   VSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAA 68
           +   KHK+V+K +KGF GR     R A   +++S QYAYRDR+VKKR+FR LWIQR+NA 
Sbjct: 1   IHKPKHKRVIKLSKGFRGRANRCYRVAIRRLEKSWQYAYRDRKVKKREFRKLWIQRLNAG 60

Query: 69  VRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVEL 112
           VR   L+YS+FI    K G+VLDRK+LS LA+ +  SFK +V++
Sbjct: 61  VRQQGLSYSKFIQLQGKTGVVLDRKILSTLAMYEPFSFKAVVDV 104


>gi|261867958|ref|YP_003255880.1| 50S ribosomal protein L20 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261413290|gb|ACX82661.1| 50S ribosomal protein L20 [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 117

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|332670158|ref|YP_004453166.1| 50S ribosomal protein L20 [Cellulomonas fimi ATCC 484]
 gi|332339196|gb|AEE45779.1| ribosomal protein L20 [Cellulomonas fimi ATCC 484]
          Length = 127

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  YAYRDR+V+K+DFR L
Sbjct: 1   MARVKRAVNAQKKRRATLERASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKVRKQDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL  AG+ +DR+VL+DLA+    +F  +V++++  L  D
Sbjct: 61  WIQRINAASREQGLTYNRLIQGLKLAGVEVDRRVLADLAVNDAPAFAALVQVAKDALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|300716461|ref|YP_003741264.1| 50S ribosomal protein L20 [Erwinia billingiae Eb661]
 gi|299062297|emb|CAX59414.1| 50S ribosomal protein L20 [Erwinia billingiae Eb661]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARTNGMSYSRFINGLKKASIEIDRKILADIAVFDKVTFTALVEKAKTAL 117


>gi|291457668|ref|ZP_06597058.1| ribosomal protein L20 [Bifidobacterium breve DSM 20213]
 gi|291380721|gb|EFE88239.1| ribosomal protein L20 [Bifidobacterium breve DSM 20213]
          Length = 127

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/121 (47%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L++LA++  D+FK IV+ +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAELAVSDSDTFKTIVDAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|251789561|ref|YP_003004282.1| 50S ribosomal protein L20 [Dickeya zeae Ech1591]
 gi|271500483|ref|YP_003333508.1| 50S ribosomal protein L20 [Dickeya dadantii Ech586]
 gi|307131174|ref|YP_003883190.1| 50S ribosomal subunit protein L20 [Dickeya dadantii 3937]
 gi|247538182|gb|ACT06803.1| ribosomal protein L20 [Dickeya zeae Ech1591]
 gi|270344038|gb|ACZ76803.1| ribosomal protein L20 [Dickeya dadantii Ech586]
 gi|306528703|gb|ADM98633.1| 50S ribosomal subunit protein L20 [Dickeya dadantii 3937]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKSAL 117


>gi|291617250|ref|YP_003519992.1| RplT [Pantoea ananatis LMG 20103]
 gi|291152280|gb|ADD76864.1| RplT [Pantoea ananatis LMG 20103]
 gi|327393704|dbj|BAK11126.1| 50S ribosomal protein L20 RplT [Pantoea ananatis AJ13355]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKAAIEIDRKILADIAVFDKVAFTALVEKAKSAL 117


>gi|189499155|ref|YP_001958625.1| 50S ribosomal protein L20 [Chlorobium phaeobacteroides BS1]
 gi|226730373|sp|B3EKG6|RL20_CHLPB RecName: Full=50S ribosomal protein L20
 gi|189494596|gb|ACE03144.1| ribosomal protein L20 [Chlorobium phaeobacteroides BS1]
          Length = 115

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 76/111 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ K++LK AKG++G R   +  AK AVD+++QYAYRDRRVKKR FRSL
Sbjct: 1   MPRATNSVASRARRKRILKKAKGYWGSRGTILTVAKHAVDKAEQYAYRDRRVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R    +YS+ +  ++K  I ++RK L+++A+    +F +IV+
Sbjct: 61  WIMRINAAARENGTSYSRLMEAMNKKSIDINRKALAEIAVKDPAAFSQIVK 111


>gi|163942307|ref|YP_001647191.1| 50S ribosomal protein L20 [Bacillus weihenstephanensis KBAB4]
 gi|229013776|ref|ZP_04170904.1| 50S ribosomal protein L20 [Bacillus mycoides DSM 2048]
 gi|229032218|ref|ZP_04188191.1| 50S ribosomal protein L20 [Bacillus cereus AH1271]
 gi|229062257|ref|ZP_04199578.1| 50S ribosomal protein L20 [Bacillus cereus AH603]
 gi|229135408|ref|ZP_04264196.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST196]
 gi|229169300|ref|ZP_04297010.1| 50S ribosomal protein L20 [Bacillus cereus AH621]
 gi|229175282|ref|ZP_04302797.1| 50S ribosomal protein L20 [Bacillus cereus MM3]
 gi|226730356|sp|A9VJN6|RL20_BACWK RecName: Full=50S ribosomal protein L20
 gi|163864504|gb|ABY45563.1| ribosomal protein L20 [Bacillus weihenstephanensis KBAB4]
 gi|228608114|gb|EEK65421.1| 50S ribosomal protein L20 [Bacillus cereus MM3]
 gi|228614063|gb|EEK71178.1| 50S ribosomal protein L20 [Bacillus cereus AH621]
 gi|228648051|gb|EEL04098.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST196]
 gi|228716985|gb|EEL68666.1| 50S ribosomal protein L20 [Bacillus cereus AH603]
 gi|228728998|gb|EEL80001.1| 50S ribosomal protein L20 [Bacillus cereus AH1271]
 gi|228747445|gb|EEL97320.1| 50S ribosomal protein L20 [Bacillus mycoides DSM 2048]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKSTLFKVANQQVMKSLMYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  ++++ +
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKNAGIEVNRKMLADLAVHDEKAFAELATVAKNNI 117


>gi|188994829|ref|YP_001929081.1| 50S ribosomal protein L20 [Porphyromonas gingivalis ATCC 33277]
 gi|188594509|dbj|BAG33484.1| putative 50S ribosomal protein L20 [Porphyromonas gingivalis ATCC
           33277]
          Length = 115

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYFGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAA R+  ++YS+ +  LH  GI ++RKVL+DLA+   ++F+ IV
Sbjct: 61  WIQRINAAARLEGMSYSRLMGALHANGIEINRKVLADLAMNHPEAFRAIV 110


>gi|302330632|gb|ADL20826.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis 1002]
          Length = 127

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 78/121 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K +++LK+AKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSLDAKKKRREILKAAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  A I +DRKVL+DLA+    +F  I E +++ L  D
Sbjct: 61  WITRINAAARMNDITYNRLIQGLRLAEIEVDRKVLADLAVNDFAAFSAICEAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|297583670|ref|YP_003699450.1| 50S ribosomal protein L20 [Bacillus selenitireducens MLS10]
 gi|297142127|gb|ADH98884.1| ribosomal protein L20 [Bacillus selenitireducens MLS10]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+VLK AKG+ G +    + A+  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGYVARRRRKRVLKLAKGYVGSKHRLFKTAQGQVMKSHLYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+Y++F++GL +AGI ++RK+L+DLAI    +F ++ + +++ L
Sbjct: 61  WIARINAAARINGLSYNRFMHGLKQAGIEMNRKMLADLAINDEKAFAELADKAKANL 117


>gi|323484402|ref|ZP_08089768.1| 50S ribosomal protein L20 [Clostridium symbiosum WAL-14163]
 gi|323692413|ref|ZP_08106649.1| 50S ribosomal protein L20 [Clostridium symbiosum WAL-14673]
 gi|323402180|gb|EGA94512.1| 50S ribosomal protein L20 [Clostridium symbiosum WAL-14163]
 gi|323503553|gb|EGB19379.1| 50S ribosomal protein L20 [Clostridium symbiosum WAL-14673]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  +H +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARVKGGLNAKKRHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+ GL  AG+ ++RKVLSD+AI+  + F K+ EL++++L
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLAGVEMNRKVLSDMAISDAEGFAKLAELAKAKL 117


>gi|328907933|gb|EGG27693.1| 50S ribosomal protein L20 [Propionibacterium sp. P08]
          Length = 116

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 52/111 (46%), Positives = 77/111 (69%)

Query: 13  KHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVY 72
           K ++VL+ A G+ G+R    R AK     S  Y++RDRR KK DFRSLWIQRINAA R  
Sbjct: 6   KRREVLEQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFRSLWIQRINAASRAQ 65

Query: 73  DLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVDVAS 123
            + Y++FINGL  AG+ +DRKVL++LA++ +D+F  +VE++++    + A+
Sbjct: 66  GMTYNRFINGLKNAGVEVDRKVLAELAVSDIDAFNSLVEVAKANQPQNAAA 116


>gi|304397619|ref|ZP_07379496.1| ribosomal protein L20 [Pantoea sp. aB]
 gi|308186649|ref|YP_003930780.1| 50S ribosomal protein L20 [Pantoea vagans C9-1]
 gi|304354791|gb|EFM19161.1| ribosomal protein L20 [Pantoea sp. aB]
 gi|308057159|gb|ADO09331.1| 50S ribosomal protein L20 [Pantoea vagans C9-1]
          Length = 118

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKAAIEIDRKILADIAVFDKVAFSALVEKAKSAL 117


>gi|157149726|ref|YP_001450323.1| 50S ribosomal protein L20 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|189041892|sp|A8AX13|RL20_STRGC RecName: Full=50S ribosomal protein L20
 gi|157074520|gb|ABV09203.1| ribosomal protein L20 [Streptococcus gordonii str. Challis substr.
           CH1]
          Length = 119

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/106 (54%), Positives = 73/106 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+    +F
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDATAF 106


>gi|228993300|ref|ZP_04153216.1| 50S ribosomal protein L20 [Bacillus pseudomycoides DSM 12442]
 gi|228999353|ref|ZP_04158932.1| 50S ribosomal protein L20 [Bacillus mycoides Rock3-17]
 gi|229006908|ref|ZP_04164538.1| 50S ribosomal protein L20 [Bacillus mycoides Rock1-4]
 gi|228754308|gb|EEM03723.1| 50S ribosomal protein L20 [Bacillus mycoides Rock1-4]
 gi|228760298|gb|EEM09265.1| 50S ribosomal protein L20 [Bacillus mycoides Rock3-17]
 gi|228766368|gb|EEM15011.1| 50S ribosomal protein L20 [Bacillus pseudomycoides DSM 12442]
          Length = 118

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKNTLFKVANQQVMKSLLYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  ++++ L
Sbjct: 61  WITRINAAARINGLSYSRLMHGLKVAGIEVNRKMLADLAVHDEKAFAELATVAKNNL 117


>gi|12746347|gb|AAK07452.1|AF324935_1 large subunit ribosomal protein L20 [Photobacterium profundum SS9]
          Length = 95

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/89 (61%), Positives = 67/89 (75%)

Query: 12  AKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRV 71
           A+HKKVLK AKG+YG R    RA+  AV ++ QYAYRDRR KKR FR LWI RINAA R 
Sbjct: 4   ARHKKVLKQAKGYYGARSRVYRASFQAVTKAGQYAYRDRRQKKRTFRQLWIARINAAARQ 63

Query: 72  YDLNYSQFINGLHKAGIVLDRKVLSDLAI 100
             ++YS+ INGL KA I +DRK+LSD+A+
Sbjct: 64  NGMSYSRLINGLKKASIEIDRKILSDIAV 92


>gi|32474647|ref|NP_867641.1| 50S ribosomal protein L20 [Rhodopirellula baltica SH 1]
 gi|39931770|sp|Q7UP74|RL20_RHOBA RecName: Full=50S ribosomal protein L20
 gi|32445186|emb|CAD75188.1| probable 50S ribosomal protein L20 [Rhodopirellula baltica SH 1]
          Length = 118

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 73/109 (66%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R  +G       K++ K AKGF G R N  R  K  + RS  +A+RDRRV+KR+FR LWI
Sbjct: 2   RTTKGAARRQSKKRLFKRAKGFRGGRGNLTRTVKETLLRSGAFAFRDRRVRKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAAV+ + L YS+FI+GL+KAGI LDRK LS++AI     FK++ +
Sbjct: 62  IRINAAVKQHGLRYSEFIHGLNKAGIQLDRKSLSEMAIHDAAGFKQVCD 110


>gi|256422764|ref|YP_003123417.1| ribosomal protein L20 [Chitinophaga pinensis DSM 2588]
 gi|256037672|gb|ACU61216.1| ribosomal protein L20 [Chitinophaga pinensis DSM 2588]
          Length = 114

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 75/110 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+LK AKGFYG+RKN    AK  +++   Y+Y  R++KKR++R L
Sbjct: 1   MPRSVNAVASRARRKKILKQAKGFYGKRKNVYTVAKNVLEKGLTYSYVGRKLKKRNYRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RINAAVR   + YS+FI+ L    I L+RKVL+DLA+ + ++FK +V
Sbjct: 61  WIARINAAVRAEGITYSEFIHKLSVKNIGLNRKVLADLAMNEPETFKNLV 110


>gi|229916376|ref|YP_002885022.1| 50S ribosomal protein L20 [Exiguobacterium sp. AT1b]
 gi|229467805|gb|ACQ69577.1| ribosomal protein L20 [Exiguobacterium sp. AT1b]
          Length = 119

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KK +K AKG++G +    + AK  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYTTRQRRKKQIKLAKGYFGSKHILFKVAKQQVMKSLMYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ ++GL  AGI ++RK+L++LA+T   +F  + E ++S+L
Sbjct: 61  WITRINAAARTNGLSYSRMMHGLKLAGIDINRKMLAELAVTDAQAFASLAETAKSKL 117


>gi|23335403|ref|ZP_00120639.1| COG0292: Ribosomal protein L20 [Bifidobacterium longum DJO10A]
 gi|189439097|ref|YP_001954178.1| 50S ribosomal protein L20 [Bifidobacterium longum DJO10A]
 gi|239621211|ref|ZP_04664242.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|312132534|ref|YP_003999873.1| rplt [Bifidobacterium longum subsp. longum BBMN68]
 gi|317482509|ref|ZP_07941525.1| ribosomal protein L20 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322691425|ref|YP_004220995.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|226730358|sp|B3DQT4|RL20_BIFLD RecName: Full=50S ribosomal protein L20
 gi|189427532|gb|ACD97680.1| Ribosomal protein L20 [Bifidobacterium longum DJO10A]
 gi|239515672|gb|EEQ55539.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|291516705|emb|CBK70321.1| LSU ribosomal protein L20P [Bifidobacterium longum subsp. longum
           F8]
 gi|311773468|gb|ADQ02956.1| RplT [Bifidobacterium longum subsp. longum BBMN68]
 gi|316916061|gb|EFV37467.1| ribosomal protein L20 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456281|dbj|BAJ66903.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. longum JCM
           1217]
          Length = 127

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L+++A++  D+FK IV+ +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAEIAVSDPDTFKTIVDAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|332288525|ref|YP_004419377.1| 50S ribosomal protein L20 [Gallibacterium anatis UMN179]
 gi|330431421|gb|AEC16480.1| 50S ribosomal protein L20 [Gallibacterium anatis UMN179]
          Length = 117

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|183221768|ref|YP_001839764.1| 50S ribosomal protein L20 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189911842|ref|YP_001963397.1| 50S ribosomal protein L20 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|226730413|sp|B0SCH2|RL20_LEPBA RecName: Full=50S ribosomal protein L20
 gi|226730414|sp|B0SKZ5|RL20_LEPBP RecName: Full=50S ribosomal protein L20
 gi|167776518|gb|ABZ94819.1| 50S Ribosomal protein L20 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Ames)']
 gi|167780190|gb|ABZ98488.1| 50S ribosomal protein L20 [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
          Length = 117

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 73/114 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R   G +   + KKVL  AKGF G R    R AK+AV ++ Q+AYRDRR KK +FR L
Sbjct: 1   MPRAVNGTIHKNRRKKVLAKAKGFRGGRSKLFRTAKSAVMKAGQWAYRDRRKKKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAAVR   ++YS+FI+ L   GI LDRK L+DLA    + F  IVE ++
Sbjct: 61  WITRINAAVRENGMSYSKFIHALKTHGINLDRKTLADLAYNHKEVFNAIVEKTK 114


>gi|119716687|ref|YP_923652.1| 50S ribosomal protein L20 [Nocardioides sp. JS614]
 gi|166219669|sp|A1SJI0|RL20_NOCSJ RecName: Full=50S ribosomal protein L20
 gi|119537348|gb|ABL81965.1| LSU ribosomal protein L20P [Nocardioides sp. JS614]
          Length = 130

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 78/121 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y+Y DRR  K +FR L
Sbjct: 1   MARVKRAVNAQKKRRVVLERASGYRGQRSRLYRKAKEQVTHSLVYSYNDRRKNKGNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL+ AG+ +DRK+L+DLA+  + +F  +VE +++ L  D
Sbjct: 61  WIQRINAAARAQGMTYNRFIQGLNLAGVEVDRKILADLAVNDVTAFNALVETAKAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|259908575|ref|YP_002648931.1| 50S ribosomal protein L20 [Erwinia pyrifoliae Ep1/96]
 gi|292488132|ref|YP_003531009.1| 50S ribosomal protein L20 [Erwinia amylovora CFBP1430]
 gi|292899343|ref|YP_003538712.1| 50S ribosomal protein L20 [Erwinia amylovora ATCC 49946]
 gi|224964197|emb|CAX55704.1| 50S ribosomal protein L20 [Erwinia pyrifoliae Ep1/96]
 gi|283478544|emb|CAY74460.1| 50S ribosomal protein L20 [Erwinia pyrifoliae DSM 12163]
 gi|291199191|emb|CBJ46305.1| 50S ribosomal protein L20 [Erwinia amylovora ATCC 49946]
 gi|291553556|emb|CBA20601.1| 50S ribosomal protein L20 [Erwinia amylovora CFBP1430]
 gi|310767525|gb|ADP12475.1| 50S ribosomal protein L20 [Erwinia sp. Ejp617]
 gi|312172264|emb|CBX80521.1| 50S ribosomal protein L20 [Erwinia amylovora ATCC BAA-2158]
          Length = 118

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+     F  +VE ++S L
Sbjct: 61  WIARINAAARTNGISYSRFINGLKKASIEIDRKILADIAVFDKAVFAALVEKAKSAL 117


>gi|195953418|ref|YP_002121708.1| 50S ribosomal protein L20 [Hydrogenobaculum sp. Y04AAS1]
 gi|259646190|sp|B4U9B9|RL20_HYDS0 RecName: Full=50S ribosomal protein L20
 gi|195933030|gb|ACG57730.1| ribosomal protein L20 [Hydrogenobaculum sp. Y04AAS1]
          Length = 116

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (68%)

Query: 6   RGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRI 65
           +G  S    KKVLK AKG+ G++    R AK AV R+ +Y YRDRR +KR FR+LWI RI
Sbjct: 4   KGRSSKKFRKKVLKLAKGYRGQKSRVYRKAKEAVIRALKYQYRDRRQRKRQFRALWIARI 63

Query: 66  NAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           NAA R   + YS+FINGL KAGI L+RK LS +AI    +FK+++E +R
Sbjct: 64  NAACRANGMTYSKFINGLKKAGINLNRKSLSQIAILDPQAFKELIEKAR 112


>gi|294787705|ref|ZP_06752949.1| ribosomal protein L20 [Simonsiella muelleri ATCC 29453]
 gi|294483998|gb|EFG31681.1| ribosomal protein L20 [Simonsiella muelleri ATCC 29453]
          Length = 118

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  A G+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHKKVIALATGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL +A I LDRKVL+DLA+    +F ++VE +++ L
Sbjct: 61  WIARINAGARQNGLSYSKFMNGLKRAAIELDRKVLADLAVFDKAAFAQLVEKAKAAL 117


>gi|229820869|ref|YP_002882395.1| ribosomal protein L20 [Beutenbergia cavernae DSM 12333]
 gi|259646175|sp|C5BW32|RL20_BEUC1 RecName: Full=50S ribosomal protein L20
 gi|229566782|gb|ACQ80633.1| ribosomal protein L20 [Beutenbergia cavernae DSM 12333]
          Length = 126

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTTLERASGYRGQRSRLYRKAKEQVTHSLGYAYRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A + +DR++L++LA++   +F  +VEL++  L  D
Sbjct: 61  WIQRINAAARANGITYNRFIQGLKAAEVEVDRRMLAELAVSDPAAFTTLVELAKGALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|269795535|ref|YP_003314990.1| 50S ribosomal protein L20P [Sanguibacter keddieii DSM 10542]
 gi|269097720|gb|ACZ22156.1| LSU ribosomal protein L20P [Sanguibacter keddieii DSM 10542]
          Length = 128

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 81/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y+YRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTILEQASGYRGQRSRLYRKAKEQVTHSLTYSYRDRKKRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A I++DR+VL++LA++ + +F  +V+L+++ L  D
Sbjct: 61  WIQRINAAARAEGITYNRFIQGLKAAEILVDRRVLAELAVSDVAAFNALVKLAKAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|326800363|ref|YP_004318182.1| 50S ribosomal protein L20 [Sphingobacterium sp. 21]
 gi|326551127|gb|ADZ79512.1| 50S ribosomal protein L20 [Sphingobacterium sp. 21]
          Length = 114

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 73/111 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+LK AKG+YG R      AK  V++  QYAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNAVASRRRRKKILKLAKGYYGSRSKVYTIAKNTVEKGLQYAYRDRKTKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R + ++YSQ I  L    I L+RKVL+DLA+   ++FK +V+
Sbjct: 61  WIQRINAGARQHGISYSQLIGKLSAKNIGLNRKVLADLALNNPNAFKAVVD 111


>gi|241889598|ref|ZP_04776896.1| ribosomal protein L20 [Gemella haemolysans ATCC 10379]
 gi|317495089|ref|ZP_07953460.1| ribosomal protein L20 [Gemella moribillum M424]
 gi|329770369|ref|ZP_08261751.1| 50S ribosomal protein L20 [Gemella sanguinis M325]
 gi|241863220|gb|EER67604.1| ribosomal protein L20 [Gemella haemolysans ATCC 10379]
 gi|316914796|gb|EFV36271.1| ribosomal protein L20 [Gemella moribillum M424]
 gi|328836492|gb|EGF86152.1| 50S ribosomal protein L20 [Gemella sanguinis M325]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + AK  V +S  YA+RDRR  KR+FR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYFGSKHTLFKVAKQQVMKSGMYAFRDRRQTKRNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ +NGL  AGI ++RK+LS++AI    +F  I E +++ L
Sbjct: 61  WIVRINAAARLNGLSYSRLMNGLKVAGIDINRKMLSEIAIHDAAAFTSICEQAKAAL 117


>gi|224023754|ref|ZP_03642120.1| hypothetical protein BACCOPRO_00470 [Bacteroides coprophilus DSM
           18228]
 gi|224016976|gb|EEF74988.1| hypothetical protein BACCOPRO_00470 [Bacteroides coprophilus DSM
           18228]
          Length = 116

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 73/106 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+L   +G++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKILGLTRGYFGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAA R+  ++YS+ +  LHKAGI ++RKVL+DLA+   ++F
Sbjct: 61  WIQRINAAARLEGMSYSKLMGALHKAGIEINRKVLADLAVNHPEAF 106


>gi|11466537|ref|NP_044786.1| ribosomal protein L20 [Reclinomonas americana]
 gi|2258367|gb|AAD11901.1| ribosomal protein L20 [Reclinomonas americana]
          Length = 115

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 73/111 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  + ++HKK++K+A G+ GR KN    A   V +  QYAY  R+V KR FR++
Sbjct: 1   MIRVKSGTTTHSRHKKIIKNATGYRGRSKNCFSIAIEKVHKGLQYAYAHRKVNKRFFRNV 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINAA     +NYS FI+ L    I L+RK+LS LAIT+  +F+ I++
Sbjct: 61  WIQRINAACTTSQINYSSFIHNLSLQNIQLNRKILSTLAITEPYTFQSILK 111


>gi|312195569|ref|YP_004015630.1| ribosomal protein L20 [Frankia sp. EuI1c]
 gi|311226905|gb|ADP79760.1| ribosomal protein L20 [Frankia sp. EuI1c]
          Length = 127

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 74/115 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  +  S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTTLEQASGYRGQRSRLYRKAKEQMLHSMNYAYRDRRARKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R   + Y++FI GL  AG+ +DRK+L+DLA+    +F  +VE++R+
Sbjct: 61  WITRINAAARANGMTYNRFIQGLKVAGVEVDRKILADLAVNDAAAFTALVEVARA 115


>gi|257867130|ref|ZP_05646783.1| ribosomal protein L20 [Enterococcus casseliflavus EC30]
 gi|257871009|ref|ZP_05650662.1| ribosomal protein L20 [Enterococcus gallinarum EG2]
 gi|257873464|ref|ZP_05653117.1| ribosomal protein L20 [Enterococcus casseliflavus EC10]
 gi|257801186|gb|EEV30116.1| ribosomal protein L20 [Enterococcus casseliflavus EC30]
 gi|257805173|gb|EEV33995.1| ribosomal protein L20 [Enterococcus gallinarum EG2]
 gi|257807628|gb|EEV36450.1| ribosomal protein L20 [Enterococcus casseliflavus EC10]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDATAFTALADQAKDAL 117


>gi|15594533|ref|NP_212322.1| 50S ribosomal protein L20 [Borrelia burgdorferi B31]
 gi|3914716|sp|O51206|RL20_BORBU RecName: Full=50S ribosomal protein L20
 gi|2688076|gb|AAC66573.1| ribosomal protein L20 (rplT) [Borrelia burgdorferi B31]
          Length = 115

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G V  A+ K++LK  KGF+G +K+  + AK  + +   YA RDR+V+KRDFR L
Sbjct: 1   MARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLXKGMMYATRDRKVRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RI+AA+    + YS+FI GL K+ I ++RK+LS+LAI  +++FKKIV
Sbjct: 61  WISRISAALSDTGVTYSRFIEGLLKSNIKINRKILSNLAIEDVEAFKKIV 110


>gi|311031380|ref|ZP_07709470.1| 50S ribosomal protein L20 [Bacillus sp. m3-13]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKHTLYKVANQQVMKSLMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L++LA++   +F ++   +++ L
Sbjct: 61  WIARINAAARMNGLSYSRLMHGLKVAGIEVNRKMLAELAVSDEKAFAELATAAKNSL 117


>gi|257069325|ref|YP_003155580.1| 50S ribosomal protein L20P [Brachybacterium faecium DSM 4810]
 gi|256560143|gb|ACU85990.1| LSU ribosomal protein L20P [Brachybacterium faecium DSM 4810]
          Length = 126

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++L+ A G+ G+R    R AK  V  SQ Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRREILEQASGYRGQRSRLYRKAKEQVLHSQTYNFRDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  AG+ +DR++L++LA+    +F  +VE++++ L  D
Sbjct: 61  WIQRINAAARANGMTYNRFIQGLGLAGVEVDRRMLAELAVNDAPAFAALVEVAKNALPKD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|225552104|ref|ZP_03773044.1| ribosomal protein L20 [Borrelia sp. SV1]
 gi|225371102|gb|EEH00532.1| ribosomal protein L20 [Borrelia sp. SV1]
          Length = 115

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G V  A+ K++LK  KGF+G +K+  + AK  + +   YA RDR+V+KRDFR L
Sbjct: 1   MARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRKVRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RI+AA+    + YS+FI GL K+ I ++RK+LS+LAI  +++FKKIV
Sbjct: 61  WISRISAALSDTGITYSRFIEGLLKSNIKINRKILSNLAIEDVEAFKKIV 110


>gi|330467002|ref|YP_004404745.1| ribosomal protein l20 [Verrucosispora maris AB-18-032]
 gi|328809973|gb|AEB44145.1| ribosomal protein l20 [Verrucosispora maris AB-18-032]
          Length = 130

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 76/115 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S QYAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTLLETASGYRGQRSRLYRKAKEQVLHSMQYAYRDRRDRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINA  R   + Y++ I GL  AGI +DRK+L+D+A+    +F  IVEL+R+
Sbjct: 61  WIQRINAGARANGMTYNRLIQGLRLAGIEVDRKILADMAVNDAAAFAAIVELARA 115


>gi|89101228|ref|ZP_01174054.1| 50S ribosomal protein L20 [Bacillus sp. NRRL B-14911]
 gi|89084057|gb|EAR63232.1| 50S ribosomal protein L20 [Bacillus sp. NRRL B-14911]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSLMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L++LA+    +F ++  +++  L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKVAGIEVNRKMLAELAVADEKAFAELASVAKQNL 117


>gi|253989349|ref|YP_003040705.1| 50s ribosomal protein l20 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780799|emb|CAQ83961.1| 50s ribosomal protein l20 [Photorhabdus asymbiotica]
          Length = 118

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L+
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVAFAALVEKAKGALV 118


>gi|121634520|ref|YP_974765.1| 50S ribosomal protein L20 [Neisseria meningitidis FAM18]
 gi|166219668|sp|A1KSY5|RL20_NEIMF RecName: Full=50S ribosomal protein L20
 gi|120866226|emb|CAM09966.1| putative 50S ribosomal protein L20 [Neisseria meningitidis FAM18]
 gi|325129872|gb|EGC52676.1| ribosomal protein L20 [Neisseria meningitidis OX99.30304]
 gi|325131824|gb|EGC54524.1| ribosomal protein L20 [Neisseria meningitidis M6190]
 gi|325137874|gb|EGC60449.1| ribosomal protein L20 [Neisseria meningitidis ES14902]
          Length = 119

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE ++S L
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKAAFAQLVEKAKSAL 117


>gi|116328737|ref|YP_798457.1| 50S ribosomal protein L20 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116330606|ref|YP_800324.1| 50S ribosomal protein L20 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|122281639|sp|Q04U54|RL20_LEPBJ RecName: Full=50S ribosomal protein L20
 gi|122283478|sp|Q04ZH1|RL20_LEPBL RecName: Full=50S ribosomal protein L20
 gi|116121481|gb|ABJ79524.1| 50S Ribosomal protein L20 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116124295|gb|ABJ75566.1| 50S Ribosomal protein L20 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 117

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 72/111 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R   G +   + ++VLK AKGF G R    R AK+AV ++ Q+AYRDRR KKRDFR L
Sbjct: 1   MPRAVNGTIHKNRRRRVLKDAKGFRGARSKLYRTAKSAVMKAGQWAYRDRRAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R   L+YS F+N L K GI +DRK L++LA    + F  +VE
Sbjct: 61  WIIRINAAARENGLSYSVFMNSLKKLGINMDRKSLAELAFNDREVFNALVE 111


>gi|33152808|ref|NP_874161.1| 50S ribosomal protein L20 [Haemophilus ducreyi 35000HP]
 gi|39931809|sp|Q7VKS2|RL20_HAEDU RecName: Full=50S ribosomal protein L20
 gi|33149032|gb|AAP96550.1| 50S ribosomal protein L20 [Haemophilus ducreyi 35000HP]
          Length = 117

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKTLADIAVFDKVAFAALVEKAKSAL 117


>gi|329767184|ref|ZP_08258711.1| 50S ribosomal protein L20 [Gemella haemolysans M341]
 gi|328836851|gb|EGF86498.1| 50S ribosomal protein L20 [Gemella haemolysans M341]
          Length = 119

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + AK  V +S  YA+RDRR  KR+FR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYFGSKHTLFKVAKQQVMKSGMYAFRDRRQTKRNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ +NGL  AGI ++RK+LS++AI     F  I E +++ L
Sbjct: 61  WIVRINAAARLNGLSYSRLMNGLKVAGIDINRKMLSEIAIHDAAGFASICEQAKAAL 117


>gi|115375459|ref|ZP_01462719.1| ribosomal protein L20 [Stigmatella aurantiaca DW4/3-1]
 gi|310821383|ref|YP_003953741.1| 50S ribosomal protein L20 [Stigmatella aurantiaca DW4/3-1]
 gi|115367502|gb|EAU66477.1| ribosomal protein L20 [Stigmatella aurantiaca DW4/3-1]
 gi|309394455|gb|ADO71914.1| 50S ribosomal protein L20 [Stigmatella aurantiaca DW4/3-1]
          Length = 115

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 77/113 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK+G  +  +  ++LK AKG+ GRRKN  + A  AV+R+  YA RDR V+KR+FRSLWI
Sbjct: 2   RVKKGFKARRRRNRILKLAKGYRGRRKNCYKRANQAVERALDYATRDRAVRKRNFRSLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
            RINAA R   L+YS+ I GL KA I LDRKVL+DLA+     F  +  ++++
Sbjct: 62  VRINAAARGVGLSYSKLIAGLAKAKISLDRKVLADLAVADPSGFTAVANIAKA 114


>gi|239993782|ref|ZP_04714306.1| 50S ribosomal protein L20 [Alteromonas macleodii ATCC 27126]
 gi|332141019|ref|YP_004426757.1| 50S ribosomal protein L20 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|226730348|sp|B4RSL5|RL20_ALTMD RecName: Full=50S ribosomal protein L20
 gi|327551041|gb|AEA97759.1| 50S ribosomal protein L20 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 118

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG ++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGTIARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASVEIDRKILADIAVHDKAAFSALVEAAKGAL 117


>gi|295113893|emb|CBL32530.1| LSU ribosomal protein L20P [Enterococcus sp. 7L76]
          Length = 119

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    ++AK  V  S  YA+RDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKSAKEQVMNSYYYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + E ++  L
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDTAAFTALAEQAKDAL 117


>gi|320539028|ref|ZP_08038703.1| 50S ribosomal subunit protein L20 [Serratia symbiotica str. Tucson]
 gi|320030961|gb|EFW12965.1| 50S ribosomal subunit protein L20 [Serratia symbiotica str. Tucson]
          Length = 118

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK++K AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKIMKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L+
Sbjct: 61  WIARINAAARQSGLSYSKFINGLKKASIEIDRKILADIAVFDKVAFSTLVEKAKAALV 118


>gi|298500136|ref|ZP_07009942.1| LSU ribosomal protein L20 [Vibrio cholerae MAK 757]
 gi|297542117|gb|EFH78168.1| LSU ribosomal protein L20 [Vibrio cholerae MAK 757]
          Length = 90

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 65/90 (72%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1  MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRAKKRQFRQL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVL 90
          WI RINAA R   L+YS+FINGL KA I +
Sbjct: 61 WIARINAAARQNGLSYSRFINGLKKASIEI 90


>gi|218960858|ref|YP_001740633.1| 50S ribosomal subunit protein L20 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729515|emb|CAO80426.1| 50S ribosomal subunit protein L20 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 98

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 69/94 (73%)

Query: 21  AKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFI 80
           A+G+YG R  T RAA+  V+R+  +++  R+ KKR FRSLWI RINAA R+ D+NYSQFI
Sbjct: 4   ARGYYGSRSKTYRAARQTVERAMAFSFAHRKQKKRQFRSLWITRINAACRMNDINYSQFI 63

Query: 81  NGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           NGLHKA I ++RK L+ LA     +F K+VE+++
Sbjct: 64  NGLHKANIQINRKTLAHLAWHDSPAFAKLVEIAK 97


>gi|284991464|ref|YP_003410018.1| 50S ribosomal protein L20 [Geodermatophilus obscurus DSM 43160]
 gi|284064709|gb|ADB75647.1| ribosomal protein L20 [Geodermatophilus obscurus DSM 43160]
          Length = 127

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL++A G+ G+R      AK  +  S  Y YRDR+V+K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTVLEAASGYRGQRSRLYSKAKEQLLHSATYQYRDRKVRKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R  D+ Y++F+ GL  AGI LDR+VLS+LA+ +  +F  +VE SR
Sbjct: 61  WITRINAAARQNDMTYNRFMQGLKLAGIELDRRVLSELAVNEPAAFAALVETSR 114


>gi|224367576|ref|YP_002601739.1| RplT [Desulfobacterium autotrophicum HRM2]
 gi|259646181|sp|C0QHL7|RL20_DESAH RecName: Full=50S ribosomal protein L20
 gi|223690292|gb|ACN13575.1| RplT [Desulfobacterium autotrophicum HRM2]
          Length = 116

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/108 (53%), Positives = 74/108 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG  +  +  KVLK AKGF G R    R A  AVD++  YAYRDRR KKRDFR LWI
Sbjct: 2   RVKRGFKARRRRNKVLKLAKGFRGSRSKLYRTAADAVDKALGYAYRDRRAKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
            RINAA ++ +++YS+ I+GL  A + LDRKVL+DLA++    F +I 
Sbjct: 62  ARINAASKMNNISYSKLIHGLKLAKVELDRKVLADLAVSDPAGFSQIA 109


>gi|195941919|ref|ZP_03087301.1| 50S ribosomal protein L20 [Borrelia burgdorferi 80a]
 gi|224532843|ref|ZP_03673458.1| ribosomal protein L20 [Borrelia burgdorferi WI91-23]
 gi|224512232|gb|EEF82618.1| ribosomal protein L20 [Borrelia burgdorferi WI91-23]
          Length = 115

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G V  A+ K++LK  KGF+G +K+  + AK  + +   YA RDR+V+KRDFR L
Sbjct: 1   MARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRKVRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RI+AA+    + YS+FI GL K+ I ++RK+LS+LAI  +++FKKIV
Sbjct: 61  WISRISAALSDTGVTYSRFIEGLLKSNIKINRKILSNLAIEDVEAFKKIV 110


>gi|319760487|ref|YP_004124425.1| 50S ribosomal protein L20 [Candidatus Blochmannia vafer str. BVAF]
 gi|318039201|gb|ADV33751.1| 50S ribosomal protein L20 [Candidatus Blochmannia vafer str. BVAF]
          Length = 118

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 77/113 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVK  +++ A+HKK+LK A G+YG R  T R A  ++ +S QY+YRDRR KKR FR L
Sbjct: 2   MTRVKNSIIARARHKKILKQASGYYGARSRTYRVAYQSILKSGQYSYRDRRQKKRLFRKL 61

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI +INAA R Y + Y+  IN L K+ I ++RK+L+ LA +   SF  I++ S
Sbjct: 62  WINQINAASRQYGITYNILINALRKSSININRKILAKLAQSDKVSFFSIIKNS 114


>gi|240047799|ref|YP_002961187.1| 50S ribosomal protein L20 [Mycoplasma conjunctivae HRC/581]
 gi|239985371|emb|CAT05384.1| 50S ribosomal protein L20 [Mycoplasma conjunctivae]
          Length = 124

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/112 (50%), Positives = 78/112 (69%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  + KK LK AKG++G +    + AK AV +S  YA+RDR+  KRDFR LWI
Sbjct: 2   RVKGGTVTRQRRKKWLKLAKGYWGHKSIGYKVAKQAVVKSWTYAFRDRKQVKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
            RINAA R Y + YSQ +NG+  A I ++RK+LS+LAI   ++F +IV+L+R
Sbjct: 62  SRINAASRNYGMTYSQLMNGIKLAEIDINRKMLSELAIHHEEAFAQIVKLAR 113


>gi|317047871|ref|YP_004115519.1| 50S ribosomal protein L20 [Pantoea sp. At-9b]
 gi|316949488|gb|ADU68963.1| ribosomal protein L20 [Pantoea sp. At-9b]
          Length = 118

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASIEIDRKILADIAVFDKVTFTALVEKAKSAL 117


>gi|138896277|ref|YP_001126730.1| 50S ribosomal protein L20 [Geobacillus thermodenitrificans NG80-2]
 gi|166219647|sp|A4IRN1|RL20_GEOTN RecName: Full=50S ribosomal protein L20
 gi|134267790|gb|ABO67985.1| Ribosomal protein L20 [Geobacillus thermodenitrificans NG80-2]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    R A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGPVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ ++GL  AG+ ++RK+L+DLA+    +F ++ +L+++ L
Sbjct: 61  WIARINAAARQNGLSYSRLMHGLKLAGVEVNRKMLADLAVNDQAAFAQLADLAKANL 117


>gi|323339583|ref|ZP_08079857.1| 50S ribosomal protein L20 [Lactobacillus ruminis ATCC 25644]
 gi|323092978|gb|EFZ35576.1| 50S ribosomal protein L20 [Lactobacillus ruminis ATCC 25644]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+ G +    + AK  V +S QYA+RDRR  K +FR L
Sbjct: 1   MPRVKGGTVTRQRRKKVLKLAKGYRGSKHTQFKVAKQQVMKSYQYAFRDRRKNKSNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YSQ ++GL  A I ++RK+L+DLAIT   +F  +VE ++  L
Sbjct: 61  WIARINAAARMNGISYSQLMHGLKLANIEVNRKMLADLAITDAAAFTAVVEEAKKAL 117


>gi|153872754|ref|ZP_02001553.1| Ribosomal protein L20 [Beggiatoa sp. PS]
 gi|152070780|gb|EDN68447.1| Ribosomal protein L20 [Beggiatoa sp. PS]
          Length = 137

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ G R    R AK AV ++ QYAYRDRR +KRDFR L
Sbjct: 18  MPRVKRGVTAHARHKKILKQAKGYRGARSRVFRVAKQAVIKAGQYAYRDRRQRKRDFRRL 77

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YS+ INGL KAGI +DRK+L++LA+   D+F  I   ++  L
Sbjct: 78  WIARINAAARECGLTYSRMINGLQKAGIEVDRKMLAELAVFNKDAFAAIANKAKLEL 134


>gi|293396367|ref|ZP_06640645.1| inorganic diphosphatase [Serratia odorifera DSM 4582]
 gi|291421156|gb|EFE94407.1| inorganic diphosphatase [Serratia odorifera DSM 4582]
          Length = 118

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASIEIDRKILADIAVFDKVAFGALVEKAKAAL 117


>gi|29375500|ref|NP_814654.1| 50S ribosomal protein L20 [Enterococcus faecalis V583]
 gi|227517835|ref|ZP_03947884.1| 50S ribosomal protein L20 [Enterococcus faecalis TX0104]
 gi|227555027|ref|ZP_03985074.1| 50S ribosomal protein L20 [Enterococcus faecalis HH22]
 gi|229546760|ref|ZP_04435485.1| 50S ribosomal protein L20 [Enterococcus faecalis TX1322]
 gi|229548852|ref|ZP_04437577.1| 50S ribosomal protein L20 [Enterococcus faecalis ATCC 29200]
 gi|255971366|ref|ZP_05421952.1| ribosomal protein L20 [Enterococcus faecalis T1]
 gi|255973985|ref|ZP_05424571.1| ribosomal protein L20 [Enterococcus faecalis T2]
 gi|256617784|ref|ZP_05474630.1| ribosomal protein L20 [Enterococcus faecalis ATCC 4200]
 gi|256761670|ref|ZP_05502250.1| ribosomal protein L20 [Enterococcus faecalis T3]
 gi|256854241|ref|ZP_05559605.1| ribosomal protein L20 [Enterococcus faecalis T8]
 gi|256957228|ref|ZP_05561399.1| ribosomal protein L20 [Enterococcus faecalis DS5]
 gi|256960041|ref|ZP_05564212.1| 50S ribosomal protein L20 [Enterococcus faecalis Merz96]
 gi|256964265|ref|ZP_05568436.1| 50S ribosomal protein L20 [Enterococcus faecalis HIP11704]
 gi|257077800|ref|ZP_05572161.1| 50S ribosomal protein L20 [Enterococcus faecalis JH1]
 gi|257081159|ref|ZP_05575520.1| ribosomal protein L20 [Enterococcus faecalis E1Sol]
 gi|257083828|ref|ZP_05578189.1| 50S ribosomal protein L20 [Enterococcus faecalis Fly1]
 gi|257086253|ref|ZP_05580614.1| ribosomal protein L20 [Enterococcus faecalis D6]
 gi|257089326|ref|ZP_05583687.1| 50S ribosomal protein L20 [Enterococcus faecalis CH188]
 gi|257415478|ref|ZP_05592472.1| ribosomal protein L20 [Enterococcus faecalis AR01/DG]
 gi|257418510|ref|ZP_05595504.1| 50S ribosomal protein L20 [Enterococcus faecalis T11]
 gi|257421160|ref|ZP_05598150.1| 50S ribosomal protein L20 [Enterococcus faecalis X98]
 gi|293383794|ref|ZP_06629701.1| ribosomal protein L20 [Enterococcus faecalis R712]
 gi|293388730|ref|ZP_06633223.1| ribosomal protein L20 [Enterococcus faecalis S613]
 gi|294781326|ref|ZP_06746672.1| ribosomal protein L20 [Enterococcus faecalis PC1.1]
 gi|300859954|ref|ZP_07106042.1| ribosomal protein L20 [Enterococcus faecalis TUSoD Ef11]
 gi|307267991|ref|ZP_07549379.1| ribosomal protein L20 [Enterococcus faecalis TX4248]
 gi|307271915|ref|ZP_07553183.1| ribosomal protein L20 [Enterococcus faecalis TX0855]
 gi|307278389|ref|ZP_07559464.1| ribosomal protein L20 [Enterococcus faecalis TX0860]
 gi|307286723|ref|ZP_07566809.1| ribosomal protein L20 [Enterococcus faecalis TX0109]
 gi|307290932|ref|ZP_07570822.1| ribosomal protein L20 [Enterococcus faecalis TX0411]
 gi|312901542|ref|ZP_07760815.1| ribosomal protein L20 [Enterococcus faecalis TX0470]
 gi|312904476|ref|ZP_07763635.1| ribosomal protein L20 [Enterococcus faecalis TX0635]
 gi|312906990|ref|ZP_07765986.1| ribosomal protein L20 [Enterococcus faecalis DAPTO 512]
 gi|312952817|ref|ZP_07771679.1| ribosomal protein L20 [Enterococcus faecalis TX0102]
 gi|312978752|ref|ZP_07790479.1| ribosomal protein L20 [Enterococcus faecalis DAPTO 516]
 gi|39931897|sp|Q837C7|RL20_ENTFA RecName: Full=50S ribosomal protein L20
 gi|29342960|gb|AAO80724.1| ribosomal protein L20 [Enterococcus faecalis V583]
 gi|227074725|gb|EEI12688.1| 50S ribosomal protein L20 [Enterococcus faecalis TX0104]
 gi|227175853|gb|EEI56825.1| 50S ribosomal protein L20 [Enterococcus faecalis HH22]
 gi|229306081|gb|EEN72077.1| 50S ribosomal protein L20 [Enterococcus faecalis ATCC 29200]
 gi|229308109|gb|EEN74096.1| 50S ribosomal protein L20 [Enterococcus faecalis TX1322]
 gi|255962384|gb|EET94860.1| ribosomal protein L20 [Enterococcus faecalis T1]
 gi|255966857|gb|EET97479.1| ribosomal protein L20 [Enterococcus faecalis T2]
 gi|256597311|gb|EEU16487.1| ribosomal protein L20 [Enterococcus faecalis ATCC 4200]
 gi|256682921|gb|EEU22616.1| ribosomal protein L20 [Enterococcus faecalis T3]
 gi|256709801|gb|EEU24845.1| ribosomal protein L20 [Enterococcus faecalis T8]
 gi|256947724|gb|EEU64356.1| ribosomal protein L20 [Enterococcus faecalis DS5]
 gi|256950537|gb|EEU67169.1| 50S ribosomal protein L20 [Enterococcus faecalis Merz96]
 gi|256954761|gb|EEU71393.1| 50S ribosomal protein L20 [Enterococcus faecalis HIP11704]
 gi|256985830|gb|EEU73132.1| 50S ribosomal protein L20 [Enterococcus faecalis JH1]
 gi|256989189|gb|EEU76491.1| ribosomal protein L20 [Enterococcus faecalis E1Sol]
 gi|256991858|gb|EEU79160.1| 50S ribosomal protein L20 [Enterococcus faecalis Fly1]
 gi|256994283|gb|EEU81585.1| ribosomal protein L20 [Enterococcus faecalis D6]
 gi|256998138|gb|EEU84658.1| 50S ribosomal protein L20 [Enterococcus faecalis CH188]
 gi|257157306|gb|EEU87266.1| ribosomal protein L20 [Enterococcus faecalis ARO1/DG]
 gi|257160338|gb|EEU90298.1| 50S ribosomal protein L20 [Enterococcus faecalis T11]
 gi|257162984|gb|EEU92944.1| 50S ribosomal protein L20 [Enterococcus faecalis X98]
 gi|291078870|gb|EFE16234.1| ribosomal protein L20 [Enterococcus faecalis R712]
 gi|291081887|gb|EFE18850.1| ribosomal protein L20 [Enterococcus faecalis S613]
 gi|294451662|gb|EFG20118.1| ribosomal protein L20 [Enterococcus faecalis PC1.1]
 gi|300850772|gb|EFK78521.1| ribosomal protein L20 [Enterococcus faecalis TUSoD Ef11]
 gi|306498002|gb|EFM67529.1| ribosomal protein L20 [Enterococcus faecalis TX0411]
 gi|306502201|gb|EFM71485.1| ribosomal protein L20 [Enterococcus faecalis TX0109]
 gi|306504895|gb|EFM74090.1| ribosomal protein L20 [Enterococcus faecalis TX0860]
 gi|306511421|gb|EFM80423.1| ribosomal protein L20 [Enterococcus faecalis TX0855]
 gi|306515632|gb|EFM84159.1| ribosomal protein L20 [Enterococcus faecalis TX4248]
 gi|310626975|gb|EFQ10258.1| ribosomal protein L20 [Enterococcus faecalis DAPTO 512]
 gi|310629333|gb|EFQ12616.1| ribosomal protein L20 [Enterococcus faecalis TX0102]
 gi|310632174|gb|EFQ15457.1| ribosomal protein L20 [Enterococcus faecalis TX0635]
 gi|311288459|gb|EFQ67015.1| ribosomal protein L20 [Enterococcus faecalis DAPTO 516]
 gi|311291337|gb|EFQ69893.1| ribosomal protein L20 [Enterococcus faecalis TX0470]
 gi|315027101|gb|EFT39033.1| ribosomal protein L20 [Enterococcus faecalis TX2137]
 gi|315029786|gb|EFT41718.1| ribosomal protein L20 [Enterococcus faecalis TX4000]
 gi|315032455|gb|EFT44387.1| ribosomal protein L20 [Enterococcus faecalis TX0017]
 gi|315034311|gb|EFT46243.1| ribosomal protein L20 [Enterococcus faecalis TX0027]
 gi|315145797|gb|EFT89813.1| ribosomal protein L20 [Enterococcus faecalis TX2141]
 gi|315148073|gb|EFT92089.1| ribosomal protein L20 [Enterococcus faecalis TX4244]
 gi|315149675|gb|EFT93691.1| ribosomal protein L20 [Enterococcus faecalis TX0012]
 gi|315152988|gb|EFT97004.1| ribosomal protein L20 [Enterococcus faecalis TX0031]
 gi|315155219|gb|EFT99235.1| ribosomal protein L20 [Enterococcus faecalis TX0043]
 gi|315157546|gb|EFU01563.1| ribosomal protein L20 [Enterococcus faecalis TX0312]
 gi|315163025|gb|EFU07042.1| ribosomal protein L20 [Enterococcus faecalis TX0645]
 gi|315165224|gb|EFU09241.1| ribosomal protein L20 [Enterococcus faecalis TX1302]
 gi|315167949|gb|EFU11966.1| ribosomal protein L20 [Enterococcus faecalis TX1341]
 gi|315172018|gb|EFU16035.1| ribosomal protein L20 [Enterococcus faecalis TX1342]
 gi|315174841|gb|EFU18858.1| ribosomal protein L20 [Enterococcus faecalis TX1346]
 gi|315574171|gb|EFU86362.1| ribosomal protein L20 [Enterococcus faecalis TX0309B]
 gi|315577302|gb|EFU89493.1| ribosomal protein L20 [Enterococcus faecalis TX0630]
 gi|315581686|gb|EFU93877.1| ribosomal protein L20 [Enterococcus faecalis TX0309A]
 gi|323480096|gb|ADX79535.1| ribosomal protein L20 [Enterococcus faecalis 62]
 gi|327534496|gb|AEA93330.1| 50S ribosomal protein L20 [Enterococcus faecalis OG1RF]
 gi|329577912|gb|EGG59333.1| ribosomal protein L20 [Enterococcus faecalis TX1467]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    ++AK  V  S  YA+RDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKSAKEQVMNSYYYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + E ++  L
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDAAAFTALAEQAKDAL 117


>gi|238753684|ref|ZP_04615046.1| 50S ribosomal protein L20 [Yersinia ruckeri ATCC 29473]
 gi|238708236|gb|EEQ00592.1| 50S ribosomal protein L20 [Yersinia ruckeri ATCC 29473]
          Length = 118

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQSGLSYSRFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKAAL 117


>gi|71280047|ref|YP_269607.1| 50S ribosomal protein L20 [Colwellia psychrerythraea 34H]
 gi|109893107|sp|Q480B2|RL20_COLP3 RecName: Full=50S ribosomal protein L20
 gi|71145787|gb|AAZ26260.1| ribosomal protein L20 [Colwellia psychrerythraea 34H]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVQARARHKKVLKQAKGYYGARSRVYRVAYQAVTKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASIEIDRKILADIAVYDKAAFTFLVEKAQASL 117


>gi|325103183|ref|YP_004272837.1| LSU ribosomal protein L20P [Pedobacter saltans DSM 12145]
 gi|324972031|gb|ADY51015.1| LSU ribosomal protein L20P [Pedobacter saltans DSM 12145]
          Length = 114

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 73/111 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+L  AKG++G R      AK  V++  QYAYRDR+VKKR+FR+L
Sbjct: 1   MPRSVNAVASRRRRKKILNLAKGYWGSRSKVYTIAKNTVEKGLQYAYRDRKVKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R Y ++YSQ +  L    I L+RKVL+DLA+   ++FK IV+
Sbjct: 61  WIQRINAGARQYGVSYSQLMGKLAAKNIGLNRKVLADLAMNHPEAFKAIVD 111


>gi|308068137|ref|YP_003869742.1| 50S ribosomal protein L20 [Paenibacillus polymyxa E681]
 gi|310640926|ref|YP_003945684.1| ribosomal protein l20 [Paenibacillus polymyxa SC2]
 gi|305857416|gb|ADM69204.1| 50S ribosomal protein L20 [Paenibacillus polymyxa E681]
 gi|309245876|gb|ADO55443.1| Ribosomal protein L20 [Paenibacillus polymyxa SC2]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK AKG++G +    + A   V +S  YAYRDRR  KR+FR L
Sbjct: 1   MARVKGGFVVRRRHKKVLKLAKGYFGSKHRIFKTANEQVMKSLVYAYRDRRQTKRNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AG+ ++RK+L+DLA+  +++F  +  +++ ++
Sbjct: 61  WIVRINAAARLNGLSYSKLMHGLKLAGVDINRKILADLAVNDINAFNSLATVAKGKI 117


>gi|163782649|ref|ZP_02177646.1| 50S ribosomal protein L20 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882222|gb|EDP75729.1| 50S ribosomal protein L20 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 115

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/95 (55%), Positives = 70/95 (73%)

Query: 23  GFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFING 82
           G+ G R  + R AK AV R+  Y YRDR+ +KR+FR LWI RINAAVR Y L+YS+FING
Sbjct: 21  GYRGMRHTSYRRAKEAVMRALYYEYRDRKQRKREFRRLWIARINAAVRPYGLSYSRFING 80

Query: 83  LHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           L KAGI LDRK+L+D+A+   + F ++VE ++S L
Sbjct: 81  LKKAGIELDRKILADMAVRDPEGFAQVVEKAKSAL 115


>gi|216264371|ref|ZP_03436363.1| ribosomal protein L20 [Borrelia burgdorferi 156a]
 gi|218249501|ref|YP_002374716.1| ribosomal protein L20 [Borrelia burgdorferi ZS7]
 gi|221217516|ref|ZP_03588986.1| ribosomal protein L20 [Borrelia burgdorferi 72a]
 gi|223889271|ref|ZP_03623859.1| ribosomal protein L20 [Borrelia burgdorferi 64b]
 gi|224534100|ref|ZP_03674683.1| ribosomal protein L20 [Borrelia burgdorferi CA-11.2a]
 gi|225549778|ref|ZP_03770742.1| ribosomal protein L20 [Borrelia burgdorferi 118a]
 gi|226320903|ref|ZP_03796454.1| ribosomal protein L20 [Borrelia burgdorferi 29805]
 gi|226321506|ref|ZP_03797032.1| ribosomal protein L20 [Borrelia burgdorferi Bol26]
 gi|215980844|gb|EEC21651.1| ribosomal protein L20 [Borrelia burgdorferi 156a]
 gi|218164689|gb|ACK74750.1| ribosomal protein L20 [Borrelia burgdorferi ZS7]
 gi|221192579|gb|EEE18796.1| ribosomal protein L20 [Borrelia burgdorferi 72a]
 gi|223885304|gb|EEF56406.1| ribosomal protein L20 [Borrelia burgdorferi 64b]
 gi|224512799|gb|EEF83167.1| ribosomal protein L20 [Borrelia burgdorferi CA-11.2a]
 gi|225369586|gb|EEG99035.1| ribosomal protein L20 [Borrelia burgdorferi 118a]
 gi|226232695|gb|EEH31448.1| ribosomal protein L20 [Borrelia burgdorferi Bol26]
 gi|226233675|gb|EEH32405.1| ribosomal protein L20 [Borrelia burgdorferi 29805]
 gi|312148373|gb|ADQ31032.1| ribosomal protein L20 [Borrelia burgdorferi JD1]
 gi|312149329|gb|ADQ29400.1| ribosomal protein L20 [Borrelia burgdorferi N40]
          Length = 115

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G V  A+ K++LK  KGF+G +K+  + AK  + +   YA RDR+V+KRDFR L
Sbjct: 1   MARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRKVRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RI+AA+    + YS+FI GL K+ I ++RK+LS+LAI  +++FKKIV
Sbjct: 61  WISRISAALSDTGVTYSRFIEGLLKSNIKINRKILSNLAIEDVEAFKKIV 110


>gi|15900838|ref|NP_345442.1| 50S ribosomal protein L20 [Streptococcus pneumoniae TIGR4]
 gi|15902907|ref|NP_358457.1| 50S ribosomal protein L20 [Streptococcus pneumoniae R6]
 gi|111658038|ref|ZP_01408740.1| hypothetical protein SpneT_02000771 [Streptococcus pneumoniae
           TIGR4]
 gi|116516545|ref|YP_816331.1| 50S ribosomal protein L20 [Streptococcus pneumoniae D39]
 gi|148984703|ref|ZP_01817971.1| ribosomal protein L20 [Streptococcus pneumoniae SP3-BS71]
 gi|148988401|ref|ZP_01819848.1| ribosomal protein L20 [Streptococcus pneumoniae SP6-BS73]
 gi|148992904|ref|ZP_01822523.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP9-BS68]
 gi|148998604|ref|ZP_01826044.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP11-BS70]
 gi|149002511|ref|ZP_01827445.1| ribosomal protein L20 [Streptococcus pneumoniae SP14-BS69]
 gi|149006363|ref|ZP_01830075.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP18-BS74]
 gi|149010393|ref|ZP_01831764.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP19-BS75]
 gi|149019552|ref|ZP_01834871.1| ribosomal protein L20 [Streptococcus pneumoniae SP23-BS72]
 gi|168483031|ref|ZP_02707983.1| ribosomal protein L20 [Streptococcus pneumoniae CDC1873-00]
 gi|168485913|ref|ZP_02710421.1| ribosomal protein L20 [Streptococcus pneumoniae CDC1087-00]
 gi|168490220|ref|ZP_02714419.1| ribosomal protein L20 [Streptococcus pneumoniae SP195]
 gi|168491050|ref|ZP_02715193.1| ribosomal protein L20 [Streptococcus pneumoniae CDC0288-04]
 gi|168494390|ref|ZP_02718533.1| ribosomal protein L20 [Streptococcus pneumoniae CDC3059-06]
 gi|168575623|ref|ZP_02721559.1| ribosomal protein L20 [Streptococcus pneumoniae MLV-016]
 gi|169833852|ref|YP_001694406.1| 50S ribosomal protein L20 [Streptococcus pneumoniae Hungary19A-6]
 gi|182683907|ref|YP_001835654.1| 50S ribosomal protein L20 [Streptococcus pneumoniae CGSP14]
 gi|194398245|ref|YP_002037596.1| 50S ribosomal protein L20 [Streptococcus pneumoniae G54]
 gi|221231724|ref|YP_002510876.1| 50S ribosomal protein L20 [Streptococcus pneumoniae ATCC 700669]
 gi|225854465|ref|YP_002735977.1| 50S ribosomal protein L20 [Streptococcus pneumoniae JJA]
 gi|225856619|ref|YP_002738130.1| 50S ribosomal protein L20 [Streptococcus pneumoniae P1031]
 gi|225858754|ref|YP_002740264.1| 50S ribosomal protein L20 [Streptococcus pneumoniae 70585]
 gi|225861152|ref|YP_002742661.1| 50S ribosomal protein L20 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650889|ref|ZP_04525141.1| 50S ribosomal protein L20 [Streptococcus pneumoniae CCRI 1974]
 gi|237821898|ref|ZP_04597743.1| 50S ribosomal protein L20 [Streptococcus pneumoniae CCRI 1974M2]
 gi|298229845|ref|ZP_06963526.1| 50S ribosomal protein L20 [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298254544|ref|ZP_06978130.1| 50S ribosomal protein L20 [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298503029|ref|YP_003724969.1| 50S ribosomal protein L20 [Streptococcus pneumoniae TCH8431/19A]
 gi|303254429|ref|ZP_07340535.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS455]
 gi|303259873|ref|ZP_07345848.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP-BS293]
 gi|303262287|ref|ZP_07348231.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP14-BS292]
 gi|303264709|ref|ZP_07350627.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS397]
 gi|303267238|ref|ZP_07353103.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS457]
 gi|303269524|ref|ZP_07355289.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS458]
 gi|307067618|ref|YP_003876584.1| hypothetical protein SPAP_0993 [Streptococcus pneumoniae AP200]
 gi|307127488|ref|YP_003879519.1| 50S ribosomal protein L20 [Streptococcus pneumoniae 670-6B]
 gi|54039130|sp|P66113|RL20_STRR6 RecName: Full=50S ribosomal protein L20
 gi|54041833|sp|P66112|RL20_STRPN RecName: Full=50S ribosomal protein L20
 gi|122278783|sp|Q04KW7|RL20_STRP2 RecName: Full=50S ribosomal protein L20
 gi|226730460|sp|B5E480|RL20_STRP4 RecName: Full=50S ribosomal protein L20
 gi|226730461|sp|B1IBC1|RL20_STRPI RecName: Full=50S ribosomal protein L20
 gi|226730462|sp|B2IPB5|RL20_STRPS RecName: Full=50S ribosomal protein L20
 gi|254800341|sp|C1C6T8|RL20_STRP7 RecName: Full=50S ribosomal protein L20
 gi|254800342|sp|B8ZP58|RL20_STRPJ RecName: Full=50S ribosomal protein L20
 gi|254800344|sp|C1CDV6|RL20_STRZJ RecName: Full=50S ribosomal protein L20
 gi|254800345|sp|C1CK42|RL20_STRZP RecName: Full=50S ribosomal protein L20
 gi|254800346|sp|C1CRT9|RL20_STRZT RecName: Full=50S ribosomal protein L20
 gi|14972435|gb|AAK75082.1| ribosomal protein L20 [Streptococcus pneumoniae TIGR4]
 gi|15458467|gb|AAK99667.1| 50S Ribosomal protein L20 [Streptococcus pneumoniae R6]
 gi|116077121|gb|ABJ54841.1| ribosomal protein L20 [Streptococcus pneumoniae D39]
 gi|147755602|gb|EDK62649.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP11-BS70]
 gi|147759448|gb|EDK66440.1| ribosomal protein L20 [Streptococcus pneumoniae SP14-BS69]
 gi|147762140|gb|EDK69102.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP18-BS74]
 gi|147764874|gb|EDK71803.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP19-BS75]
 gi|147923094|gb|EDK74209.1| ribosomal protein L20 [Streptococcus pneumoniae SP3-BS71]
 gi|147926082|gb|EDK77156.1| ribosomal protein L20 [Streptococcus pneumoniae SP6-BS73]
 gi|147928356|gb|EDK79372.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP9-BS68]
 gi|147930927|gb|EDK81907.1| ribosomal protein L20 [Streptococcus pneumoniae SP23-BS72]
 gi|168996354|gb|ACA36966.1| ribosomal protein L20 [Streptococcus pneumoniae Hungary19A-6]
 gi|172043473|gb|EDT51519.1| ribosomal protein L20 [Streptococcus pneumoniae CDC1873-00]
 gi|182629241|gb|ACB90189.1| 50S ribosomal protein L20 [Streptococcus pneumoniae CGSP14]
 gi|183570963|gb|EDT91491.1| ribosomal protein L20 [Streptococcus pneumoniae CDC1087-00]
 gi|183571420|gb|EDT91948.1| ribosomal protein L20 [Streptococcus pneumoniae SP195]
 gi|183574586|gb|EDT95114.1| ribosomal protein L20 [Streptococcus pneumoniae CDC0288-04]
 gi|183575637|gb|EDT96165.1| ribosomal protein L20 [Streptococcus pneumoniae CDC3059-06]
 gi|183578551|gb|EDT99079.1| ribosomal protein L20 [Streptococcus pneumoniae MLV-016]
 gi|194357912|gb|ACF56360.1| 50S ribosomal protein L20 [Streptococcus pneumoniae G54]
 gi|220674184|emb|CAR68712.1| 50S ribosomal protein L20 [Streptococcus pneumoniae ATCC 700669]
 gi|225720302|gb|ACO16156.1| ribosomal protein L20 [Streptococcus pneumoniae 70585]
 gi|225723595|gb|ACO19448.1| ribosomal protein L20 [Streptococcus pneumoniae JJA]
 gi|225726279|gb|ACO22131.1| ribosomal protein L20 [Streptococcus pneumoniae P1031]
 gi|225726453|gb|ACO22304.1| ribosomal protein L20 [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238624|gb|ADI69755.1| 50S ribosomal protein L20 [Streptococcus pneumoniae TCH8431/19A]
 gi|301794099|emb|CBW36505.1| 50S ribosomal protein L20 [Streptococcus pneumoniae INV104]
 gi|301799937|emb|CBW32520.1| 50S ribosomal protein L20 [Streptococcus pneumoniae OXC141]
 gi|302598596|gb|EFL65636.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS455]
 gi|302636610|gb|EFL67101.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP14-BS292]
 gi|302639078|gb|EFL69538.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP-BS293]
 gi|302640960|gb|EFL71342.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS458]
 gi|302643247|gb|EFL73529.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS457]
 gi|302645796|gb|EFL76025.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS397]
 gi|306409155|gb|ADM84582.1| hypothetical protein SPAP_0993 [Streptococcus pneumoniae AP200]
 gi|306484550|gb|ADM91419.1| ribosomal protein L20 [Streptococcus pneumoniae 670-6B]
 gi|327389239|gb|EGE87584.1| ribosomal protein L20 [Streptococcus pneumoniae GA04375]
 gi|332073294|gb|EGI83773.1| ribosomal protein L20 [Streptococcus pneumoniae GA17570]
 gi|332075577|gb|EGI86045.1| ribosomal protein L20 [Streptococcus pneumoniae GA17545]
 gi|332076235|gb|EGI86701.1| ribosomal protein L20 [Streptococcus pneumoniae GA41301]
 gi|332201427|gb|EGJ15497.1| ribosomal protein L20 [Streptococcus pneumoniae GA47368]
 gi|332202816|gb|EGJ16885.1| ribosomal protein L20 [Streptococcus pneumoniae GA41317]
 gi|332204964|gb|EGJ19029.1| ribosomal protein L20 [Streptococcus pneumoniae GA47901]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/106 (54%), Positives = 73/106 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+    +F
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDAVAF 106


>gi|329296186|ref|ZP_08253522.1| 50S ribosomal protein L20 [Plautia stali symbiont]
          Length = 118

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASIEIDRKILADIAVFDKVAFTALVEKAKSAL 117


>gi|225076637|ref|ZP_03719836.1| hypothetical protein NEIFLAOT_01687 [Neisseria flavescens
           NRL30031/H210]
 gi|241758581|ref|ZP_04756696.1| ribosomal protein L20 [Neisseria flavescens SK114]
 gi|261377869|ref|ZP_05982442.1| ribosomal protein L20 [Neisseria cinerea ATCC 14685]
 gi|261379894|ref|ZP_05984467.1| ribosomal protein L20 [Neisseria subflava NJ9703]
 gi|224952043|gb|EEG33252.1| hypothetical protein NEIFLAOT_01687 [Neisseria flavescens
           NRL30031/H210]
 gi|241321233|gb|EER57405.1| ribosomal protein L20 [Neisseria flavescens SK114]
 gi|269145719|gb|EEZ72137.1| ribosomal protein L20 [Neisseria cinerea ATCC 14685]
 gi|284797595|gb|EFC52942.1| ribosomal protein L20 [Neisseria subflava NJ9703]
          Length = 119

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+KV   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKVFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE +++ L
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRAAIEIDRKVLADLAVFDKAAFAQLVEKAKAAL 117


>gi|190149496|ref|YP_001968021.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|226730344|sp|B3H067|RL20_ACTP7 RecName: Full=50S ribosomal protein L20
 gi|189914627|gb|ACE60879.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
          Length = 117

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL K  + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKVSVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|50121347|ref|YP_050514.1| 50S ribosomal protein L20 [Pectobacterium atrosepticum SCRI1043]
 gi|227111542|ref|ZP_03825198.1| 50S ribosomal protein L20 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227327042|ref|ZP_03831066.1| 50S ribosomal protein L20 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|253688278|ref|YP_003017468.1| ribosomal protein L20 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261821454|ref|YP_003259560.1| 50S ribosomal protein L20 [Pectobacterium wasabiae WPP163]
 gi|60390384|sp|Q6D4H1|RL20_ERWCT RecName: Full=50S ribosomal protein L20
 gi|259646193|sp|C6DFY9|RL20_PECCP RecName: Full=50S ribosomal protein L20
 gi|49611873|emb|CAG75322.1| 50S ribosomal protein L20 [Pectobacterium atrosepticum SCRI1043]
 gi|251754856|gb|ACT12932.1| ribosomal protein L20 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261605467|gb|ACX87953.1| ribosomal protein L20 [Pectobacterium wasabiae WPP163]
          Length = 118

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKLAFSALVEKAKAAL 117


>gi|134101782|ref|YP_001107443.1| 50S ribosomal protein L20 [Saccharopolyspora erythraea NRRL 2338]
 gi|291009829|ref|ZP_06567802.1| 50S ribosomal protein L20 [Saccharopolyspora erythraea NRRL 2338]
 gi|166220742|sp|A4FKE3|RL20_SACEN RecName: Full=50S ribosomal protein L20
 gi|133914405|emb|CAM04518.1| 50S ribosomal subunit protein L20 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 122

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+SAKG+ G+R    R AK  +  S  Y+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTILESAKGYRGQRSRLYRKAKEQMLHSMTYSYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R   ++Y++F+ GL  AG+ +DRK+L++LA+    +F  +V+++R  L   
Sbjct: 61  WITRINAATRQNGMSYNRFVQGLKAAGVEVDRKILAELAVNDSQAFAALVDVARQNLPEG 120

Query: 121 VA 122
            A
Sbjct: 121 AA 122


>gi|328944548|ref|ZP_08242009.1| 50S ribosomal protein L20 [Atopobium vaginae DSM 15829]
 gi|327490949|gb|EGF22727.1| 50S ribosomal protein L20 [Atopobium vaginae DSM 15829]
          Length = 119

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/106 (51%), Positives = 69/106 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V    K + +++ +KG+YG    T R  K  V  S QYAYRDRR KKR+ R L
Sbjct: 1   MARVKRAVAGRKKRQTLVERSKGYYGVGSRTFRGMKEQVQHSLQYAYRDRRNKKREIRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAA R+ DL+YS F++GL  AG+ LDRKVL+ +A      F
Sbjct: 61  WIQRINAAARLNDLSYSTFMHGLKVAGVELDRKVLAQIACEDEQGF 106


>gi|24213944|ref|NP_711425.1| 50S ribosomal protein L20 [Leptospira interrogans serovar Lai str.
           56601]
 gi|45658303|ref|YP_002389.1| 50S ribosomal protein L20 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|31563145|sp|Q8F6Q7|RL20_LEPIN RecName: Full=50S ribosomal protein L20
 gi|60390497|sp|Q72PL0|RL20_LEPIC RecName: Full=50S ribosomal protein L20
 gi|24194801|gb|AAN48443.1| 50S ribosomal protein L20 [Leptospira interrogans serovar Lai str.
           56601]
 gi|45601545|gb|AAS71026.1| 50S ribosomal protein L20 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 117

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 72/111 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R   G +   + +++LK AKGF G R    R AK+AV ++ Q+AYRDRR KKRDFR L
Sbjct: 1   MPRAVNGTIHKNRRRRILKDAKGFRGARSKLYRTAKSAVMKAGQWAYRDRRAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R   L+YS F+N L K GI +DRK L++LA    + F  +VE
Sbjct: 61  WIIRINAAARENGLSYSVFMNSLKKLGIHMDRKSLAELAFNDREVFNSLVE 111


>gi|319651795|ref|ZP_08005920.1| 50S ribosomal protein L20 [Bacillus sp. 2_A_57_CT2]
 gi|317396447|gb|EFV77160.1| 50S ribosomal protein L20 [Bacillus sp. 2_A_57_CT2]
          Length = 119

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG++G +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVIKLAKGYFGSKHTLYKVANQQVMKSLMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           W+ RINAA R+  L+YS+ ++GL  AGI ++RK+L++LAI    +F ++  +++ +L
Sbjct: 61  WVTRINAAARMNGLSYSRLMHGLKLAGIEVNRKMLAELAIADEKAFAELASVAKQQL 117


>gi|291542635|emb|CBL15745.1| LSU ribosomal protein L20P [Ruminococcus bromii L2-63]
          Length = 116

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 78/115 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  + KK LK AKG++G +    + AK AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKGAMMTRKRRKKTLKLAKGYWGAKSRHFKMAKQAVMKSGNYAYIGRKQRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RI+AA +    NYS F+NGL KAGI L+RK+LS++AI+   +F  +VE +++
Sbjct: 61  WITRISAACKANGTNYSTFMNGLKKAGIALNRKMLSEIAISDPAAFTSLVEQAKN 115


>gi|212638373|ref|YP_002314893.1| 50S ribosomal protein L20 [Anoxybacillus flavithermus WK1]
 gi|226730351|sp|B7GGV3|RL20_ANOFW RecName: Full=50S ribosomal protein L20
 gi|212559853|gb|ACJ32908.1| Ribosomal protein L20 [Anoxybacillus flavithermus WK1]
          Length = 119

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG++G +    + A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRRRRKKILKLAKGYFGSKHRLYKVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  +++  L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLAGIEVNRKMLADLAVNDAAAFTQLANIAKENL 117


>gi|188533974|ref|YP_001907771.1| 50S ribosomal protein L20 [Erwinia tasmaniensis Et1/99]
 gi|226730398|sp|B2VEL7|RL20_ERWT9 RecName: Full=50S ribosomal protein L20
 gi|188029016|emb|CAO96884.1| 50S ribosomal protein L20 [Erwinia tasmaniensis Et1/99]
          Length = 118

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+     F  +VE +++ L
Sbjct: 61  WIARINAAARTNGISYSRFINGLKKASIEIDRKILADIAVFDKAVFAALVEKAKTAL 117


>gi|164687658|ref|ZP_02211686.1| hypothetical protein CLOBAR_01300 [Clostridium bartlettii DSM
           16795]
 gi|164603432|gb|EDQ96897.1| hypothetical protein CLOBAR_01300 [Clostridium bartlettii DSM
           16795]
          Length = 118

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  + +  KHKKVLK AKG+ G R    R A   V ++ + AY  R++KKRDFR L
Sbjct: 1   MARVKGAMNARKKHKKVLKLAKGYRGSRSKLYRPANTFVMKALKNAYIGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+  ++YS+ +NGL  AG+ ++RK+LS++AI     F ++VE+++++L
Sbjct: 61  WIQRINAAARMNGISYSRLMNGLKLAGVEVNRKMLSEMAIQDPAGFAQLVEVAKAKL 117


>gi|319440342|ref|ZP_07989498.1| 50S ribosomal protein L20 [Corynebacterium variabile DSM 44702]
          Length = 127

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++L  A G+ G+R    R AK  V  S+ YA+RDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREILNEASGYRGQRSRLYRKAKEQVLHSKTYAFRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R  D+ Y++ I GL  AGI +DRK L+++A++   +F  +VE +++ L  D
Sbjct: 61  WIQRINAAARANDITYNRLIQGLRLAGIEVDRKNLAEIAVSDPAAFTALVEAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|288918244|ref|ZP_06412599.1| ribosomal protein L20 [Frankia sp. EUN1f]
 gi|288350414|gb|EFC84636.1| ribosomal protein L20 [Frankia sp. EUN1f]
          Length = 126

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 79/119 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL++A G+ G+R    R AK  +  S  Y+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRREVLEAASGYRGQRSRLYRKAKEQMLHSMTYSYRDRRARKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L Y++F+ GL  AG+ +DRK+L+DLA+    +F  +VE++R+ L V
Sbjct: 61  WITRINAAARANGLTYNRFVQGLRLAGVEVDRKILADLAVNDAAAFAALVEVARAALPV 119


>gi|238749479|ref|ZP_04610984.1| 50S ribosomal protein L20 [Yersinia rohdei ATCC 43380]
 gi|238712134|gb|EEQ04347.1| 50S ribosomal protein L20 [Yersinia rohdei ATCC 43380]
          Length = 118

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKAAL 117


>gi|313665131|ref|YP_004047002.1| ribosomal protein L20 [Mycoplasma leachii PG50]
 gi|312949500|gb|ADR24096.1| ribosomal protein L20 [Mycoplasma leachii PG50]
          Length = 119

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ K+ +K AKG++G +K++ + A   V RS  YA+  R+ +KRDFRSL
Sbjct: 1   MARVKYGKVTRARRKRWIKLAKGYFGTKKSSYKKAHEQVIRSMAYAFIGRKERKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   L+YS F++GL  A I ++RK+LS+LAI   + FKKIV+ ++  L
Sbjct: 61  WIVRINAAVRPEGLSYSTFMHGLKLANININRKMLSELAINNNEEFKKIVKQAKKAL 117


>gi|167957093|ref|ZP_02544167.1| 50S ribosomal protein L20 [candidate division TM7 single-cell
           isolate TM7c]
          Length = 113

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 73/111 (65%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRGV + AKHKK+LK++ G    R  + R AK  V R+ QYAYRDRR KKRD R LWI
Sbjct: 2   RVKRGVTARAKHKKILKASAGMQHNRTRSFRLAKQGVIRALQYAYRDRRNKKRDLRGLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
            RINAA R     Y + I  +    I +DRK+L++LA+++  +F +IV+ S
Sbjct: 62  TRINAAARQEGTTYGKLIASMKSKNIEIDRKILAELAVSEPKAFAEIVKAS 112


>gi|268608875|ref|ZP_06142602.1| 50S ribosomal protein L20 [Ruminococcus flavefaciens FD-1]
          Length = 117

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K  +++  +  K LK AKG++G +    + AK AV +S QYAY  R+ KKR FR L
Sbjct: 1   MARIKGAMMTRKRRNKTLKLAKGYWGAKSKHFKMAKQAVMKSGQYAYIGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NG  KAGI L+RK+LS++AI     F  IVE +++ L
Sbjct: 61  WIARISAAAKLNGMNYSTFMNGCKKAGISLNRKMLSEIAINDAAGFTAIVEKAKAAL 117


>gi|197122311|ref|YP_002134262.1| 50S ribosomal protein L20 [Anaeromyxobacter sp. K]
 gi|220917093|ref|YP_002492397.1| ribosomal protein L20 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|226730350|sp|B4UAN7|RL20_ANASK RecName: Full=50S ribosomal protein L20
 gi|254800293|sp|B8J832|RL20_ANAD2 RecName: Full=50S ribosomal protein L20
 gi|196172160|gb|ACG73133.1| ribosomal protein L20 [Anaeromyxobacter sp. K]
 gi|219954947|gb|ACL65331.1| ribosomal protein L20 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 114

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 77/113 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK+G  +  +  +VLK AKGF GRRKN  R A  AV+R+  Y+ RDRR+K+R+FR+LWI
Sbjct: 2   RVKKGFKARRRRNRVLKLAKGFRGRRKNCYRRANQAVERALNYSTRDRRLKRREFRALWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
            RINAA R     YS+ +  L KAGI +DRK+L+DLA+     F  IV+ +++
Sbjct: 62  VRINAAARQNGTTYSKLVAALRKAGIEIDRKILADLALALPGDFAAIVKTAQA 114


>gi|171779889|ref|ZP_02920793.1| hypothetical protein STRINF_01676 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281237|gb|EDT46672.1| hypothetical protein STRINF_01676 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 119

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKSGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|206895235|ref|YP_002246955.1| ribosomal protein L20 [Coprothermobacter proteolyticus DSM 5265]
 gi|206737852|gb|ACI16930.1| ribosomal protein L20 [Coprothermobacter proteolyticus DSM 5265]
          Length = 117

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 74/109 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK  V   A+HKKVLK AKG++G      R A  AV ++ + A+  R+ +KRD RSLWI
Sbjct: 2   RVKTSVAKRARHKKVLKEAKGYFGASHRVYRKAHEAVLKAGEDAFAGRKQRKRDMRSLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
            RINAA R + +NYS F++GL  AGI +DRK+L++LA+T  + F  +VE
Sbjct: 62  TRINAAARNHGMNYSNFMHGLKVAGIQIDRKMLAELAVTDPEGFSALVE 110


>gi|256832337|ref|YP_003161064.1| 50S ribosomal protein L20 [Jonesia denitrificans DSM 20603]
 gi|256685868|gb|ACV08761.1| ribosomal protein L20 [Jonesia denitrificans DSM 20603]
          Length = 128

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y YRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTVLERASGYRGQRSRLYRKAKEQVTHSLVYNYRDRKRRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  AG+ +DR+VL++LA++ +++F  +V ++++ L  D
Sbjct: 61  WIQRINAAARAQGMTYNRFIQGLKAAGVEVDRRVLAELAVSDINAFNALVTVAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|163815464|ref|ZP_02206837.1| hypothetical protein COPEUT_01629 [Coprococcus eutactus ATCC 27759]
 gi|158449101|gb|EDP26096.1| hypothetical protein COPEUT_01629 [Coprococcus eutactus ATCC 27759]
 gi|295093747|emb|CBK82838.1| LSU ribosomal protein L20P [Coprococcus sp. ART55/1]
          Length = 118

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  KH KVLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARVKGGMNAKQKHNKVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YS+ ++GL  AG+ ++RK+LS++AI+  + F K+VE+++++L
Sbjct: 61  WIARINAAARMNDISYSKLMHGLKLAGVDINRKMLSEMAISDAEGFAKLVEVAKAQL 117


>gi|331697624|ref|YP_004333863.1| 50S ribosomal protein L20 [Pseudonocardia dioxanivorans CB1190]
 gi|326952313|gb|AEA26010.1| 50S ribosomal protein L20 [Pseudonocardia dioxanivorans CB1190]
          Length = 128

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 76/122 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L++A G+ G+R    R AK  +  S  YAYRDRR KK +FR L
Sbjct: 1   MARVKRAVNAQKKRRTTLEAASGYRGQRSRLYRKAKEQMLHSLNYAYRDRRAKKGEFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINA  R   + Y++FI GL  AG+ +DRK LS+LAI+   +F  +VEL+R+ +   
Sbjct: 61  WITRINAGARANGMTYNRFIQGLKAAGVEVDRKNLSELAISDPAAFTALVELARANVPAQ 120

Query: 121 VA 122
            A
Sbjct: 121 GA 122


>gi|237785424|ref|YP_002906129.1| 50S ribosomal protein L20 [Corynebacterium kroppenstedtii DSM
           44385]
 gi|259646178|sp|C4LID1|RL20_CORK4 RecName: Full=50S ribosomal protein L20
 gi|237758336|gb|ACR17586.1| 50S ribosomal protein L20 [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 126

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 77/121 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VLKSAKG+ G+R    R AK  +  S+ Y +RDRR KK DFR L
Sbjct: 1   MARVKRSVNAKKKRREVLKSAKGYRGQRSRLYRKAKEQMLHSKTYEFRDRRAKKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+DLA++   +F  +   ++  L  D
Sbjct: 61  WITRINAAARQNDMTYNRLIQGLRLAGVDIDRKNLADLAVSDEQAFSALCAAAKDALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|261344013|ref|ZP_05971658.1| ribosomal protein L20 [Providencia rustigianii DSM 4541]
 gi|282568405|gb|EFB73940.1| ribosomal protein L20 [Providencia rustigianii DSM 4541]
          Length = 118

 Score =  108 bits (269), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK++K AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKIMKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFSALVEKAKGAL 117


>gi|46446338|ref|YP_007703.1| 50S ribosomal protein L20 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|60390461|sp|Q6MDC1|RL20_PARUW RecName: Full=50S ribosomal protein L20
 gi|46399979|emb|CAF23428.1| probable ribosomal protein L20 [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 118

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 73/117 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + K++ K AKGF G RKN +R    AV R+  Y Y  R+ KKRDFRSL
Sbjct: 1   MVRATNAVASHRRKKRLFKLAKGFVGDRKNHLRLTSGAVMRAMAYNYAHRKQKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI R+NAA R+  ++YS+FI GL KA   LDRKVL+D+AI    SF  IV  ++  L
Sbjct: 61  WIMRLNAAARINGISYSKFIYGLKKAQCELDRKVLADMAIRDPGSFAAIVGFAKEAL 117


>gi|167856596|ref|ZP_02479298.1| 50S ribosomal protein L20 [Haemophilus parasuis 29755]
 gi|219871989|ref|YP_002476364.1| 50S ribosomal protein L20 [Haemophilus parasuis SH0165]
 gi|240949008|ref|ZP_04753362.1| 50S ribosomal protein L20 [Actinobacillus minor NM305]
 gi|257465352|ref|ZP_05629723.1| 50S ribosomal protein L20 [Actinobacillus minor 202]
 gi|254800325|sp|B8F7W4|RL20_HAEPS RecName: Full=50S ribosomal protein L20
 gi|167852277|gb|EDS23589.1| 50S ribosomal protein L20 [Haemophilus parasuis 29755]
 gi|219692193|gb|ACL33416.1| 50S ribosomal protein L20 [Haemophilus parasuis SH0165]
 gi|240296595|gb|EER47213.1| 50S ribosomal protein L20 [Actinobacillus minor NM305]
 gi|257451012|gb|EEV25055.1| 50S ribosomal protein L20 [Actinobacillus minor 202]
          Length = 117

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVVKAAQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +V  ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFAALVAKAKSAL 117


>gi|56421251|ref|YP_148569.1| 50S ribosomal protein L20 [Geobacillus kaustophilus HTA426]
 gi|261418269|ref|YP_003251951.1| 50S ribosomal protein L20 [Geobacillus sp. Y412MC61]
 gi|297529123|ref|YP_003670398.1| ribosomal protein L20 [Geobacillus sp. C56-T3]
 gi|319767771|ref|YP_004133272.1| ribosomal protein L20 [Geobacillus sp. Y412MC52]
 gi|81819648|sp|Q5KWD5|RL20_GEOKA RecName: Full=50S ribosomal protein L20
 gi|56381093|dbj|BAD77001.1| 50S ribosomal protein L20 [Geobacillus kaustophilus HTA426]
 gi|261374726|gb|ACX77469.1| ribosomal protein L20 [Geobacillus sp. Y412MC61]
 gi|297252375|gb|ADI25821.1| ribosomal protein L20 [Geobacillus sp. C56-T3]
 gi|317112637|gb|ADU95129.1| ribosomal protein L20 [Geobacillus sp. Y412MC52]
          Length = 119

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    R A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGPVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ ++GL  AG+ ++RK+L+DLA+    +F ++ +L+++ L
Sbjct: 61  WIVRINAAARQNGLSYSRLMHGLKLAGVEVNRKMLADLAVNDQAAFAQLADLAKANL 117


>gi|11467700|ref|NP_050752.1| ribosomal protein L20 [Guillardia theta]
 gi|6093981|sp|O78495|RK20_GUITH RecName: Full=50S ribosomal protein L20, chloroplastic
 gi|3603025|gb|AAC35686.1| ribosomal protein L20 [Guillardia theta]
          Length = 114

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 77/113 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRG ++  +HKK+LK AKGF G      R A   V ++ +Y Y  R+ +KR+FRSL
Sbjct: 1   MVRIKRGNIARKRHKKILKLAKGFRGSHSKLFRIANQQVMKALRYGYHGRKRRKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAAVR+   NYS FIN L +  I L+RK+L+ LA++  ++FK++ +++
Sbjct: 61  WITRINAAVRIEGTNYSCFINSLKRQHIALNRKMLAQLAVSDQNAFKQLTKIT 113


>gi|332637331|ref|ZP_08416194.1| 50S ribosomal protein L20P [Weissella cibaria KACC 11862]
          Length = 187

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/115 (47%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ KK++K AKG+ G+R    + AK  V +S  YA+RDR+  KR+FR LWI
Sbjct: 2   RVKGGTVTRARRKKMIKLAKGYRGQRHINYKVAKQQVWKSWFYAFRDRKQTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+  L+YS+F+NGL   G  L+RK+L+DLA++  ++F  + E S+  L
Sbjct: 62  ARINAAARMNGLSYSRFMNGLSLMGSTLNRKMLADLAVSDFEAFSALAEASKKAL 116


>gi|320159469|ref|YP_004172693.1| 50S ribosomal protein L20 [Anaerolinea thermophila UNI-1]
 gi|319993322|dbj|BAJ62093.1| 50S ribosomal protein L20 [Anaerolinea thermophila UNI-1]
          Length = 116

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/106 (51%), Positives = 71/106 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G     +HKK+LK  +G++G R    R A  A+ +S  YA RDRRV+KRD R L
Sbjct: 1   MARVKGGPKGHLRHKKILKMTEGYFGTRHRLFRRANEAMLKSLWYATRDRRVRKRDMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  L YSQFI+ L +AGI L+RKVL++LA+    +F
Sbjct: 61  WIARINAAARLNGLTYSQFIHALKQAGIALNRKVLANLAVRDPKAF 106


>gi|313681240|ref|YP_004058978.1| LSU ribosomal protein l20p [Sulfuricurvum kujiense DSM 16994]
 gi|313154100|gb|ADR32778.1| LSU ribosomal protein L20P [Sulfuricurvum kujiense DSM 16994]
          Length = 117

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/95 (57%), Positives = 68/95 (71%)

Query: 1  MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
          M RVK GVV   +HKKVLK A+GFY  R    R AK  ++RS  YA+RDR+ KKR+FR L
Sbjct: 1  MPRVKTGVVRRRRHKKVLKLARGFYSARHKHFRKAKEQLERSLVYAFRDRKQKKREFRKL 60

Query: 61 WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVL 95
          WI RINAA R+  ++YS F+NGL +A I LDRK+L
Sbjct: 61 WIIRINAACRLNGMSYSVFMNGLKRANIELDRKIL 95


>gi|298369381|ref|ZP_06980699.1| ribosomal protein L20 [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283384|gb|EFI24871.1| ribosomal protein L20 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 119

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTAHARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE +++ L
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKAAFAQLVEKAKAAL 117


>gi|83319552|ref|YP_424190.1| 50S ribosomal protein L20 [Mycoplasma capricolum subsp. capricolum
           ATCC 27343]
 gi|331703215|ref|YP_004399902.1| 50S ribosomal protein L20 [Mycoplasma mycoides subsp. capri LC str.
           95010]
 gi|109893122|sp|Q2SSS3|RL20_MYCCT RecName: Full=50S ribosomal protein L20
 gi|83283438|gb|ABC01370.1| 50S ribosomal protein L20 [Mycoplasma capricolum subsp. capricolum
           ATCC 27343]
 gi|256383816|gb|ACU78386.1| ribosomal protein L20 [Mycoplasma mycoides subsp. capri str. GM12]
 gi|256384646|gb|ACU79215.1| ribosomal protein L20 [Mycoplasma mycoides subsp. capri str. GM12]
 gi|296455302|gb|ADH21537.1| ribosomal protein L20 [synthetic Mycoplasma mycoides JCVI-syn1.0]
 gi|328801770|emb|CBW53923.1| 50S ribosomal protein L20 [Mycoplasma mycoides subsp. capri LC str.
           95010]
          Length = 119

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ K+ +K AKG++G +K++ + A   V RS  YA+  R+ +KRDFRSL
Sbjct: 1   MARVKYGKVTRARRKRWIKLAKGYFGTKKSSYKKAHEQVIRSMAYAFIGRKERKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   L+YS F++GL  A I ++RK+LS+LAI   + FK+IV+ ++  L
Sbjct: 61  WIVRINAAVRPEGLSYSTFMHGLKLANININRKMLSELAINNSEEFKQIVQQAKKAL 117


>gi|69248642|ref|ZP_00604787.1| Ribosomal protein L20, bacterial and organelle form [Enterococcus
           faecium DO]
 gi|257878891|ref|ZP_05658544.1| ribosomal protein L20 [Enterococcus faecium 1,230,933]
 gi|257881527|ref|ZP_05661180.1| ribosomal protein L20 [Enterococcus faecium 1,231,502]
 gi|257890749|ref|ZP_05670402.1| ribosomal protein L20 [Enterococcus faecium 1,231,410]
 gi|258615037|ref|ZP_05712807.1| 50S ribosomal protein L20 [Enterococcus faecium DO]
 gi|260558450|ref|ZP_05830646.1| ribosomal protein L20 [Enterococcus faecium C68]
 gi|261207172|ref|ZP_05921861.1| ribosomal protein L20 [Enterococcus faecium TC 6]
 gi|289565293|ref|ZP_06445744.1| 50S ribosomal protein L20 [Enterococcus faecium D344SRF]
 gi|293560313|ref|ZP_06676810.1| ribosomal protein L20 [Enterococcus faecium E1162]
 gi|293567754|ref|ZP_06679095.1| ribosomal protein L20 [Enterococcus faecium E1071]
 gi|294615066|ref|ZP_06694952.1| ribosomal protein L20 [Enterococcus faecium E1636]
 gi|294617096|ref|ZP_06696763.1| ribosomal protein L20 [Enterococcus faecium E1679]
 gi|294620926|ref|ZP_06700127.1| ribosomal protein L20 [Enterococcus faecium U0317]
 gi|314938985|ref|ZP_07846250.1| ribosomal protein L20 [Enterococcus faecium TX0133a04]
 gi|314943464|ref|ZP_07850231.1| ribosomal protein L20 [Enterococcus faecium TX0133C]
 gi|314948243|ref|ZP_07851637.1| ribosomal protein L20 [Enterococcus faecium TX0082]
 gi|314951603|ref|ZP_07854649.1| ribosomal protein L20 [Enterococcus faecium TX0133A]
 gi|314991534|ref|ZP_07857010.1| ribosomal protein L20 [Enterococcus faecium TX0133B]
 gi|314994867|ref|ZP_07859994.1| ribosomal protein L20 [Enterococcus faecium TX0133a01]
 gi|68194367|gb|EAN08876.1| Ribosomal protein L20, bacterial and organelle form [Enterococcus
           faecium DO]
 gi|257813119|gb|EEV41877.1| ribosomal protein L20 [Enterococcus faecium 1,230,933]
 gi|257817185|gb|EEV44513.1| ribosomal protein L20 [Enterococcus faecium 1,231,502]
 gi|257827109|gb|EEV53735.1| ribosomal protein L20 [Enterococcus faecium 1,231,410]
 gi|260075624|gb|EEW63930.1| ribosomal protein L20 [Enterococcus faecium C68]
 gi|260078800|gb|EEW66502.1| ribosomal protein L20 [Enterococcus faecium TC 6]
 gi|289162949|gb|EFD10798.1| 50S ribosomal protein L20 [Enterococcus faecium D344SRF]
 gi|291589339|gb|EFF21146.1| ribosomal protein L20 [Enterococcus faecium E1071]
 gi|291592008|gb|EFF23631.1| ribosomal protein L20 [Enterococcus faecium E1636]
 gi|291596654|gb|EFF27880.1| ribosomal protein L20 [Enterococcus faecium E1679]
 gi|291599537|gb|EFF30553.1| ribosomal protein L20 [Enterococcus faecium U0317]
 gi|291605763|gb|EFF35200.1| ribosomal protein L20 [Enterococcus faecium E1162]
 gi|313590849|gb|EFR69694.1| ribosomal protein L20 [Enterococcus faecium TX0133a01]
 gi|313593818|gb|EFR72663.1| ribosomal protein L20 [Enterococcus faecium TX0133B]
 gi|313596297|gb|EFR75142.1| ribosomal protein L20 [Enterococcus faecium TX0133A]
 gi|313597836|gb|EFR76681.1| ribosomal protein L20 [Enterococcus faecium TX0133C]
 gi|313641694|gb|EFS06274.1| ribosomal protein L20 [Enterococcus faecium TX0133a04]
 gi|313645376|gb|EFS09956.1| ribosomal protein L20 [Enterococcus faecium TX0082]
          Length = 119

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+VLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKRVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKVAEIDINRKMLADLAVNDAAAFTALADQAKEAL 117


>gi|323351274|ref|ZP_08086930.1| 50S ribosomal protein L20 [Streptococcus sanguinis VMC66]
 gi|322122498|gb|EFX94209.1| 50S ribosomal protein L20 [Streptococcus sanguinis VMC66]
          Length = 119

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKILADLAVN 101


>gi|33519814|ref|NP_878646.1| 50S ribosomal protein L20 [Candidatus Blochmannia floridanus]
 gi|39931817|sp|Q7VR68|RL20_BLOFL RecName: Full=50S ribosomal protein L20
 gi|33504159|emb|CAD83421.1| 50S ribosomal subunit protein L20 [Candidatus Blochmannia
           floridanus]
          Length = 118

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 74/111 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V + ++HKK+LK A G+YG R  T R A  A+ ++ QYAYRDR+ KKR FR L
Sbjct: 1   MVRVKNSVTAHSRHKKILKRATGYYGARSRTYRVAYQAIIKAGQYAYRDRKQKKRIFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI  INA  R Y L+Y+  IN L+K+ I ++RK+L++LA +   +F  +V 
Sbjct: 61  WISHINAVARQYGLSYNNLINNLYKSSIYINRKMLAELATSDQVAFLNLVN 111


>gi|37526557|ref|NP_929901.1| 50S ribosomal protein L20 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|39931728|sp|Q7N3P9|RL20_PHOLL RecName: Full=50S ribosomal protein L20
 gi|36785988|emb|CAE15040.1| 50S ribosomal protein L20 [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 118

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FI+GL KA I +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSRFIDGLKKASIEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|302866850|ref|YP_003835487.1| 50S ribosomal protein L20 [Micromonospora aurantiaca ATCC 27029]
 gi|315503265|ref|YP_004082152.1| ribosomal protein l20 [Micromonospora sp. L5]
 gi|302569709|gb|ADL45911.1| ribosomal protein L20 [Micromonospora aurantiaca ATCC 27029]
 gi|315409884|gb|ADU08001.1| ribosomal protein L20 [Micromonospora sp. L5]
          Length = 130

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S QY+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTLLETASGYRGQRSRLYRKAKEQVLHSMQYSYRDRRDRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R   L Y++ I GL  AGI +DRK+L+D+A+    +F  IVEL+R
Sbjct: 61  WIQRINAGARANGLTYNRLIQGLRLAGIEVDRKILADMAVNDAAAFAAIVELAR 114


>gi|15676621|ref|NP_273765.1| 50S ribosomal protein L20 [Neisseria meningitidis MC58]
 gi|296314676|ref|ZP_06864617.1| ribosomal protein L20 [Neisseria polysaccharea ATCC 43768]
 gi|14195131|sp|Q9K093|RL20_NEIMB RecName: Full=50S ribosomal protein L20
 gi|7225950|gb|AAF41136.1| 50S ribosomal protein L20 [Neisseria meningitidis MC58]
 gi|296838505|gb|EFH22443.1| ribosomal protein L20 [Neisseria polysaccharea ATCC 43768]
 gi|316983704|gb|EFV62685.1| ribosomal protein L20 [Neisseria meningitidis H44/76]
 gi|325140122|gb|EGC62651.1| ribosomal protein L20 [Neisseria meningitidis CU385]
 gi|325141983|gb|EGC64420.1| ribosomal protein L20 [Neisseria meningitidis 961-5945]
 gi|325197942|gb|ADY93398.1| ribosomal protein L20 [Neisseria meningitidis G2136]
 gi|325200593|gb|ADY96048.1| ribosomal protein L20 [Neisseria meningitidis H44/76]
          Length = 119

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE +++ L
Sbjct: 61  WIVRINAGTRENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKAAFAQLVEKAKAAL 117


>gi|309800231|ref|ZP_07694410.1| ribosomal protein L20 [Streptococcus infantis SK1302]
 gi|308116139|gb|EFO53636.1| ribosomal protein L20 [Streptococcus infantis SK1302]
          Length = 119

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARINGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|111115011|ref|YP_709629.1| 50S ribosomal protein L20 [Borrelia afzelii PKo]
 gi|216263994|ref|ZP_03435988.1| ribosomal protein L20 [Borrelia afzelii ACA-1]
 gi|110890285|gb|ABH01453.1| ribosomal protein L20 [Borrelia afzelii PKo]
 gi|215980038|gb|EEC20860.1| ribosomal protein L20 [Borrelia afzelii ACA-1]
          Length = 115

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G V  A+ K++LK  KGF+G +K+  + AK  + +   YA RDR+ +KRDFR L
Sbjct: 1   MARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRKTRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RI+AA+    ++YS+FI GL K+ I ++RK+LS+LAI  +++FKKIV
Sbjct: 61  WISRISAALSDTGVSYSRFIEGLLKSNIKINRKILSNLAIEDIEAFKKIV 110


>gi|322372881|ref|ZP_08047417.1| ribosomal protein L20 [Streptococcus sp. C150]
 gi|321277923|gb|EFX54992.1| ribosomal protein L20 [Streptococcus sp. C150]
          Length = 119

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|55821143|ref|YP_139585.1| 50S ribosomal protein L20 [Streptococcus thermophilus LMG 18311]
 gi|55823054|ref|YP_141495.1| 50S ribosomal protein L20 [Streptococcus thermophilus CNRZ1066]
 gi|116627858|ref|YP_820477.1| 50S ribosomal protein L20 [Streptococcus thermophilus LMD-9]
 gi|228477492|ref|ZP_04062128.1| ribosomal protein L20 [Streptococcus salivarius SK126]
 gi|312862899|ref|ZP_07723139.1| ribosomal protein L20 [Streptococcus vestibularis F0396]
 gi|322516718|ref|ZP_08069627.1| 50S ribosomal protein L20 [Streptococcus vestibularis ATCC 49124]
 gi|81820293|sp|Q5LZL9|RL20_STRT1 RecName: Full=50S ribosomal protein L20
 gi|81820455|sp|Q5M472|RL20_STRT2 RecName: Full=50S ribosomal protein L20
 gi|122267545|sp|Q03KJ1|RL20_STRTD RecName: Full=50S ribosomal protein L20
 gi|55737128|gb|AAV60770.1| 50S ribosomal protein L20 [Streptococcus thermophilus LMG 18311]
 gi|55739039|gb|AAV62680.1| 50S ribosomal protein L20 [Streptococcus thermophilus CNRZ1066]
 gi|116101135|gb|ABJ66281.1| LSU ribosomal protein L20P [Streptococcus thermophilus LMD-9]
 gi|228250927|gb|EEK10115.1| ribosomal protein L20 [Streptococcus salivarius SK126]
 gi|311101759|gb|EFQ59962.1| ribosomal protein L20 [Streptococcus vestibularis F0396]
 gi|312278439|gb|ADQ63096.1| 50S ribosomal protein L20 [Streptococcus thermophilus ND03]
 gi|322124751|gb|EFX96189.1| 50S ribosomal protein L20 [Streptococcus vestibularis ATCC 49124]
          Length = 119

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|251782185|ref|YP_002996487.1| 50S ribosomal protein L20 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390814|dbj|BAH81273.1| 50S ribosomal protein L20 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|322411521|gb|EFY02429.1| 50S ribosomal protein L20 [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
 gi|323127039|gb|ADX24336.1| 50S ribosomal protein L20 [Streptococcus dysgalactiae subsp.
           equisimilis ATCC 12394]
          Length = 119

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA++
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVS 101


>gi|225022604|ref|ZP_03711796.1| hypothetical protein CORMATOL_02646 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305682065|ref|ZP_07404869.1| ribosomal protein L20 [Corynebacterium matruchotii ATCC 14266]
 gi|224944512|gb|EEG25721.1| hypothetical protein CORMATOL_02646 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305658538|gb|EFM48041.1| ribosomal protein L20 [Corynebacterium matruchotii ATCC 14266]
          Length = 127

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 77/121 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++LKSAKG+ G+R    R AK     S  Y+YRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREILKSAKGYRGQRSRLYRKAKEQWLHSMTYSYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+  + Y++ I GL  A I +DRK+L+DLA+    +F  I E +++ L  D
Sbjct: 61  WITRINAAARMNGITYNRLIQGLRLAEIEVDRKILADLAVNDFAAFSVICEAAKAALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|23465929|ref|NP_696532.1| 50S ribosomal protein L20 [Bifidobacterium longum NCC2705]
 gi|213691796|ref|YP_002322382.1| ribosomal protein L20 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|296454371|ref|YP_003661514.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|31563169|sp|Q8G4L1|RL20_BIFLO RecName: Full=50S ribosomal protein L20
 gi|254800301|sp|B7GQC4|RL20_BIFLI RecName: Full=50S ribosomal protein L20
 gi|23326638|gb|AAN25168.1| 50S ribosomal protein L20 [Bifidobacterium longum NCC2705]
 gi|213523257|gb|ACJ52004.1| ribosomal protein L20 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|296183802|gb|ADH00684.1| ribosomal protein L20 [Bifidobacterium longum subsp. longum JDM301]
 gi|320457890|dbj|BAJ68511.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 127

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L+++A++  ++FK IV+ +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAEIAVSDPNTFKTIVDAAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|108799945|ref|YP_640142.1| 50S ribosomal protein L20 [Mycobacterium sp. MCS]
 gi|119869055|ref|YP_939007.1| 50S ribosomal protein L20 [Mycobacterium sp. KMS]
 gi|126435573|ref|YP_001071264.1| 50S ribosomal protein L20 [Mycobacterium sp. JLS]
 gi|122976853|sp|Q1B7P8|RL20_MYCSS RecName: Full=50S ribosomal protein L20
 gi|166219663|sp|A3Q0U6|RL20_MYCSJ RecName: Full=50S ribosomal protein L20
 gi|166219664|sp|A1UHA9|RL20_MYCSK RecName: Full=50S ribosomal protein L20
 gi|108770364|gb|ABG09086.1| LSU ribosomal protein L20P [Mycobacterium sp. MCS]
 gi|119695144|gb|ABL92217.1| LSU ribosomal protein L20P [Mycobacterium sp. KMS]
 gi|126235373|gb|ABN98773.1| LSU ribosomal protein L20P [Mycobacterium sp. JLS]
          Length = 129

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAQKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+++A++   +F  +VE++++ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLAEIAVSDAAAFTALVEVAKAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|108760663|ref|YP_631782.1| 50S ribosomal protein L20 [Myxococcus xanthus DK 1622]
 gi|123074305|sp|Q1D6E1|RL20_MYXXD RecName: Full=50S ribosomal protein L20
 gi|108464543|gb|ABF89728.1| ribosomal protein L20 [Myxococcus xanthus DK 1622]
          Length = 115

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 71/104 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK+GV +  +  ++LK AKG+ GRRKN  + A  AV+R+  YA RDR  +KRDFR LWI
Sbjct: 2   RVKKGVKARRRRNRILKLAKGYRGRRKNCYKRANEAVERALDYASRDRMQRKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
            RINAA R   L+YS+ I GL KA I LDRKVLSD+AI     F
Sbjct: 62  VRINAAARTVGLSYSKLIAGLAKAKIGLDRKVLSDMAIADPSGF 105


>gi|22537529|ref|NP_688380.1| 50S ribosomal protein L20 [Streptococcus agalactiae 2603V/R]
 gi|25011494|ref|NP_735889.1| 50S ribosomal protein L20 [Streptococcus agalactiae NEM316]
 gi|76788134|ref|YP_330023.1| 50S ribosomal protein L20 [Streptococcus agalactiae A909]
 gi|76797728|ref|ZP_00779996.1| ribosomal protein L20 [Streptococcus agalactiae 18RS21]
 gi|77407199|ref|ZP_00784173.1| ribosomal protein L20 [Streptococcus agalactiae H36B]
 gi|77409878|ref|ZP_00786503.1| ribosomal protein L20 [Streptococcus agalactiae COH1]
 gi|77412097|ref|ZP_00788422.1| ribosomal protein L20 [Streptococcus agalactiae CJB111]
 gi|77414728|ref|ZP_00790857.1| ribosomal protein L20 [Streptococcus agalactiae 515]
 gi|288905558|ref|YP_003430780.1| ribosomal protein L20 [Streptococcus gallolyticus UCN34]
 gi|306831646|ref|ZP_07464803.1| 50S ribosomal protein L20 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|306833788|ref|ZP_07466913.1| 50S ribosomal protein L20 [Streptococcus bovis ATCC 700338]
 gi|325978549|ref|YP_004288265.1| 50S ribosomal protein L20 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|54039129|sp|P66111|RL20_STRA5 RecName: Full=50S ribosomal protein L20
 gi|54041832|sp|P66110|RL20_STRA3 RecName: Full=50S ribosomal protein L20
 gi|109893157|sp|Q3K0D0|RL20_STRA1 RecName: Full=50S ribosomal protein L20
 gi|22534410|gb|AAN00253.1|AE014255_11 ribosomal protein L20 [Streptococcus agalactiae 2603V/R]
 gi|24413032|emb|CAD47111.1| 50S ribosomal protein L20 [Streptococcus agalactiae NEM316]
 gi|76563191|gb|ABA45775.1| ribosomal protein L20 [Streptococcus agalactiae A909]
 gi|76586952|gb|EAO63442.1| ribosomal protein L20 [Streptococcus agalactiae 18RS21]
 gi|77159214|gb|EAO70396.1| ribosomal protein L20 [Streptococcus agalactiae 515]
 gi|77161853|gb|EAO72839.1| ribosomal protein L20 [Streptococcus agalactiae CJB111]
 gi|77171513|gb|EAO74757.1| ribosomal protein L20 [Streptococcus agalactiae COH1]
 gi|77174190|gb|EAO77085.1| ribosomal protein L20 [Streptococcus agalactiae H36B]
 gi|288732284|emb|CBI13851.1| ribosomal protein L20 [Streptococcus gallolyticus UCN34]
 gi|304423982|gb|EFM27123.1| 50S ribosomal protein L20 [Streptococcus bovis ATCC 700338]
 gi|304426071|gb|EFM29186.1| 50S ribosomal protein L20 [Streptococcus gallolyticus subsp.
           gallolyticus TX20005]
 gi|319745338|gb|EFV97653.1| 50S ribosomal protein L20 [Streptococcus agalactiae ATCC 13813]
 gi|325178477|emb|CBZ48521.1| 50S ribosomal protein L20 [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 119

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|225548525|ref|ZP_03769573.1| ribosomal protein L20 [Borrelia burgdorferi 94a]
 gi|225370788|gb|EEH00223.1| ribosomal protein L20 [Borrelia burgdorferi 94a]
          Length = 115

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 77/110 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G V  A+ K++LK  KGF+G +K+  + AK  + +   YA RDR+V+KRDFR L
Sbjct: 1   MARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLRKGMMYATRDRKVRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WI RI+AA+    + YS+FI GL K+ I ++RK+LS+LAI  +++FKKIV
Sbjct: 61  WILRISAALSDTGVTYSRFIEGLLKSNIKINRKILSNLAIEDVEAFKKIV 110


>gi|15606270|ref|NP_213649.1| 50S ribosomal protein L20 [Aquifex aeolicus VF5]
 gi|6225975|sp|O67086|RL20_AQUAE RecName: Full=50S ribosomal protein L20
 gi|2983472|gb|AAC07052.1| ribosomal protein L20 [Aquifex aeolicus VF5]
          Length = 118

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/88 (57%), Positives = 67/88 (76%)

Query: 23  GFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFING 82
           G+ G+R  + R AK AV R+  Y YRDR+++KR+FR LWI RINAAVR Y LNYS FING
Sbjct: 21  GYRGQRSRSYRRAKEAVMRALYYQYRDRKLRKREFRRLWIARINAAVRAYGLNYSTFING 80

Query: 83  LHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           L KAGI LDRK+L+D+A+    +F+++V
Sbjct: 81  LKKAGIELDRKILADMAVRDPQAFEQVV 108


>gi|22125798|ref|NP_669221.1| 50S ribosomal protein L20 [Yersinia pestis KIM 10]
 gi|45442008|ref|NP_993547.1| 50S ribosomal protein L20 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51596663|ref|YP_070854.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis IP 32953]
 gi|108807770|ref|YP_651686.1| 50S ribosomal protein L20 [Yersinia pestis Antiqua]
 gi|108812047|ref|YP_647814.1| 50S ribosomal protein L20 [Yersinia pestis Nepal516]
 gi|145598023|ref|YP_001162099.1| 50S ribosomal protein L20 [Yersinia pestis Pestoides F]
 gi|149365661|ref|ZP_01887696.1| 50S ribosomal protein L20 [Yersinia pestis CA88-4125]
 gi|153947105|ref|YP_001400692.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis IP 31758]
 gi|162419875|ref|YP_001607029.1| 50S ribosomal protein L20 [Yersinia pestis Angola]
 gi|165927521|ref|ZP_02223353.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939532|ref|ZP_02228078.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011787|ref|ZP_02232685.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210504|ref|ZP_02236539.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400939|ref|ZP_02306445.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422078|ref|ZP_02313831.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425028|ref|ZP_02316781.1| ribosomal protein L20 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170024062|ref|YP_001720567.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis YPIII]
 gi|186895719|ref|YP_001872831.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis PB1/+]
 gi|218929519|ref|YP_002347394.1| 50S ribosomal protein L20 [Yersinia pestis CO92]
 gi|229837957|ref|ZP_04458116.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229895118|ref|ZP_04510294.1| 50S ribosomal subunit protein L20 [Yersinia pestis Pestoides A]
 gi|229898518|ref|ZP_04513663.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902359|ref|ZP_04517479.1| 50S ribosomal subunit protein L20 [Yersinia pestis Nepal516]
 gi|270490461|ref|ZP_06207535.1| ribosomal protein L20 [Yersinia pestis KIM D27]
 gi|294503568|ref|YP_003567630.1| 50S ribosomal protein L20 [Yersinia pestis Z176003]
 gi|20978603|sp|Q8ZDW8|RL20_YERPE RecName: Full=50S ribosomal protein L20
 gi|60390352|sp|Q669Z3|RL20_YERPS RecName: Full=50S ribosomal protein L20
 gi|122383263|sp|Q1C731|RL20_YERPA RecName: Full=50S ribosomal protein L20
 gi|122384740|sp|Q1CIG6|RL20_YERPN RecName: Full=50S ribosomal protein L20
 gi|166220806|sp|A4TIL4|RL20_YERPP RecName: Full=50S ribosomal protein L20
 gi|166984824|sp|A7FHG4|RL20_YERP3 RecName: Full=50S ribosomal protein L20
 gi|226730479|sp|B2K665|RL20_YERPB RecName: Full=50S ribosomal protein L20
 gi|226730480|sp|A9R0A5|RL20_YERPG RecName: Full=50S ribosomal protein L20
 gi|226730481|sp|B1JJ20|RL20_YERPY RecName: Full=50S ribosomal protein L20
 gi|21958724|gb|AAM85472.1|AE013793_8 50S ribosomal subunit protein L20 [Yersinia pestis KIM 10]
 gi|45436871|gb|AAS62424.1| 50S ribosomal protein L20 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51589945|emb|CAH21577.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis IP 32953]
 gi|108775695|gb|ABG18214.1| LSU ribosomal protein L20P [Yersinia pestis Nepal516]
 gi|108779683|gb|ABG13741.1| LSU ribosomal protein L20P [Yersinia pestis Antiqua]
 gi|115348130|emb|CAL21058.1| 50S ribosomal protein L20 [Yersinia pestis CO92]
 gi|145209719|gb|ABP39126.1| LSU ribosomal protein L20P [Yersinia pestis Pestoides F]
 gi|149292074|gb|EDM42148.1| 50S ribosomal protein L20 [Yersinia pestis CA88-4125]
 gi|152958600|gb|ABS46061.1| ribosomal protein L20 [Yersinia pseudotuberculosis IP 31758]
 gi|162352690|gb|ABX86638.1| ribosomal protein L20 [Yersinia pestis Angola]
 gi|165912581|gb|EDR31212.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165920576|gb|EDR37853.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989252|gb|EDR41553.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207684|gb|EDR52164.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958890|gb|EDR55911.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049792|gb|EDR61200.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056215|gb|EDR65993.1| ribosomal protein L20 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169750596|gb|ACA68114.1| ribosomal protein L20 [Yersinia pseudotuberculosis YPIII]
 gi|186698745|gb|ACC89374.1| ribosomal protein L20 [Yersinia pseudotuberculosis PB1/+]
 gi|229680694|gb|EEO76790.1| 50S ribosomal subunit protein L20 [Yersinia pestis Nepal516]
 gi|229688066|gb|EEO80137.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229694323|gb|EEO84370.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701880|gb|EEO89903.1| 50S ribosomal subunit protein L20 [Yersinia pestis Pestoides A]
 gi|262361610|gb|ACY58331.1| 50S ribosomal protein L20 [Yersinia pestis D106004]
 gi|262365649|gb|ACY62206.1| 50S ribosomal protein L20 [Yersinia pestis D182038]
 gi|270338965|gb|EFA49742.1| ribosomal protein L20 [Yersinia pestis KIM D27]
 gi|294354027|gb|ADE64368.1| 50S ribosomal protein L20 [Yersinia pestis Z176003]
 gi|320015087|gb|ADV98658.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 118

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKAAL 117


>gi|149276296|ref|ZP_01882440.1| 50S ribosomal protein L20 [Pedobacter sp. BAL39]
 gi|149232816|gb|EDM38191.1| 50S ribosomal protein L20 [Pedobacter sp. BAL39]
          Length = 114

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 72/111 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KKVL  AKG++G R      AK  V++  QYAYRDR+VKKR+FR L
Sbjct: 1   MPRSVNAVASRRRRKKVLNLAKGYWGSRSKVFTIAKNTVEKGLQYAYRDRKVKKREFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R + ++YSQ I  L    I L+RKVL+DLA+   ++FK +++
Sbjct: 61  WIQRINAGARQHGISYSQLIGKLASKNIGLNRKVLADLAMNHPEAFKAVID 111


>gi|159037500|ref|YP_001536753.1| ribosomal protein L20 [Salinispora arenicola CNS-205]
 gi|189041881|sp|A8LY45|RL20_SALAI RecName: Full=50S ribosomal protein L20
 gi|157916335|gb|ABV97762.1| ribosomal protein L20 [Salinispora arenicola CNS-205]
          Length = 130

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 75/115 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L +A G+ G+R    R AK  V  S QY+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTLLATASGYRGQRSRLYRKAKEQVLHSMQYSYRDRRDRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINA  R   L Y++ I GL  AG+ +DRK+L+DLA+    +F  IVEL+R+
Sbjct: 61  WIQRINAGARANGLTYNRLIQGLKLAGVEVDRKILADLAVNDAAAFAAIVELARA 115


>gi|306967738|ref|ZP_07480399.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu009]
 gi|308354667|gb|EFP43518.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu009]
          Length = 129

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK+++G+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSILKASRGYGGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  AG+ +DRK L+D+AI+   +F  +V+++R+ L  D
Sbjct: 61  WIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|304404964|ref|ZP_07386624.1| ribosomal protein L20 [Paenibacillus curdlanolyticus YK9]
 gi|304345843|gb|EFM11677.1| ribosomal protein L20 [Paenibacillus curdlanolyticus YK9]
          Length = 119

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V + + K++LK AKG++G +    + AK  V +S  YAYRDRR  KRDFR L
Sbjct: 1   MARVKGGFVRARRRKRILKLAKGYFGSKHRLFKTAKEQVMKSLLYAYRDRRQVKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+Y++F+ GL  AGI ++RK+L+DLA+  +++F  +  +++ ++
Sbjct: 61  WIVRINAAARLNGLSYNKFMYGLKLAGIEVNRKILADLAVNDINAFNSLAGVAKQKI 117


>gi|296270013|ref|YP_003652645.1| 50S ribosomal protein L20 [Thermobispora bispora DSM 43833]
 gi|296092800|gb|ADG88752.1| ribosomal protein L20 [Thermobispora bispora DSM 43833]
          Length = 129

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 77/121 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKR + +  K + +L+ A G+ G+R    R AK  V  S  YAYRDR+ +K  FR L
Sbjct: 1   MTRVKRALNAKKKRRVILEQASGYRGQRSRLYRKAKEQVLHSMTYAYRDRKDRKGAFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  AGI +DRK+L+DLA+    +F  +VE ++  L  D
Sbjct: 61  WIQRINAAARANGMTYNRFIQGLRLAGIEVDRKILADLAVNDAKTFATLVESAKKALPSD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|15608781|ref|NP_216159.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis H37Rv]
 gi|15841099|ref|NP_336136.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis CDC1551]
 gi|31792830|ref|NP_855323.1| 50S ribosomal protein L20 [Mycobacterium bovis AF2122/97]
 gi|121637551|ref|YP_977774.1| 50S ribosomal protein L20 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148661439|ref|YP_001282962.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis H37Ra]
 gi|148822851|ref|YP_001287605.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis F11]
 gi|167968403|ref|ZP_02550680.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis H37Ra]
 gi|215404055|ref|ZP_03416236.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis 02_1987]
 gi|215411289|ref|ZP_03420097.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis 94_M4241A]
 gi|215426962|ref|ZP_03424881.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T92]
 gi|215430535|ref|ZP_03428454.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis EAS054]
 gi|215445824|ref|ZP_03432576.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T85]
 gi|218753349|ref|ZP_03532145.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis GM 1503]
 gi|219557562|ref|ZP_03536638.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T17]
 gi|224990026|ref|YP_002644713.1| 50S ribosomal protein L20 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253799317|ref|YP_003032318.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN
           1435]
 gi|254231844|ref|ZP_04925171.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis C]
 gi|254364492|ref|ZP_04980538.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254550649|ref|ZP_05141096.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260200706|ref|ZP_05768197.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T46]
 gi|260204912|ref|ZP_05772403.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis K85]
 gi|289443097|ref|ZP_06432841.1| LSU ribosomal protein L20 [Mycobacterium tuberculosis T46]
 gi|289554582|ref|ZP_06443792.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN 605]
 gi|289569690|ref|ZP_06449917.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis T17]
 gi|289574312|ref|ZP_06454539.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis K85]
 gi|289745919|ref|ZP_06505297.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis 02_1987]
 gi|289750191|ref|ZP_06509569.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis T92]
 gi|289753731|ref|ZP_06513109.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis EAS054]
 gi|289757747|ref|ZP_06517125.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T85]
 gi|289761794|ref|ZP_06521172.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis GM 1503]
 gi|294996593|ref|ZP_06802284.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis 210]
 gi|297634196|ref|ZP_06951976.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis KZN 4207]
 gi|297731183|ref|ZP_06960301.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis KZN R506]
 gi|298525141|ref|ZP_07012550.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis
           94_M4241A]
 gi|306775830|ref|ZP_07414167.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu001]
 gi|306779643|ref|ZP_07417980.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu002]
 gi|306784374|ref|ZP_07422696.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu003]
 gi|306788743|ref|ZP_07427065.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu004]
 gi|306793079|ref|ZP_07431381.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu005]
 gi|306797460|ref|ZP_07435762.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu006]
 gi|306803339|ref|ZP_07440007.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu008]
 gi|306807921|ref|ZP_07444589.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu007]
 gi|306971936|ref|ZP_07484597.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu010]
 gi|307079652|ref|ZP_07488822.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu011]
 gi|307084224|ref|ZP_07493337.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu012]
 gi|313658515|ref|ZP_07815395.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis KZN V2475]
 gi|54039126|sp|P66106|RL20_MYCBO RecName: Full=50S ribosomal protein L20
 gi|54041830|sp|P66105|RL20_MYCTU RecName: Full=50S ribosomal protein L20
 gi|166219661|sp|A1KJ60|RL20_MYCBP RecName: Full=50S ribosomal protein L20
 gi|166219665|sp|A5U300|RL20_MYCTA RecName: Full=50S ribosomal protein L20
 gi|254800331|sp|C1ANR6|RL20_MYCBT RecName: Full=50S ribosomal protein L20
 gi|1838994|emb|CAB06637.1| Probable 50S ribosomal protein L20 RplT [Mycobacterium tuberculosis
           H37Rv]
 gi|13881314|gb|AAK45950.1| ribosomal protein L20 [Mycobacterium tuberculosis CDC1551]
 gi|31618420|emb|CAD96338.1| 50S ribosomal protein L20 rplT [Mycobacterium bovis AF2122/97]
 gi|121493198|emb|CAL71669.1| 50S ribosomal protein L20 rplT [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124600903|gb|EAY59913.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis C]
 gi|134150006|gb|EBA42051.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148505591|gb|ABQ73400.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis H37Ra]
 gi|148721378|gb|ABR06003.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis F11]
 gi|224773139|dbj|BAH25945.1| 50S ribosomal protein L20 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253320820|gb|ACT25423.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN
           1435]
 gi|289416016|gb|EFD13256.1| LSU ribosomal protein L20 [Mycobacterium tuberculosis T46]
 gi|289439214|gb|EFD21707.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN 605]
 gi|289538743|gb|EFD43321.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis K85]
 gi|289543444|gb|EFD47092.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis T17]
 gi|289686447|gb|EFD53935.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis 02_1987]
 gi|289690778|gb|EFD58207.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis T92]
 gi|289694318|gb|EFD61747.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis EAS054]
 gi|289709300|gb|EFD73316.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis GM 1503]
 gi|289713311|gb|EFD77323.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T85]
 gi|298494935|gb|EFI30229.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215745|gb|EFO75144.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu001]
 gi|308327412|gb|EFP16263.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu002]
 gi|308330922|gb|EFP19773.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu003]
 gi|308334692|gb|EFP23543.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu004]
 gi|308338534|gb|EFP27385.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu005]
 gi|308342204|gb|EFP31055.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu006]
 gi|308345730|gb|EFP34581.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu007]
 gi|308350030|gb|EFP38881.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu008]
 gi|308358623|gb|EFP47474.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu010]
 gi|308362549|gb|EFP51400.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu011]
 gi|308366169|gb|EFP55020.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu012]
 gi|323719904|gb|EGB29017.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis
           CDC1551A]
 gi|326903258|gb|EGE50191.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis W-148]
 gi|328459068|gb|AEB04491.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN
           4207]
          Length = 129

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK+++G+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  AG+ +DRK L+D+AI+   +F  +V+++R+ L  D
Sbjct: 61  WIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|238922261|ref|YP_002935775.1| large subunit ribosomal protein L20 [Eubacterium eligens ATCC
           27750]
 gi|238873933|gb|ACR73641.1| large subunit ribosomal protein L20 [Eubacterium eligens ATCC
           27750]
          Length = 118

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y+ R+ KKR FR L
Sbjct: 1   MARIKGGLNAKKKHNRVLKLAKGYRGARSKQYRVAKQSVMRALTESYKGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+ GL  A I L+RKVLS++A+   + F K+ E+++S+L
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLANIDLNRKVLSEMAVNDAEGFAKLAEVAKSKL 117


>gi|296140118|ref|YP_003647361.1| ribosomal protein L20 [Tsukamurella paurometabola DSM 20162]
 gi|296028252|gb|ADG79022.1| ribosomal protein L20 [Tsukamurella paurometabola DSM 20162]
          Length = 126

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 79/121 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+++KG+ G+R    R AK     S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSILEASKGYRGQRSRLYRKAKEQQLHSMTYAYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++F+ GL  AG+ +DRK L++LA++   +F  +V++++  L  D
Sbjct: 61  WITRINAAARANDITYNRFMQGLKLAGVEVDRKNLAELAVSDSAAFTALVDIAKKALPAD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|78186010|ref|YP_374053.1| 50S ribosomal protein L20 [Chlorobium luteolum DSM 273]
 gi|109893132|sp|Q3B6M1|RL20_PELLD RecName: Full=50S ribosomal protein L20
 gi|78165912|gb|ABB23010.1| LSU ribosomal protein L20P [Chlorobium luteolum DSM 273]
          Length = 115

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 75/111 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M +    V S A+ K+VLK AKG++G R N +   K AVD+ +QYAYRDRR KKR FRSL
Sbjct: 1   MPKANNAVASKARRKRVLKKAKGYWGSRGNILTVVKHAVDKGEQYAYRDRRAKKRSFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R+    YS+ ++ + K  + +DRK ++++A+   ++F ++V+
Sbjct: 61  WIIRINAAARLNGTTYSRLMDAMIKKNVEIDRKTMAEIAVRDPEAFTQLVK 111


>gi|242239480|ref|YP_002987661.1| ribosomal protein L20 [Dickeya dadantii Ech703]
 gi|242131537|gb|ACS85839.1| ribosomal protein L20 [Dickeya dadantii Ech703]
          Length = 118

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 65/111 (58%), Positives = 81/111 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVE 111


>gi|317491933|ref|ZP_07950367.1| ribosomal protein L20 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920054|gb|EFV41379.1| ribosomal protein L20 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 118

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKV+K AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVMKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|261408922|ref|YP_003245163.1| 50S ribosomal protein L20 [Paenibacillus sp. Y412MC10]
 gi|315649036|ref|ZP_07902130.1| ribosomal protein L20 [Paenibacillus vortex V453]
 gi|329922248|ref|ZP_08277950.1| ribosomal protein L20 [Paenibacillus sp. HGF5]
 gi|261285385|gb|ACX67356.1| ribosomal protein L20 [Paenibacillus sp. Y412MC10]
 gi|315275717|gb|EFU39071.1| ribosomal protein L20 [Paenibacillus vortex V453]
 gi|328942285|gb|EGG38555.1| ribosomal protein L20 [Paenibacillus sp. HGF5]
          Length = 119

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK AKG++G +    + A   V +S  YAYRDRR  KR+FR L
Sbjct: 1   MARVKGGFVVRRRHKKVLKLAKGYFGSKHRIFKTANEQVMKSLVYAYRDRRNTKRNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ ++GL  AG+ ++RK+L+DLA+  L++F  +  +++ ++
Sbjct: 61  WIVRINAAARQNGLSYSKLMHGLKLAGVDINRKMLADLAVNDLNAFNSLATVAKEKV 117


>gi|187250762|ref|YP_001875244.1| 50S ribosomal protein L20 [Elusimicrobium minutum Pei191]
 gi|254800323|sp|B2KB85|RL20_ELUMP RecName: Full=50S ribosomal protein L20
 gi|186970922|gb|ACC97907.1| Ribosomal protein L20 [Elusimicrobium minutum Pei191]
          Length = 118

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/112 (50%), Positives = 76/112 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+K  V   A+ KKVLK A G+YG +   +R A   VD+S  +AY  R+ KK  +R LWI
Sbjct: 2   RIKFSVARHARKKKVLKRASGYYGDKSRRLRMATQQVDKSLVHAYTGRKDKKHQYRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
            RINAAVR   LNYS FINGL K+ I L+RK+LS++AI    SFKK+V++++
Sbjct: 62  TRINAAVREEGLNYSNFINGLAKSNITLNRKMLSEMAIQDPLSFKKLVDVAK 113


>gi|86158396|ref|YP_465181.1| 50S ribosomal protein L20 [Anaeromyxobacter dehalogenans 2CP-C]
 gi|109893094|sp|Q2IJB1|RL20_ANADE RecName: Full=50S ribosomal protein L20
 gi|85774907|gb|ABC81744.1| LSU ribosomal protein L20P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 114

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 77/113 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK+G  +  +  +VLK AKGF GRRKN  R A  AV+R+  Y+ RDRR+K+R+FR+LWI
Sbjct: 2   RVKKGFKARRRRNRVLKLAKGFRGRRKNCYRRANQAVERALNYSTRDRRLKRREFRALWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
            RINAA R     YS+ +  L KAG+ +DRK+L+DLA+     F  IV+ +++
Sbjct: 62  VRINAAARQNGTTYSKLVAALRKAGVEIDRKILADLALALPGDFAAIVKTAQA 114


>gi|152976956|ref|YP_001376473.1| 50S ribosomal protein L20 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189041848|sp|A7GTM0|RL20_BACCN RecName: Full=50S ribosomal protein L20
 gi|152025708|gb|ABS23478.1| ribosomal protein L20 [Bacillus cytotoxicus NVH 391-98]
          Length = 118

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK++K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKMIKLAKGYYGSKHTLFKVANQQVMKSLLYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  ++++ L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLAGIEVNRKMLADLAVHDEKAFAELATVAKNNL 117


>gi|260186591|ref|ZP_05764065.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis CPHL_A]
 gi|289447253|ref|ZP_06436997.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis CPHL_A]
 gi|289420211|gb|EFD17412.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis CPHL_A]
          Length = 129

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK+++G+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  AG+ +DRK L+D+AI+   +F  +V+++R+ L  D
Sbjct: 61  WIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPED 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|146311383|ref|YP_001176457.1| 50S ribosomal protein L20 [Enterobacter sp. 638]
 gi|166984734|sp|A4W9M6|RL20_ENT38 RecName: Full=50S ribosomal protein L20
 gi|145318259|gb|ABP60406.1| LSU ribosomal protein L20P [Enterobacter sp. 638]
          Length = 118

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKLAFTALVEKAKAAL 117


>gi|59800746|ref|YP_207458.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA 1090]
 gi|161869665|ref|YP_001598832.1| 50S ribosomal protein L20 [Neisseria meningitidis 053442]
 gi|194098023|ref|YP_002001071.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae NCCP11945]
 gi|218767845|ref|YP_002342357.1| 50S ribosomal protein L20 [Neisseria meningitidis Z2491]
 gi|239998487|ref|ZP_04718411.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 35/02]
 gi|240013612|ref|ZP_04720525.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae DGI18]
 gi|240016051|ref|ZP_04722591.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA6140]
 gi|240080193|ref|ZP_04724736.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA19]
 gi|240112406|ref|ZP_04726896.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae MS11]
 gi|240115146|ref|ZP_04729208.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID18]
 gi|240117430|ref|ZP_04731492.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID1]
 gi|240120682|ref|ZP_04733644.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID24-1]
 gi|240122986|ref|ZP_04735942.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID332]
 gi|240125238|ref|ZP_04738124.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-92-679]
 gi|240127692|ref|ZP_04740353.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-93-1035]
 gi|254493206|ref|ZP_05106377.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 1291]
 gi|254804604|ref|YP_003082825.1| 50S ribosomal protein L20 [Neisseria meningitidis alpha14]
 gi|255066460|ref|ZP_05318315.1| ribosomal protein L20 [Neisseria sicca ATCC 29256]
 gi|260441036|ref|ZP_05794852.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae DGI2]
 gi|261365584|ref|ZP_05978467.1| ribosomal protein L20 [Neisseria mucosa ATCC 25996]
 gi|268594346|ref|ZP_06128513.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 35/02]
 gi|268596342|ref|ZP_06130509.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA19]
 gi|268598469|ref|ZP_06132636.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae MS11]
 gi|268600822|ref|ZP_06134989.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID18]
 gi|268603127|ref|ZP_06137294.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID1]
 gi|268681608|ref|ZP_06148470.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID332]
 gi|268683836|ref|ZP_06150698.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-92-679]
 gi|268686077|ref|ZP_06152939.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-93-1035]
 gi|291044368|ref|ZP_06570077.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae DGI2]
 gi|293399554|ref|ZP_06643707.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae F62]
 gi|294670483|ref|ZP_06735363.1| hypothetical protein NEIELOOT_02201 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|304387975|ref|ZP_07370147.1| 50S ribosomal protein L20 [Neisseria meningitidis ATCC 13091]
 gi|14195130|sp|Q9JVA1|RL20_NEIMA RecName: Full=50S ribosomal protein L20
 gi|81311240|sp|Q5F9U1|RL20_NEIG1 RecName: Full=50S ribosomal protein L20
 gi|189041872|sp|A9M378|RL20_NEIM0 RecName: Full=50S ribosomal protein L20
 gi|226730427|sp|B4RJY6|RL20_NEIG2 RecName: Full=50S ribosomal protein L20
 gi|59717641|gb|AAW89046.1| putative 50S ribosomal protein L20 [Neisseria gonorrhoeae FA 1090]
 gi|121051853|emb|CAM08159.1| putative 50S ribosomal protein L20 [Neisseria meningitidis Z2491]
 gi|161595218|gb|ABX72878.1| 50S ribosomal protein L20 [Neisseria meningitidis 053442]
 gi|193933313|gb|ACF29137.1| putative 50S ribosomal protein L20 [Neisseria gonorrhoeae
           NCCP11945]
 gi|226512246|gb|EEH61591.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 1291]
 gi|254668146|emb|CBA04777.1| 50S ribosomal protein L20 [Neisseria meningitidis alpha14]
 gi|254671881|emb|CBA04129.1| 50S ribosomal protein L20 [Neisseria meningitidis alpha275]
 gi|255049340|gb|EET44804.1| ribosomal protein L20 [Neisseria sicca ATCC 29256]
 gi|261392908|emb|CAX50489.1| 50S ribosomal protein L20 [Neisseria meningitidis 8013]
 gi|268547735|gb|EEZ43153.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 35/02]
 gi|268550130|gb|EEZ45149.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA19]
 gi|268582600|gb|EEZ47276.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae MS11]
 gi|268584953|gb|EEZ49629.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID18]
 gi|268587258|gb|EEZ51934.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID1]
 gi|268621892|gb|EEZ54292.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID332]
 gi|268624120|gb|EEZ56520.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-92-679]
 gi|268626361|gb|EEZ58761.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-93-1035]
 gi|288565908|gb|EFC87468.1| ribosomal protein L20 [Neisseria mucosa ATCC 25996]
 gi|291011262|gb|EFE03258.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae DGI2]
 gi|291307762|gb|EFE49005.1| hypothetical protein NEIELOOT_02201 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291610123|gb|EFF39245.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae F62]
 gi|304337974|gb|EFM04112.1| 50S ribosomal protein L20 [Neisseria meningitidis ATCC 13091]
 gi|308388912|gb|ADO31232.1| putative 50S ribosomal protein L20 [Neisseria meningitidis
           alpha710]
 gi|317163765|gb|ADV07306.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae TCDC-NG08107]
 gi|319410092|emb|CBY90428.1| 50S ribosomal protein L20 [Neisseria meningitidis WUE 2594]
 gi|325127771|gb|EGC50679.1| ribosomal protein L20 [Neisseria meningitidis N1568]
 gi|325133763|gb|EGC56419.1| ribosomal protein L20 [Neisseria meningitidis M13399]
 gi|325136054|gb|EGC58664.1| ribosomal protein L20 [Neisseria meningitidis M0579]
 gi|325144074|gb|EGC66382.1| ribosomal protein L20 [Neisseria meningitidis M01-240013]
 gi|325202481|gb|ADY97935.1| ribosomal protein L20 [Neisseria meningitidis M01-240149]
 gi|325203810|gb|ADY99263.1| ribosomal protein L20 [Neisseria meningitidis M01-240355]
 gi|325206435|gb|ADZ01888.1| ribosomal protein L20 [Neisseria meningitidis M04-240196]
 gi|325207767|gb|ADZ03219.1| ribosomal protein L20 [Neisseria meningitidis NZ-05/33]
          Length = 119

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE +++ L
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKAAFAQLVEKAKAAL 117


>gi|307105035|gb|EFN53286.1| hypothetical protein CHLNCDRAFT_25913 [Chlorella variabilis]
          Length = 133

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 70/99 (70%)

Query: 16  KVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLN 75
           KV K AKGF GR KN IR A+  V++S QYA+RDRR KKRD RSLWI RI A  R Y + 
Sbjct: 5   KVFKLAKGFRGRAKNCIRIARERVEKSLQYAFRDRRTKKRDMRSLWITRITAGSRQYGVK 64

Query: 76  YSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           YS+ I+GL +  I ++RK+LS+LA+ +  SFK +V+  R
Sbjct: 65  YSELIHGLKQENIQINRKMLSELAMNEPYSFKALVDQVR 103


>gi|146321129|ref|YP_001200840.1| 50S ribosomal protein L20 [Streptococcus suis 98HAH33]
 gi|253751996|ref|YP_003025137.1| 50S ribosomal protein L20 [Streptococcus suis SC84]
 gi|253753821|ref|YP_003026962.1| 50S ribosomal protein L20 [Streptococcus suis P1/7]
 gi|253755303|ref|YP_003028443.1| 50S ribosomal protein L20 [Streptococcus suis BM407]
 gi|330832533|ref|YP_004401358.1| 50S ribosomal protein L20 [Streptococcus suis ST3]
 gi|166220795|sp|A4W251|RL20_STRS2 RecName: Full=50S ribosomal protein L20
 gi|145691935|gb|ABP92440.1| Ribosomal protein L20 [Streptococcus suis 98HAH33]
 gi|251816285|emb|CAZ51913.1| 50S ribosomal protein L20 [Streptococcus suis SC84]
 gi|251817767|emb|CAZ55519.1| 50S ribosomal protein L20 [Streptococcus suis BM407]
 gi|251820067|emb|CAR46320.1| 50S ribosomal protein L20 [Streptococcus suis P1/7]
 gi|292558578|gb|ADE31579.1| ribosomal protein L20 [Streptococcus suis GZ1]
 gi|319758362|gb|ADV70304.1| 50S ribosomal protein L20 [Streptococcus suis JS14]
 gi|329306756|gb|AEB81172.1| 50S ribosomal protein L20 [Streptococcus suis ST3]
          Length = 119

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHLLFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|330443793|ref|YP_004376779.1| 50S ribosomal protein L20 [Chlamydophila pecorum E58]
 gi|328806903|gb|AEB41076.1| ribosomal protein L20 [Chlamydophila pecorum E58]
          Length = 122

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 76/117 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + K++LK AKGF+G RK  IR +++ V R+  + Y  R+ +K DFRSL
Sbjct: 1   MVRATGSVASRRRRKRILKQAKGFWGDRKGHIRQSRSCVMRAMAFNYMHRKDRKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI R+N A R++ L+YS+ INGL  AGI L+RK+LS++AI     F  + E ++S L
Sbjct: 61  WIMRLNVAARIHGLSYSRLINGLKCAGITLNRKMLSEMAIHNPQGFAAVAEQAKSAL 117


>gi|255659701|ref|ZP_05405110.1| ribosomal protein L20 [Mitsuokella multacida DSM 20544]
 gi|260848275|gb|EEX68282.1| ribosomal protein L20 [Mitsuokella multacida DSM 20544]
          Length = 117

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 78/115 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  +HKK+LK AKG+ G +    + A   V ++  YA RDRR KK +FR L
Sbjct: 1   MPRVKVGVTAHRRHKKILKLAKGYKGSKSKQFKKANETVMKALYYARRDRRAKKGNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R   ++YS+ INGL KAG+ ++RK+L+DLAI+   +F ++V +++ 
Sbjct: 61  WIARINAAARTNGISYSKLINGLTKAGVEVNRKMLADLAISDEKAFAQLVAVAKE 115


>gi|325687202|gb|EGD29224.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK72]
          Length = 119

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|312867636|ref|ZP_07727842.1| ribosomal protein L20 [Streptococcus parasanguinis F0405]
 gi|311096699|gb|EFQ54937.1| ribosomal protein L20 [Streptococcus parasanguinis F0405]
          Length = 119

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|257877208|ref|ZP_05656861.1| ribosomal protein L20 [Enterococcus casseliflavus EC20]
 gi|257811374|gb|EEV40194.1| ribosomal protein L20 [Enterococcus casseliflavus EC20]
          Length = 119

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 76/117 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ + GL  A I ++RK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIARINAAARMNGLSYSKLMYGLKLAEIDINRKMLADLAVNDAAAFTALADQAKDAL 117


>gi|196019826|ref|XP_002119049.1| hypothetical protein TRIADDRAFT_9980 [Trichoplax adhaerens]
 gi|190577166|gb|EDV18464.1| hypothetical protein TRIADDRAFT_9980 [Trichoplax adhaerens]
          Length = 93

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/92 (57%), Positives = 66/92 (71%)

Query: 26  GRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHK 85
           GR KN  R A   V++  QYAYRDRR KKRDFR+LWIQRINAA R + L YSQFI G+  
Sbjct: 2   GRAKNCFRVAIQRVEKGLQYAYRDRRTKKRDFRALWIQRINAATRAHGLAYSQFIKGIKL 61

Query: 86  AGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           AGI L+RK+LS+LAI   D+F +I+  ++  L
Sbjct: 62  AGITLNRKMLSELAIHNADAFNQILNKAQEAL 93


>gi|315221376|ref|ZP_07863297.1| ribosomal protein L20 [Streptococcus anginosus F0211]
 gi|315189495|gb|EFU23189.1| ribosomal protein L20 [Streptococcus anginosus F0211]
          Length = 119

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|255531807|ref|YP_003092179.1| 50S ribosomal protein L20 [Pedobacter heparinus DSM 2366]
 gi|255344791|gb|ACU04117.1| ribosomal protein L20 [Pedobacter heparinus DSM 2366]
          Length = 114

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 72/111 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KKVL  AKG++G R      AK  V++  QYAYRDR+VKKR+FR L
Sbjct: 1   MPRSVNAVASRRRRKKVLNLAKGYWGSRSKVFTIAKNTVEKGLQYAYRDRKVKKREFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WIQRINA  R + ++YSQ I  L    I L+RKVL+DLA+   ++FK +++
Sbjct: 61  WIQRINAGARQHGISYSQLIGKLAAKNIGLNRKVLADLAMNHPEAFKAVID 111


>gi|227550909|ref|ZP_03980958.1| ribosomal protein L20 [Enterococcus faecium TX1330]
 gi|257885799|ref|ZP_05665452.1| ribosomal protein L20 [Enterococcus faecium 1,231,501]
 gi|257887842|ref|ZP_05667495.1| ribosomal protein L20 [Enterococcus faecium 1,141,733]
 gi|257893360|ref|ZP_05673013.1| ribosomal protein L20 [Enterococcus faecium 1,231,408]
 gi|257896540|ref|ZP_05676193.1| ribosomal protein L20 [Enterococcus faecium Com12]
 gi|257899521|ref|ZP_05679174.1| ribosomal protein L20 [Enterococcus faecium Com15]
 gi|293379320|ref|ZP_06625466.1| ribosomal protein L20 [Enterococcus faecium PC4.1]
 gi|293556931|ref|ZP_06675492.1| ribosomal protein L20 [Enterococcus faecium E1039]
 gi|293572982|ref|ZP_06683924.1| ribosomal protein L20 [Enterococcus faecium E980]
 gi|227180007|gb|EEI60979.1| ribosomal protein L20 [Enterococcus faecium TX1330]
 gi|257821655|gb|EEV48785.1| ribosomal protein L20 [Enterococcus faecium 1,231,501]
 gi|257823896|gb|EEV50828.1| ribosomal protein L20 [Enterococcus faecium 1,141,733]
 gi|257829739|gb|EEV56346.1| ribosomal protein L20 [Enterococcus faecium 1,231,408]
 gi|257833105|gb|EEV59526.1| ribosomal protein L20 [Enterococcus faecium Com12]
 gi|257837433|gb|EEV62507.1| ribosomal protein L20 [Enterococcus faecium Com15]
 gi|291601015|gb|EFF31306.1| ribosomal protein L20 [Enterococcus faecium E1039]
 gi|291606884|gb|EFF36264.1| ribosomal protein L20 [Enterococcus faecium E980]
 gi|292642116|gb|EFF60280.1| ribosomal protein L20 [Enterococcus faecium PC4.1]
          Length = 119

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+VLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKRVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKVAEIDINRKMLADLAVNDAAAFTALADQAKDAL 117


>gi|322385724|ref|ZP_08059368.1| 50S ribosomal protein L20 [Streptococcus cristatus ATCC 51100]
 gi|321270462|gb|EFX53378.1| 50S ribosomal protein L20 [Streptococcus cristatus ATCC 51100]
          Length = 119

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|153004744|ref|YP_001379069.1| 50S ribosomal protein L20 [Anaeromyxobacter sp. Fw109-5]
 gi|166219604|sp|A7HBI9|RL20_ANADF RecName: Full=50S ribosomal protein L20
 gi|152028317|gb|ABS26085.1| ribosomal protein L20 [Anaeromyxobacter sp. Fw109-5]
          Length = 114

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 71/104 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK+G  +  +  +VLK AKGF GRRKN  R A  AV+R+  YA RDRR K+RDFR+LWI
Sbjct: 2   RVKKGYKARRRRNRVLKLAKGFRGRRKNCYRRANQAVERALDYATRDRRQKRRDFRALWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
            RINAA R     YS+ + GL KAG+ +DRK+L+DLA+     F
Sbjct: 62  VRINAAARQNGTTYSRLLAGLKKAGVAIDRKILADLALALPGDF 105


>gi|307706459|ref|ZP_07643268.1| ribosomal protein L20 [Streptococcus mitis SK321]
 gi|307618169|gb|EFN97327.1| ribosomal protein L20 [Streptococcus mitis SK321]
          Length = 119

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAIT 101
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+ 
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVN 101


>gi|195977987|ref|YP_002123231.1| 50S ribosomal protein L20 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|225868681|ref|YP_002744629.1| 50S ribosomal protein L20 [Streptococcus equi subsp. zooepidemicus]
 gi|225870362|ref|YP_002746309.1| 50S ribosomal protein L20 [Streptococcus equi subsp. equi 4047]
 gi|270292935|ref|ZP_06199146.1| ribosomal protein L20 [Streptococcus sp. M143]
 gi|289167804|ref|YP_003446073.1| 50S ribosomal protein L20 [Streptococcus mitis B6]
 gi|306829313|ref|ZP_07462503.1| 50S ribosomal protein L20 [Streptococcus mitis ATCC 6249]
 gi|307704691|ref|ZP_07641590.1| ribosomal protein L20 [Streptococcus mitis SK597]
 gi|307708593|ref|ZP_07645057.1| ribosomal protein L20 [Streptococcus mitis NCTC 12261]
 gi|307709142|ref|ZP_07645601.1| ribosomal protein L20 [Streptococcus mitis SK564]
 gi|319939327|ref|ZP_08013687.1| 50S ribosomal protein L20 [Streptococcus anginosus 1_2_62CV]
 gi|319946725|ref|ZP_08020959.1| 50S ribosomal protein L20 [Streptococcus australis ATCC 700641]
 gi|322376455|ref|ZP_08050948.1| ribosomal protein L20 [Streptococcus sp. M334]
 gi|322388181|ref|ZP_08061785.1| 50S ribosomal protein L20 [Streptococcus infantis ATCC 700779]
 gi|322389276|ref|ZP_08062836.1| 50S ribosomal protein L20 [Streptococcus parasanguinis ATCC 903]
 gi|226730456|sp|B4U2K1|RL20_STREM RecName: Full=50S ribosomal protein L20
 gi|254800340|sp|C0M8T1|RL20_STRE4 RecName: Full=50S ribosomal protein L20
 gi|259646199|sp|C0MGL8|RL20_STRS7 RecName: Full=50S ribosomal protein L20
 gi|195974692|gb|ACG62218.1| 50S ribosomal protein L20 RplT [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225699766|emb|CAW93548.1| 50S ribosomal protein L20 [Streptococcus equi subsp. equi 4047]
 gi|225701957|emb|CAW99498.1| 50S ribosomal protein L20 [Streptococcus equi subsp. zooepidemicus]
 gi|270278914|gb|EFA24760.1| ribosomal protein L20 [Streptococcus sp. M143]
 gi|288907371|emb|CBJ22208.1| 50S ribosomal protein L20 [Streptococcus mitis B6]
 gi|301801804|emb|CBW34515.1| 50S ribosomal protein L20 [Streptococcus pneumoniae INV200]
 gi|304428399|gb|EFM31489.1| 50S ribosomal protein L20 [Streptococcus mitis ATCC 6249]
 gi|307615342|gb|EFN94551.1| ribosomal protein L20 [Streptococcus mitis NCTC 12261]
 gi|307620088|gb|EFN99205.1| ribosomal protein L20 [Streptococcus mitis SK564]
 gi|307621