PSIBLAST alignment of GI: 254780318 and protein with PDB id: 2j01

gi|116668252|pdb|2J01|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 118
>gi|116668313|pdb|2J03|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4). This File Contains The 50s Subunit From Molecule Ii. Length = 118
 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 79/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K GVV   KHKK+LK AKG++G R  + R A+  +  +  YAY  R+ +KRDFR L
Sbjct: 1   MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R + LNYS FI+GL KAGI +DRK L+DLA+ +   F ++VE +++ 
Sbjct: 61  WIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAA 116