PSIBLAST alignment of GI: 254780318 and protein with PDB id: 3fin

>gi|224510796|pdb|3FIN|U Chain U, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 117
 Score =  138 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 78/115 (67%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R K GVV   KHKK+LK AKG++G R  + R A+  +  +  YAY  R+ +KRDFR LW
Sbjct: 1   PRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           I RINAA R + LNYS FI+GL KAGI +DRK L+DLA+ +   F ++VE +++ 
Sbjct: 61  IVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAA 115