BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780318|ref|YP_003064731.1| ribosomal protein L20
[Candidatus Liberibacter asiaticus str. psy62]
         (123 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|312113591|ref|YP_004011187.1| ribosomal protein L20 [Rhodomicrobium vannielii ATCC 17100]
 gi|311218720|gb|ADP70088.1| ribosomal protein L20 [Rhodomicrobium vannielii ATCC 17100]
          Length = 124

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 80/123 (65%), Positives = 97/123 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL+ AKGFYGRRKNTIR AK AV++S QYAYRDRR KKR+FRSL
Sbjct: 1   MSRVKRGVAAHARHKKVLEQAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRRTKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R + L Y +FI+GL+KAGI +DRKVLSD+AIT    F  +V  +R  L  +
Sbjct: 61  WIQRINAATREHGLTYGRFIDGLNKAGIEIDRKVLSDMAITDPTGFAALVGKAREALPAE 120

Query: 121 VAS 123
           + S
Sbjct: 121 LQS 123


>gi|308176902|ref|YP_003916308.1| 50S ribosomal protein L20 [Arthrobacter arilaitensis Re117]
 gi|307744365|emb|CBT75337.1| 50S ribosomal protein L20 [Arthrobacter arilaitensis Re117]
          Length = 215

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/122 (42%), Positives = 78/122 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ AKG+ G+R    R AK  +  S  Y++ DRR +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERAKGYRGQRSRLYRKAKEQLLHSFVYSFNDRRKRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DR++L++LA++  ++F  +V++++  L  D
Sbjct: 61  WIQRINAASRANGMTYNRLIQGLKAAQIEVDRRMLAELAVSDSNAFATLVKVAKDALPAD 120

Query: 121 VA 122
           V 
Sbjct: 121 VN 122


>gi|119964246|ref|YP_947380.1| ribosomal protein L20 [Arthrobacter aurescens TC1]
 gi|215274794|sp|A1R568|RL20_ARTAT RecName: Full=50S ribosomal protein L20
 gi|119951105|gb|ABM10016.1| ribosomal protein L20 [Arthrobacter aurescens TC1]
          Length = 222

 Score =  164 bits (416), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 78/122 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ AKG+ G+R    R AK  +  S  Y+Y DRR KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERAKGYRGQRSRLYRKAKEQLLHSFVYSYGDRRKKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL  A + +DR++L++LA++  ++F  +V ++++ L  D
Sbjct: 61  WIQRINAASRANGLTYNRLIQGLKAAEVEVDRRMLAELAVSDANAFAALVNIAKAALPAD 120

Query: 121 VA 122
            +
Sbjct: 121 TS 122


>gi|82701624|ref|YP_411190.1| 50S ribosomal protein L20 [Nitrosospira multiformis ATCC 25196]
 gi|109893127|sp|Q2YBS3|RL20_NITMU RecName: Full=50S ribosomal protein L20
 gi|82409689|gb|ABB73798.1| LSU ribosomal protein L20P [Nitrosospira multiformis ATCC 25196]
          Length = 119

 Score =  164 bits (415), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 87/118 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR+FR+L
Sbjct: 1   MPRVKRGVTAHARHKKILDLAKGYRGRRKNVYRVAKEAVMKAGQYAYRDRRQKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS F+NGL KA I +DRKVL+DLA+    +F KI E +++ L 
Sbjct: 61  WIARINAAARECGLSYSVFMNGLKKAEIEVDRKVLADLAVFDKPAFAKIAEQAKASLA 118


>gi|163793840|ref|ZP_02187814.1| ribosomal protein L20 [alpha proteobacterium BAL199]
 gi|159180951|gb|EDP65468.1| ribosomal protein L20 [alpha proteobacterium BAL199]
          Length = 119

 Score =  164 bits (415), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 74/119 (62%), Positives = 95/119 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  A G+YGRRKN  R A  AV+++QQYAYRDR+V+KR+FR+L
Sbjct: 1   MARVKRGVTAHARHKKVIDKAAGYYGRRKNVFRVAVQAVEKAQQYAYRDRKVRKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINA VR+Y + YS F+NG+  AGI LDRKVLSDLAI + D+FK+IVE +++ L  
Sbjct: 61  WIQRINAGVRLYGMTYSTFMNGMKLAGIELDRKVLSDLAIREPDAFKQIVEQAKAALPA 119


>gi|325982722|ref|YP_004295124.1| 50S ribosomal protein L20 [Nitrosomonas sp. AL212]
 gi|325532241|gb|ADZ26962.1| ribosomal protein L20 [Nitrosomonas sp. AL212]
          Length = 119

 Score =  163 bits (413), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 88/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKILDLAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS F+NGL KA I +DRKVL+DLA+    +F+KIVE +++ L  
Sbjct: 61  WIARINAAARECGLSYSVFMNGLKKASIEVDRKVLADLAVFDKSAFEKIVEQAKASLAT 119


>gi|254501329|ref|ZP_05113480.1| ribosomal protein L20 [Labrenzia alexandrii DFL-11]
 gi|222437400|gb|EEE44079.1| ribosomal protein L20 [Labrenzia alexandrii DFL-11]
          Length = 119

 Score =  162 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 79/119 (66%), Positives = 99/119 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK+AKG+YGRRKNTIR AK AV+++ QYAYRDR+ KKR+FRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLKAAKGYYGRRKNTIRVAKQAVEKAGQYAYRDRKAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAA R + + Y  FINGL+KAGI +DRKVLSDLAI+Q D+FK +V+ ++  L  
Sbjct: 61  WIQRINAATRQHGMTYGTFINGLNKAGIEVDRKVLSDLAISQPDAFKALVDQAQGALAA 119


>gi|88706035|ref|ZP_01103743.1| 50S ribosomal protein L20 [Congregibacter litoralis KT71]
 gi|88699749|gb|EAQ96860.1| 50S ribosomal protein L20 [Congregibacter litoralis KT71]
          Length = 119

 Score =  162 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVVAHRRHKKILKQAKGYYGARSRVFRVAKQAVTKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L YS+ INGL KA I LDR+VL+DLA+    +F  +VE +++ L  
Sbjct: 61  WITRINAQSRANGLTYSKLINGLKKADIGLDRRVLADLAVHDKPAFAAVVEQAKAALAA 119


>gi|254515026|ref|ZP_05127087.1| ribosomal protein L20 [gamma proteobacterium NOR5-3]
 gi|219677269|gb|EED33634.1| ribosomal protein L20 [gamma proteobacterium NOR5-3]
          Length = 119

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVVAHRRHKKILKQAKGYYGARSRVFRVAKQAVTKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L YS+ INGL KA I LDR+VL+DLA+    +F  +VE +++ L  
Sbjct: 61  WITRINAQSRANGLTYSKLINGLKKANIGLDRRVLADLAVHDKPAFAAVVEQAKAALAA 119


>gi|110633031|ref|YP_673239.1| 50S ribosomal protein L20 [Mesorhizobium sp. BNC1]
 gi|122966206|sp|Q11KK1|RL20_MESSB RecName: Full=50S ribosomal protein L20
 gi|110284015|gb|ABG62074.1| LSU ribosomal protein L20P [Chelativorans sp. BNC1]
          Length = 133

 Score =  162 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 75/118 (63%), Positives = 96/118 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIR AK AV++S QYAYRDR+ +KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R + L Y +FI+GL+KAGI +DRKVL+D+A+ +  +F  +V  S++ L 
Sbjct: 61  WIQRINAATREHGLTYGRFIDGLNKAGIEIDRKVLADMAVHEPQAFAALVAKSKASLE 118


>gi|117923681|ref|YP_864298.1| 50S ribosomal protein L20P [Magnetococcus sp. MC-1]
 gi|166219658|sp|A0L4J9|RL20_MAGSM RecName: Full=50S ribosomal protein L20
 gi|117607437|gb|ABK42892.1| LSU ribosomal protein L20P [Magnetococcus sp. MC-1]
          Length = 117

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 69/117 (58%), Positives = 91/117 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S A+HKKVLK+AKG+ GR  +  R AK  V++  QYAYRDR+  KR+ R L
Sbjct: 1   MPRVKRGVTSQARHKKVLKAAKGYTGRNNSCFRIAKQKVEKGLQYAYRDRKNLKREMRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R++ ++YSQF+NGL+KAGI LDRKVLS+LAI++ +SF  +VE +++ L
Sbjct: 61  WIARINAATRLHGMSYSQFMNGLNKAGIELDRKVLSELAISEPESFGTLVEQAKAAL 117


>gi|329895716|ref|ZP_08271120.1| LSU ribosomal protein L20p [gamma proteobacterium IMCC3088]
 gi|328922192|gb|EGG29547.1| LSU ribosomal protein L20p [gamma proteobacterium IMCC3088]
          Length = 118

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 81/118 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHRRHKKILKQAKGYYGARSRIFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   + YSQ INGL KA I LDR+VL+DLA+     F  +VE ++S L 
Sbjct: 61  WITRINAQSRANGVTYSQLINGLKKANIGLDRRVLADLAVHDKAGFAAVVEQAKSALA 118


>gi|289208100|ref|YP_003460166.1| ribosomal protein L20 [Thioalkalivibrio sp. K90mix]
 gi|288943731|gb|ADC71430.1| ribosomal protein L20 [Thioalkalivibrio sp. K90mix]
          Length = 119

 Score =  160 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG RKN  R A  AV ++ QYAYRDRR KKR FRSL
Sbjct: 1   MPRVKRGVTAHARHKKVLKQAKGYYGARKNVFRVANQAVIKAGQYAYRDRRQKKRQFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R +DL+YS+ + GL KA I +DRK L+DLA+  L +F KI + +++ L  
Sbjct: 61  WIVRINAAARQFDLSYSRLMAGLKKAEIEIDRKTLADLAVHDLTAFGKIADKAKAALPA 119


>gi|119774903|ref|YP_927643.1| 50S ribosomal protein L20 [Shewanella amazonensis SB2B]
 gi|166220743|sp|A1S6G7|RL20_SHEAM RecName: Full=50S ribosomal protein L20
 gi|119767403|gb|ABL99973.1| LSU ribosomal protein L20P [Shewanella amazonensis SB2B]
          Length = 119

 Score =  160 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKILKLAKGYYGARSRTYRVAVQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKEAL 117


>gi|34496806|ref|NP_901021.1| 50S ribosomal protein L20 [Chromobacterium violaceum ATCC 12472]
 gi|39931752|sp|Q7NYC3|RL20_CHRVO RecName: Full=50S ribosomal protein L20
 gi|34102661|gb|AAQ59026.1| 50S ribosomal protein L20 [Chromobacterium violaceum ATCC 12472]
          Length = 119

 Score =  160 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 86/119 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKILALAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YS+F+NGL KA I +DRKVL+DLA+    +F +IVE +++ L  
Sbjct: 61  WIARINAAARENGLPYSKFMNGLKKAAIEIDRKVLADLAVFDKPAFAQIVEKAKASLAA 119


>gi|24373855|ref|NP_717898.1| 50S ribosomal protein L20 [Shewanella oneidensis MR-1]
 gi|91793064|ref|YP_562715.1| 50S ribosomal protein L20 [Shewanella denitrificans OS217]
 gi|113970295|ref|YP_734088.1| 50S ribosomal protein L20 [Shewanella sp. MR-4]
 gi|114047514|ref|YP_738064.1| 50S ribosomal protein L20 [Shewanella sp. MR-7]
 gi|117920490|ref|YP_869682.1| 50S ribosomal protein L20 [Shewanella sp. ANA-3]
 gi|120598811|ref|YP_963385.1| 50S ribosomal protein L20 [Shewanella sp. W3-18-1]
 gi|126174368|ref|YP_001050517.1| 50S ribosomal protein L20 [Shewanella baltica OS155]
 gi|146293111|ref|YP_001183535.1| 50S ribosomal protein L20 [Shewanella putrefaciens CN-32]
 gi|153000740|ref|YP_001366421.1| 50S ribosomal protein L20 [Shewanella baltica OS185]
 gi|160875439|ref|YP_001554755.1| 50S ribosomal protein L20 [Shewanella baltica OS195]
 gi|217973359|ref|YP_002358110.1| 50S ribosomal protein L20 [Shewanella baltica OS223]
 gi|304408771|ref|ZP_07390392.1| ribosomal protein L20 [Shewanella baltica OS183]
 gi|307302774|ref|ZP_07582529.1| ribosomal protein L20 [Shewanella baltica BA175]
 gi|31563135|sp|Q8EER6|RL20_SHEON RecName: Full=50S ribosomal protein L20
 gi|122943834|sp|Q0HIT6|RL20_SHESM RecName: Full=50S ribosomal protein L20
 gi|123060977|sp|Q12NI4|RL20_SHEDO RecName: Full=50S ribosomal protein L20
 gi|123131401|sp|Q0HV48|RL20_SHESR RecName: Full=50S ribosomal protein L20
 gi|166220744|sp|A3D4I5|RL20_SHEB5 RecName: Full=50S ribosomal protein L20
 gi|166220745|sp|A6WNG9|RL20_SHEB8 RecName: Full=50S ribosomal protein L20
 gi|166220747|sp|A4Y703|RL20_SHEPC RecName: Full=50S ribosomal protein L20
 gi|166220785|sp|A0KWV7|RL20_SHESA RecName: Full=50S ribosomal protein L20
 gi|166220786|sp|A1RJI6|RL20_SHESW RecName: Full=50S ribosomal protein L20
 gi|189041885|sp|A9L2Q6|RL20_SHEB9 RecName: Full=50S ribosomal protein L20
 gi|254800338|sp|B8EES9|RL20_SHEB2 RecName: Full=50S ribosomal protein L20
 gi|24348262|gb|AAN55342.1|AE015671_9 ribosomal protein L20 [Shewanella oneidensis MR-1]
 gi|91715066|gb|ABE54992.1| LSU ribosomal protein L20P [Shewanella denitrificans OS217]
 gi|113884979|gb|ABI39031.1| LSU ribosomal protein L20P [Shewanella sp. MR-4]
 gi|113888956|gb|ABI43007.1| LSU ribosomal protein L20P [Shewanella sp. MR-7]
 gi|117612822|gb|ABK48276.1| LSU ribosomal protein L20P [Shewanella sp. ANA-3]
 gi|120558904|gb|ABM24831.1| LSU ribosomal protein L20P [Shewanella sp. W3-18-1]
 gi|125997573|gb|ABN61648.1| LSU ribosomal protein L20P [Shewanella baltica OS155]
 gi|145564801|gb|ABP75736.1| LSU ribosomal protein L20P [Shewanella putrefaciens CN-32]
 gi|151365358|gb|ABS08358.1| ribosomal protein L20 [Shewanella baltica OS185]
 gi|160860961|gb|ABX49495.1| ribosomal protein L20 [Shewanella baltica OS195]
 gi|217498494|gb|ACK46687.1| ribosomal protein L20 [Shewanella baltica OS223]
 gi|304352592|gb|EFM16989.1| ribosomal protein L20 [Shewanella baltica OS183]
 gi|306913134|gb|EFN43556.1| ribosomal protein L20 [Shewanella baltica BA175]
 gi|315267629|gb|ADT94482.1| ribosomal protein L20 [Shewanella baltica OS678]
 gi|319426376|gb|ADV54450.1| ribosomal protein L20 [Shewanella putrefaciens 200]
          Length = 118

 Score =  160 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKEAL 117


>gi|224826511|ref|ZP_03699612.1| ribosomal protein L20 [Lutiella nitroferrum 2002]
 gi|224601112|gb|EEG07294.1| ribosomal protein L20 [Lutiella nitroferrum 2002]
          Length = 118

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKILALAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+F+NGL KA I +DRKVL+DLA+    +F +IVE +++ L 
Sbjct: 61  WIARINAGARELGLSYSKFMNGLKKAAIEIDRKVLADLAVFDKPAFAQIVEKAKASLA 118


>gi|218288920|ref|ZP_03493171.1| ribosomal protein L20 [Alicyclobacillus acidocaldarius LAA1]
 gi|258512134|ref|YP_003185568.1| 50S ribosomal protein L20 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|218241009|gb|EED08186.1| ribosomal protein L20 [Alicyclobacillus acidocaldarius LAA1]
 gi|257478860|gb|ACV59179.1| ribosomal protein L20 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 121

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 62/121 (51%), Positives = 90/121 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV+  +HKK+LK A+G++G +    R AK  V +S  YAYRDR+ +KRDFR L
Sbjct: 1   MARVKGGVVTRRRHKKILKLARGYFGSKHTLYRTAKQQVMKSLMYAYRDRKQRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR + L+YS+F++GL  AG+ ++RK+L+DLA+T  ++F ++V ++R RL  +
Sbjct: 61  WIQRINAAVRPHGLSYSRFMHGLKLAGVEVNRKMLADLAVTDKEAFSQLVTVARERLNAN 120

Query: 121 V 121
            
Sbjct: 121 A 121


>gi|188586436|ref|YP_001917981.1| LSU ribosomal protein L20P [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226730426|sp|B2A5N9|RL20_NATTJ RecName: Full=50S ribosomal protein L20
 gi|179351123|gb|ACB85393.1| LSU ribosomal protein L20P [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 117

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 80/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G     +HKKVLK AKG+ G + N  R A   V +S  YAYRDR+ +KR+FR L
Sbjct: 1   MPRVKTGTNRRRRHKKVLKLAKGYRGTKGNLFRIANQQVMKSLTYAYRDRKQRKREFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   ++Y++FINGL KAG+ ++RK+L+D+A+    +F ++V+L++  
Sbjct: 61  WISRINAACRQNGISYNKFINGLKKAGVEINRKMLADMAVNDEQAFGELVDLAKKS 116


>gi|170726834|ref|YP_001760860.1| 50S ribosomal protein L20 [Shewanella woodyi ATCC 51908]
 gi|212635270|ref|YP_002311795.1| 50S ribosomal protein L20 [Shewanella piezotolerans WP3]
 gi|226730453|sp|B8CMF1|RL20_SHEPW RecName: Full=50S ribosomal protein L20
 gi|226730454|sp|B1KG58|RL20_SHEWM RecName: Full=50S ribosomal protein L20
 gi|169812181|gb|ACA86765.1| ribosomal protein L20 [Shewanella woodyi ATCC 51908]
 gi|212556754|gb|ACJ29208.1| Ribosomal protein L20 [Shewanella piezotolerans WP3]
          Length = 119

 Score =  160 bits (406), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L 
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFTTLVEKAKEALA 118


>gi|157375260|ref|YP_001473860.1| 50S ribosomal protein L20 [Shewanella sediminis HAW-EB3]
 gi|189041888|sp|A8FV59|RL20_SHESH RecName: Full=50S ribosomal protein L20
 gi|157317634|gb|ABV36732.1| ribosomal protein L20 [Shewanella sediminis HAW-EB3]
          Length = 119

 Score =  160 bits (406), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAKQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L 
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFTTLVEKAKEALA 118


>gi|114563196|ref|YP_750709.1| 50S ribosomal protein L20 [Shewanella frigidimarina NCIMB 400]
 gi|122299729|sp|Q082E4|RL20_SHEFN RecName: Full=50S ribosomal protein L20
 gi|114334489|gb|ABI71871.1| LSU ribosomal protein L20P [Shewanella frigidimarina NCIMB 400]
          Length = 119

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKEAL 117


>gi|56460504|ref|YP_155785.1| 50S ribosomal protein L20 [Idiomarina loihiensis L2TR]
 gi|81821732|sp|Q5QYN7|RL20_IDILO RecName: Full=50S ribosomal protein L20
 gi|56179514|gb|AAV82236.1| Ribosomal protein L20 [Idiomarina loihiensis L2TR]
          Length = 117

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+   + F  +VE ++  L
Sbjct: 61  WIVRINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVHDQNGFAALVEKAKGAL 117


>gi|294141071|ref|YP_003557049.1| 50S ribosomal protein L20 [Shewanella violacea DSS12]
 gi|293327540|dbj|BAJ02271.1| ribosomal protein L20 [Shewanella violacea DSS12]
          Length = 119

 Score =  160 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAKQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFTTLVEKAKDALA 118


>gi|154250675|ref|YP_001411499.1| 50S ribosomal protein L20 [Parvibaculum lavamentivorans DS-1]
 gi|171769552|sp|A7HPK9|RL20_PARL1 RecName: Full=50S ribosomal protein L20
 gi|154154625|gb|ABS61842.1| ribosomal protein L20 [Parvibaculum lavamentivorans DS-1]
          Length = 118

 Score =  159 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 71/117 (60%), Positives = 96/117 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+H+K++K AKG+YGRRKN  R A  AV+++ QYAYRDRR +KR+FR+L
Sbjct: 1   MSRVKRGVTAHARHRKIIKKAKGYYGRRKNAFRTANQAVEKAGQYAYRDRRTRKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR + L YS+FI+GL KAGI +DRKVLSD+AI + ++FK +VE +++ L
Sbjct: 61  WIQRINAGVREHGLTYSRFIDGLAKAGIEVDRKVLSDIAIHEPEAFKALVEQAQAAL 117


>gi|256822929|ref|YP_003146892.1| 50S ribosomal protein L20 [Kangiella koreensis DSM 16069]
 gi|256796468|gb|ACV27124.1| ribosomal protein L20 [Kangiella koreensis DSM 16069]
          Length = 119

 Score =  159 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKILKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  RV+ L+YS+FINGL K+ I +DRK+L++LA+    +F    + ++S L  
Sbjct: 61  WIARINAEARVHGLSYSRFINGLKKSNIEVDRKMLAELAVFDKVAFAAFADQAKSVLEA 119


>gi|127512957|ref|YP_001094154.1| 50S ribosomal protein L20 [Shewanella loihica PV-4]
 gi|166220746|sp|A3QEJ7|RL20_SHELP RecName: Full=50S ribosomal protein L20
 gi|126638252|gb|ABO23895.1| LSU ribosomal protein L20P [Shewanella loihica PV-4]
          Length = 119

 Score =  159 bits (404), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAKQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L 
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKEALA 118


>gi|319943684|ref|ZP_08017965.1| inorganic diphosphatase [Lautropia mirabilis ATCC 51599]
 gi|319742917|gb|EFV95323.1| inorganic diphosphatase [Lautropia mirabilis ATCC 51599]
          Length = 122

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 72/122 (59%), Positives = 87/122 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GRRKN  R AK AV R+ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIDQAKGYRGRRKNVYRIAKEAVMRAGQYAYRDRRNRKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAAVR + L YS F++GL KA I LDRKVL++LA+    +F  IVE  +S L   
Sbjct: 61  WITRINAAVREHGLTYSVFMSGLLKAEIALDRKVLAELAVNDKPAFSAIVEQVKSTLGTA 120

Query: 121 VA 122
            A
Sbjct: 121 AA 122


>gi|297617664|ref|YP_003702823.1| ribosomal protein L20 [Syntrophothermus lipocalidus DSM 12680]
 gi|297145501|gb|ADI02258.1| ribosomal protein L20 [Syntrophothermus lipocalidus DSM 12680]
          Length = 117

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  +HKK+LK AKG+ G +    R AK  V +S  YAY  RR+KKRDFR L
Sbjct: 1   MPRVKGGVTTHRRHKKILKLAKGYRGAKSKLFRVAKQQVMKSGNYAYIHRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+ + GL  AG+ ++RKVL+DLA+   D+F ++  L++  L
Sbjct: 61  WIARINAAARNNGISYSRMMFGLKVAGVGINRKVLADLAVNDPDAFSELAALAKKNL 117


>gi|296133378|ref|YP_003640625.1| ribosomal protein L20 [Thermincola sp. JR]
 gi|296031956|gb|ADG82724.1| ribosomal protein L20 [Thermincola potens JR]
          Length = 119

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 60/119 (50%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  +HKK+LK AKG+ G +    R A   V +S  YAYRDRR KKR+FR L
Sbjct: 1   MPRVKGGVTTRKRHKKILKLAKGYRGAKSKLFRPANEQVLKSLAYAYRDRRTKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  ++YS+ INGL KAGI ++RK+L+DLA+    +F K+VE +++++  
Sbjct: 61  WIARINAAARINGISYSKLINGLKKAGIEVNRKMLADLAVNDQQAFGKLVEAAKAKVNA 119


>gi|289643247|ref|ZP_06475373.1| ribosomal protein L20 [Frankia symbiont of Datisca glomerata]
 gi|289506952|gb|EFD27925.1| ribosomal protein L20 [Frankia symbiont of Datisca glomerata]
          Length = 189

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 77/119 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y+YRDRR +K DFR L
Sbjct: 63  MARVKRAVNAQKKRRTVLEQASGYRGQRSRLYRKAKEQVLHSMTYSYRDRRARKGDFRQL 122

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L Y++F+ GL  AG+ +DRK+LSDLA+T   +F  +VE++R+ L  
Sbjct: 123 WITRINAAARQNGLTYNRFVQGLRLAGVEVDRKILSDLAVTDPAAFTALVEVARAALPA 181


>gi|169349801|ref|ZP_02866739.1| hypothetical protein CLOSPI_00539 [Clostridium spiroforme DSM 1552]
 gi|169293369|gb|EDS75502.1| hypothetical protein CLOSPI_00539 [Clostridium spiroforme DSM 1552]
          Length = 119

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 74/118 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KK+LK AKG++G +    + A   V  S  Y+YRDRR  KRD R L
Sbjct: 1   MARVKGGYTTRRRRKKILKLAKGYFGAKHRLYKTAHEQVMHSLAYSYRDRRQVKRDMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ D++YS+ ++GL  A + ++RK+LS++AI     F +IV  ++  L 
Sbjct: 61  WIARINAAARLNDISYSKLMHGLKLANVEINRKMLSEIAICDPKGFTEIVNTAKKALE 118


>gi|157962081|ref|YP_001502115.1| 50S ribosomal protein L20 [Shewanella pealeana ATCC 700345]
 gi|167623949|ref|YP_001674243.1| 50S ribosomal protein L20 [Shewanella halifaxensis HAW-EB4]
 gi|189041886|sp|B0TT23|RL20_SHEHH RecName: Full=50S ribosomal protein L20
 gi|189041887|sp|A8H4U3|RL20_SHEPA RecName: Full=50S ribosomal protein L20
 gi|157847081|gb|ABV87580.1| ribosomal protein L20 [Shewanella pealeana ATCC 700345]
 gi|167353971|gb|ABZ76584.1| ribosomal protein L20 [Shewanella halifaxensis HAW-EB4]
          Length = 119

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L 
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFATLVEKAKDALA 118


>gi|119476519|ref|ZP_01616870.1| ribosomal protein L20 [marine gamma proteobacterium HTCC2143]
 gi|119450383|gb|EAW31618.1| ribosomal protein L20 [marine gamma proteobacterium HTCC2143]
          Length = 118

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+ I GL KA I LDR+VL+DLA+    +F  +V+L+++ L 
Sbjct: 61  WITRINAQSRANGLSYSRLIAGLKKANIGLDRRVLADLAVHDKPAFGAVVDLAKAALA 118


>gi|295399481|ref|ZP_06809463.1| ribosomal protein L20 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109960|ref|YP_003988276.1| ribosomal protein L20 [Geobacillus sp. Y4.1MC1]
 gi|294978947|gb|EFG54543.1| ribosomal protein L20 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215061|gb|ADP73665.1| ribosomal protein L20 [Geobacillus sp. Y4.1MC1]
          Length = 118

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    R A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L+YS+F++GL  AG+ ++RK+L+DLA+    +F ++ EL++S+L
Sbjct: 61  WITRINAAARTHGLSYSRFMHGLKLAGVEVNRKMLADLAVNDQAAFAQLAELAKSKL 117


>gi|298290327|ref|YP_003692266.1| ribosomal protein L20 [Starkeya novella DSM 506]
 gi|296926838|gb|ADH87647.1| ribosomal protein L20 [Starkeya novella DSM 506]
          Length = 122

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 78/122 (63%), Positives = 97/122 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG++GRRKNTIR AK AV+++QQYAYRDR+VKKR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYFGRRKNTIRVAKQAVEKAQQYAYRDRKVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R     Y +FI+GL KAGI +DRKVLSD+AI +  +F  +VE +++ L   
Sbjct: 61  WIQRINAATRELGFTYGRFIDGLGKAGIEVDRKVLSDIAIHEPAAFAALVEQAKAALEKQ 120

Query: 121 VA 122
            A
Sbjct: 121 AA 122


>gi|237808483|ref|YP_002892923.1| 50S ribosomal protein L20 [Tolumonas auensis DSM 9187]
 gi|259646202|sp|C4LFH0|RL20_TOLAT RecName: Full=50S ribosomal protein L20
 gi|237500744|gb|ACQ93337.1| ribosomal protein L20 [Tolumonas auensis DSM 9187]
          Length = 118

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL +AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLNAAKGYYGARSRIYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+FINGL KA I +DRK+LSD+A+    +F  +VE +++ L 
Sbjct: 61  WIVRINAAARLNGLSYSRFINGLKKASIEIDRKILSDIAVHDKATFTALVEKAKAALA 118


>gi|224282679|ref|ZP_03646001.1| 50S ribosomal protein L20 [Bifidobacterium bifidum NCIMB 41171]
 gi|310287138|ref|YP_003938396.1| LSU ribosomal protein L20P [Bifidobacterium bifidum S17]
 gi|311064001|ref|YP_003970726.1| 50S ribosomal protein L20P RplT [Bifidobacterium bifidum PRL2010]
 gi|313139837|ref|ZP_07802030.1| 50S ribosomal protein L20 [Bifidobacterium bifidum NCIMB 41171]
 gi|309251074|gb|ADO52822.1| LSU ribosomal protein L20P [Bifidobacterium bifidum S17]
 gi|310866320|gb|ADP35689.1| RplT LSU ribosomal protein L20P [Bifidobacterium bifidum PRL2010]
 gi|313132347|gb|EFR49964.1| 50S ribosomal protein L20 [Bifidobacterium bifidum NCIMB 41171]
          Length = 127

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LA++  ++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAVSDPETFKAIVEQAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|118591292|ref|ZP_01548690.1| 50S ribosomal protein L20 [Stappia aggregata IAM 12614]
 gi|118435964|gb|EAV42607.1| 50S ribosomal protein L20 [Stappia aggregata IAM 12614]
          Length = 119

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 78/119 (65%), Positives = 99/119 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK+AKG+YGRRKNTIR AK AV+++ QYAYRDR+ KKR+FRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAA R + + Y +FI+GL+KAGI +DRKVLSDLAI Q D+FK +V+ ++  L  
Sbjct: 61  WIQRINAATRQHGMTYGRFIDGLNKAGIEVDRKVLSDLAINQPDAFKALVDQAQGALAA 119


>gi|85711633|ref|ZP_01042690.1| 50S ribosomal protein L20 [Idiomarina baltica OS145]
 gi|85694493|gb|EAQ32434.1| 50S ribosomal protein L20 [Idiomarina baltica OS145]
          Length = 117

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+     F  +VE ++  L
Sbjct: 61  WIVRINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVHDQSGFAALVEKAKGAL 117


>gi|308174581|ref|YP_003921286.1| 50S ribosomal protein L20 [Bacillus amyloliquefaciens DSM 7]
 gi|311069380|ref|YP_003974303.1| 50S ribosomal protein L20 [Bacillus atrophaeus 1942]
 gi|307607445|emb|CBI43816.1| ribosomal protein L20 [Bacillus amyloliquefaciens DSM 7]
 gi|310869897|gb|ADP33372.1| 50S ribosomal protein L20 [Bacillus atrophaeus 1942]
 gi|328554504|gb|AEB24996.1| 50S ribosomal protein L20 [Bacillus amyloliquefaciens TA208]
 gi|328912909|gb|AEB64505.1| ribosomal protein L20 [Bacillus amyloliquefaciens LL3]
          Length = 119

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L +F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLTAFNQLADAAKAQL 117


>gi|209965598|ref|YP_002298513.1| 50S ribosomal protein L20 [Rhodospirillum centenum SW]
 gi|226730443|sp|B6IPJ8|RL20_RHOCS RecName: Full=50S ribosomal protein L20
 gi|209959064|gb|ACI99700.1| ribosomal protein L20 [Rhodospirillum centenum SW]
          Length = 119

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+ GR     R A   V+++ +YAYRDRR +KRDFR L
Sbjct: 1   MARVKRGVTTHARHKKVLKLAKGYRGRSSKCYRIALERVEKALRYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINA  R++ L YS+F++GL +AGI +DRKVLSD+A  + +SFK +VE ++  L  
Sbjct: 61  WIQRINAGARLHGLTYSKFMHGLKRAGIEVDRKVLSDIAAREPESFKALVEQAQKALAA 119


>gi|183602464|ref|ZP_02963830.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219683222|ref|YP_002469605.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|241191182|ref|YP_002968576.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241196588|ref|YP_002970143.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|254800300|sp|B8DSQ0|RL20_BIFA0 RecName: Full=50S ribosomal protein L20
 gi|183218383|gb|EDT89028.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           HN019]
 gi|219620872|gb|ACL29029.1| ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240249574|gb|ACS46514.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240251142|gb|ACS48081.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|289177292|gb|ADC84538.1| LSU ribosomal protein L20P [Bifidobacterium animalis subsp. lactis
           BB-12]
 gi|295794175|gb|ADG33710.1| 50S ribosomal protein L20 [Bifidobacterium animalis subsp. lactis
           V9]
          Length = 127

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ AKG+ G+R    R AK  +  S  Y YRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTVLERAKGYRGQRSRLYRKAKEQLLHSFNYNYRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRIN AVR   + Y++FI GL  AGI LDR+ L++LA+   D+FK IVE +++ L  D
Sbjct: 61  WIQRINIAVRNEGITYNRFIQGLRLAGIELDRRALAELAVNDPDTFKTIVEQAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|309389090|gb|ADO76970.1| LSU ribosomal protein L20P [Halanaerobium praevalens DSM 2228]
          Length = 119

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  + KKVLK AKG++G R    R A  AV +S  YAYRDRR KKR FR L
Sbjct: 1   MPRVKRGNKARKRRKKVLKMAKGYFGSRSKLYRPANQAVMKSLHYAYRDRRNKKRTFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL +A + +DRK+L+DLA+   D F  +V+L++ +L
Sbjct: 61  WITRINAAARNEGLSYSRFINGLRQANVEIDRKMLADLAVNDSDGFANLVDLAKEKL 117


>gi|328541820|ref|YP_004301929.1| Phenylalanyl-tRNA synthetase, alpha subunit [polymorphum gilvum
           SL003B-26A1]
 gi|326411572|gb|ADZ68635.1| Phenylalanyl-tRNA synthetase, alpha subunit [Polymorphum gilvum
           SL003B-26A1]
          Length = 118

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 100/118 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK+AKGFYGRRKNTIR AK AV+++ QYAYRDR+V+KR+FRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLKAAKGFYGRRKNTIRIAKQAVEKAAQYAYRDRKVRKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R + + Y +FI+GL+KAGI +DRKVLSDLAI Q ++FK +V+ ++  L 
Sbjct: 61  WIQRINAATREHGMTYGRFIDGLNKAGIEVDRKVLSDLAIHQPEAFKALVDKAQGALA 118


>gi|21220095|ref|NP_625874.1| 50S ribosomal protein L20 [Streptomyces coelicolor A3(2)]
 gi|256788792|ref|ZP_05527223.1| 50S ribosomal protein L20 [Streptomyces lividans TK24]
 gi|289772687|ref|ZP_06532065.1| 50S ribosomal protein L20 [Streptomyces lividans TK24]
 gi|7674203|sp|O88058|RL20_STRCO RecName: Full=50S ribosomal protein L20
 gi|3581853|emb|CAA20809.1| 50S ribosomal protein L20 [Streptomyces coelicolor A3(2)]
 gi|289702886|gb|EFD70315.1| 50S ribosomal protein L20 [Streptomyces lividans TK24]
          Length = 127

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A + +DRK+L++LA+   ++F  +VE+++  L  D
Sbjct: 61  WIQRINAAARANGITYNRFIQGLKAANVEVDRKILAELAVNDPNAFAALVEVAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|299821798|ref|ZP_07053686.1| 50S ribosomal protein L20 [Listeria grayi DSM 20601]
 gi|299817463|gb|EFI84699.1| 50S ribosomal protein L20 [Listeria grayi DSM 20601]
          Length = 119

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVIKLAKGYYGAKHTLFKVANQAVMKSYQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+++L+YS+ ++GL  AGI ++RK+L+DLA+    +F  + + +++ L
Sbjct: 61  WITRINAAARLHELSYSKLMHGLKLAGIDINRKMLADLAVNDTAAFGALADQAKNAL 117


>gi|257092828|ref|YP_003166469.1| 50S ribosomal protein L20 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257045352|gb|ACV34540.1| ribosomal protein L20 [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 119

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GRR N  R AK AV ++ QYAYRDRR +KR FRSL
Sbjct: 1   MPRVKRGVTAHARHKKILALAKGYRGRRNNVYRVAKQAVMKAGQYAYRDRRQRKRQFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   + YS F+NGL KA + +DRKVL+DLA+    +F  + + ++++L
Sbjct: 61  WIARINAAARELGMKYSTFMNGLKKAQVEVDRKVLADLAVFDKPAFAVLAQQAKAQL 117


>gi|52081387|ref|YP_080178.1| 50S ribosomal protein L20 [Bacillus licheniformis ATCC 14580]
 gi|52786763|ref|YP_092592.1| 50S ribosomal protein L20 [Bacillus licheniformis ATCC 14580]
 gi|319647295|ref|ZP_08001517.1| 50S ribosomal protein L20 [Bacillus sp. BT1B_CT2]
 gi|81825224|sp|Q65GB5|RL20_BACLD RecName: Full=50S ribosomal protein L20
 gi|52004598|gb|AAU24540.1| ribosomal protein L20 [Bacillus licheniformis ATCC 14580]
 gi|52349265|gb|AAU41899.1| RplT [Bacillus licheniformis ATCC 14580]
 gi|317390642|gb|EFV71447.1| 50S ribosomal protein L20 [Bacillus sp. BT1B_CT2]
          Length = 119

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L++F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLNAFNQLADAAKAQL 117


>gi|260219595|emb|CBA26440.1| 50S ribosomal protein L20 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 119

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 73/119 (61%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKEAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRKVLSD+AI  + +F  IVE  +++L  
Sbjct: 61  WIARINAAARQCGLTYSQFANGLKKANIEIDRKVLSDIAIHDMAAFAGIVEQVKAKLAA 119


>gi|114566619|ref|YP_753773.1| 50S ribosomal protein L20 [Syntrophomonas wolfei subsp. wolfei str.
           Goettingen]
 gi|122318330|sp|Q0AY02|RL20_SYNWW RecName: Full=50S ribosomal protein L20
 gi|114337554|gb|ABI68402.1| LSU ribosomal protein L20P [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 118

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 76/116 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV S  +HKK+LK AKG+ G +    R A   V +S QYAY  RR+KKRDFR L
Sbjct: 1   MPRVKGGVTSHKRHKKILKLAKGYRGSKSKLYRVANEQVMKSGQYAYIHRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R     YS+ ++GL  AG+ ++RK+L++LAI+    F ++ EL++  
Sbjct: 61  WIARINAAARNNGTTYSRMVHGLKVAGVDINRKLLAELAISDPQGFTQLAELAKRS 116


>gi|163752534|ref|ZP_02159720.1| 50S ribosomal protein L20 [Shewanella benthica KT99]
 gi|161327589|gb|EDP98787.1| 50S ribosomal protein L20 [Shewanella benthica KT99]
          Length = 119

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLKLAKGYYGARSRTYRIAKQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+     F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVVFTTLVERAKDALA 118


>gi|332188419|ref|ZP_08390143.1| ribosomal protein L20 [Sphingomonas sp. S17]
 gi|332011565|gb|EGI53646.1| ribosomal protein L20 [Sphingomonas sp. S17]
          Length = 121

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 90/119 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR L
Sbjct: 1   MARVKRGTTTKAKHKRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINA VR   L YSQF++G   AGI LDRKVL+D+A+ + ++F  IV  +++ L  
Sbjct: 61  WIQRINAGVRAEGLTYSQFMHGCKLAGIELDRKVLADIAMHEGEAFSAIVAQAKAALPQ 119


>gi|89900133|ref|YP_522604.1| 50S ribosomal protein L20 [Rhodoferax ferrireducens T118]
 gi|109893143|sp|Q21YT0|RL20_RHOFD RecName: Full=50S ribosomal protein L20
 gi|89344870|gb|ABD69073.1| LSU ribosomal protein L20P [Rhodoferax ferrireducens T118]
          Length = 119

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVYRVAKEAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   + YSQF NGL KA I +DRKVLSD+A+  + +F  IV+  +++L  
Sbjct: 61  WIARINAAARQCGMTYSQFANGLKKANIEIDRKVLSDIAVHDMAAFASIVDQVKAKLAA 119


>gi|23015135|ref|ZP_00054920.1| COG0292: Ribosomal protein L20 [Magnetospirillum magnetotacticum
           MS-1]
 gi|83313482|ref|YP_423746.1| 50S ribosomal protein L20 [Magnetospirillum magneticum AMB-1]
 gi|109893120|sp|Q2VYY8|RL20_MAGMM RecName: Full=50S ribosomal protein L20
 gi|82948323|dbj|BAE53187.1| Ribosomal protein L20 [Magnetospirillum magneticum AMB-1]
          Length = 118

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 69/117 (58%), Positives = 89/117 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ GR     R A   V+++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTTHARHKKILKLAKGYRGRSSTCFRVAIQKVEKALRYAYRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R Y L YS+F++GL KAGI LDRKVLSD+AI + D+FK +VE +++ L
Sbjct: 61  WIQRINAGSRAYGLPYSRFMDGLKKAGIALDRKVLSDIAIREPDAFKSLVEKAQAAL 117


>gi|229543586|ref|ZP_04432646.1| ribosomal protein L20 [Bacillus coagulans 36D1]
 gi|229328006|gb|EEN93681.1| ribosomal protein L20 [Bacillus coagulans 36D1]
          Length = 117

 Score =  157 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYYGSKHTLFKVANQQVMKSYMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL +AGI ++RK+L+DLA+    +F ++   +++ L
Sbjct: 61  WITRINAAARINGLSYSRLMHGLKQAGIEVNRKMLADLAVNDAQAFAELANKAKAAL 117


>gi|56421251|ref|YP_148569.1| 50S ribosomal protein L20 [Geobacillus kaustophilus HTA426]
 gi|261418269|ref|YP_003251951.1| 50S ribosomal protein L20 [Geobacillus sp. Y412MC61]
 gi|297529123|ref|YP_003670398.1| ribosomal protein L20 [Geobacillus sp. C56-T3]
 gi|319767771|ref|YP_004133272.1| ribosomal protein L20 [Geobacillus sp. Y412MC52]
 gi|81819648|sp|Q5KWD5|RL20_GEOKA RecName: Full=50S ribosomal protein L20
 gi|56381093|dbj|BAD77001.1| 50S ribosomal protein L20 [Geobacillus kaustophilus HTA426]
 gi|261374726|gb|ACX77469.1| ribosomal protein L20 [Geobacillus sp. Y412MC61]
 gi|297252375|gb|ADI25821.1| ribosomal protein L20 [Geobacillus sp. C56-T3]
 gi|317112637|gb|ADU95129.1| ribosomal protein L20 [Geobacillus sp. Y412MC52]
          Length = 119

 Score =  157 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    R A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGPVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ ++GL  AG+ ++RK+L+DLA+    +F ++ +L+++ L
Sbjct: 61  WIVRINAAARQNGLSYSRLMHGLKLAGVEVNRKMLADLAVNDQAAFAQLADLAKANL 117


>gi|119945876|ref|YP_943556.1| ribosomal protein L20 [Psychromonas ingrahamii 37]
 gi|166220731|sp|A1SWU2|RL20_PSYIN RecName: Full=50S ribosomal protein L20
 gi|119864480|gb|ABM03957.1| LSU ribosomal protein L20P [Psychromonas ingrahamii 37]
          Length = 118

 Score =  157 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQRKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE+++  L 
Sbjct: 61  WITRINAASRISGLSYSRFINGLKKASVEIDRKILADIAVFDKATFAHLVEVAKKALA 118


>gi|91787978|ref|YP_548930.1| 50S ribosomal protein L20 [Polaromonas sp. JS666]
 gi|123355763|sp|Q12BR0|RL20_POLSJ RecName: Full=50S ribosomal protein L20
 gi|91697203|gb|ABE44032.1| LSU ribosomal protein L20P [Polaromonas sp. JS666]
          Length = 119

 Score =  157 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 73/119 (61%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKEAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + + YSQF NGL KAGI +DRKVLSD+AI    +F  IVE  +++L  
Sbjct: 61  WIARINAASRSFGMTYSQFANGLKKAGIEIDRKVLSDMAIHDSAAFGAIVEQVKAKLAA 119


>gi|121594738|ref|YP_986634.1| 50S ribosomal protein L20 [Acidovorax sp. JS42]
 gi|241764281|ref|ZP_04762311.1| ribosomal protein L20 [Acidovorax delafieldii 2AN]
 gi|319763194|ref|YP_004127131.1| ribosomal protein l20 [Alicycliphilus denitrificans BC]
 gi|330825388|ref|YP_004388691.1| 50S ribosomal protein L20 [Alicycliphilus denitrificans K601]
 gi|166219600|sp|A1W8I3|RL20_ACISJ RecName: Full=50S ribosomal protein L20
 gi|120606818|gb|ABM42558.1| LSU ribosomal protein L20P [Acidovorax sp. JS42]
 gi|241366350|gb|EER60880.1| ribosomal protein L20 [Acidovorax delafieldii 2AN]
 gi|317117755|gb|ADV00244.1| ribosomal protein L20 [Alicycliphilus denitrificans BC]
 gi|329310760|gb|AEB85175.1| 50S ribosomal protein L20 [Alicycliphilus denitrificans K601]
          Length = 119

 Score =  157 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 71/119 (59%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  +++L  
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKASIEIDRKMLADLAVHDKAAFGSIVEQVKAKLAA 119


>gi|300813854|ref|ZP_07094159.1| ribosomal protein L20 [Peptoniphilus sp. oral taxon 836 str. F0141]
 gi|300512041|gb|EFK39236.1| ribosomal protein L20 [Peptoniphilus sp. oral taxon 836 str. F0141]
          Length = 116

 Score =  157 bits (399), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 83/115 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HK +LK AKG++G +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKNILKQAKGYFGAKSKLFRPANQAVMKSLSYAYIGRKQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R++ ++YS+FI+GL KAG+ ++RK+LS++AI     FK++V+++++
Sbjct: 61  WITRINAATRLHGMSYSKFISGLKKAGVNINRKMLSEMAINDPQGFKELVDIAKA 115


>gi|118595086|ref|ZP_01552433.1| 50S ribosomal protein L20 [Methylophilales bacterium HTCC2181]
 gi|118440864|gb|EAV47491.1| 50S ribosomal protein L20 [Methylophilales bacterium HTCC2181]
          Length = 120

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 71/117 (60%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL +AKGF GRRKN  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARAKHKKVLVAAKGFRGRRKNVYRVAKQAVMKAGQYAYRDRRQKKRVFRVL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R + L YS+F+NGL KA + +DRKVL+D+A+    +F+K VEL+++ L
Sbjct: 61  WIARINAGAREFGLTYSRFMNGLKKASVEVDRKVLADMAVFDKPAFEKFVELAKNNL 117


>gi|16079937|ref|NP_390763.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221310827|ref|ZP_03592674.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221315152|ref|ZP_03596957.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221320070|ref|ZP_03601364.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221324352|ref|ZP_03605646.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|296331563|ref|ZP_06874032.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675478|ref|YP_003867150.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|321312419|ref|YP_004204706.1| 50S ribosomal protein L20 [Bacillus subtilis BSn5]
 gi|2500289|sp|P55873|RL20_BACSU RecName: Full=50S ribosomal protein L20
 gi|1770009|emb|CAA99618.1| ribosomal protein L20 [Bacillus subtilis]
 gi|2635350|emb|CAB14845.1| ribosomal protein L20 [Bacillus subtilis subsp. subtilis str. 168]
 gi|291485319|dbj|BAI86394.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. natto BEST195]
 gi|296151158|gb|EFG92038.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413722|gb|ADM38841.1| 50S ribosomal protein L20 [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|320018693|gb|ADV93679.1| 50S ribosomal protein L20 [Bacillus subtilis BSn5]
          Length = 119

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L +F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLTAFNQLADAAKAQL 117


>gi|311279399|ref|YP_003941630.1| ribosomal protein L20 [Enterobacter cloacae SCF1]
 gi|308748594|gb|ADO48346.1| ribosomal protein L20 [Enterobacter cloacae SCF1]
          Length = 118

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAALA 118


>gi|50955432|ref|YP_062720.1| 50S ribosomal protein L20 [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|60390368|sp|Q6ADC9|RL20_LEIXX RecName: Full=50S ribosomal protein L20
 gi|50951914|gb|AAT89615.1| 50S ribosomal protein L20 [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 130

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A+G+ G+R    R AK  V  S  YAYRDRR KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAEGYRGQRSRLYRKAKEQVTHSLVYAYRDRRQKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +  +F  +VE ++  L  D
Sbjct: 61  WIQRINAASRANGLTYNRFIQGLGLAGVEVDRRILAELAVNEPATFTALVETAKKALPAD 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|237731272|ref|ZP_04561753.1| 50S ribosomal protein L20 [Citrobacter sp. 30_2]
 gi|283833388|ref|ZP_06353129.1| ribosomal protein L20 [Citrobacter youngae ATCC 29220]
 gi|226906811|gb|EEH92729.1| 50S ribosomal protein L20 [Citrobacter sp. 30_2]
 gi|291071038|gb|EFE09147.1| ribosomal protein L20 [Citrobacter youngae ATCC 29220]
          Length = 118

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAALA 118


>gi|20808117|ref|NP_623288.1| 50S ribosomal protein L20 [Thermoanaerobacter tengcongensis MB4]
 gi|22096043|sp|Q8R9C4|RL20_THETN RecName: Full=50S ribosomal protein L20
 gi|20516704|gb|AAM24892.1| Ribosomal protein L20 [Thermoanaerobacter tengcongensis MB4]
          Length = 119

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 59/119 (49%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  +HKK+LK AKG++G +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MARVKSGKVTRRRHKKILKLAKGYWGAKSKLFRVANQAVMKSLMYAYIGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R Y ++YS+FINGL KAGI ++RK+LS++AI    +F ++V +++ +L  
Sbjct: 61  WITRINAAARAYGISYSRFINGLKKAGIEINRKMLSEMAIHDEKAFAELVNIAKQQLNA 119


>gi|282882482|ref|ZP_06291103.1| ribosomal protein L20 [Peptoniphilus lacrimalis 315-B]
 gi|281297624|gb|EFA90099.1| ribosomal protein L20 [Peptoniphilus lacrimalis 315-B]
          Length = 116

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 83/115 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HK +LK AKG++G +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKNILKQAKGYFGAKSKLFRPANQAVMKSLSYAYIGRKQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+Y ++YS+FI+GL KAG+ ++RK+LS++AI     FK++V+++++
Sbjct: 61  WITRINAATRLYGMSYSKFISGLKKAGVNINRKMLSEMAINDPQGFKELVDIAKA 115


>gi|269102903|ref|ZP_06155600.1| LSU ribosomal protein L20p [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268162801|gb|EEZ41297.1| LSU ribosomal protein L20p [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 117

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASIEIDRKILADIAVFDKATFTVLVEKAKAAL 117


>gi|332525935|ref|ZP_08402076.1| 50S ribosomal protein L20 [Rubrivivax benzoatilyticus JA2]
 gi|332109486|gb|EGJ10409.1| 50S ribosomal protein L20 [Rubrivivax benzoatilyticus JA2]
          Length = 118

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKGF GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTAHARHKKILALAKGFRGRRKNVFRIAKQAVMKAGQYAYRDRRTRKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   + YS+F+ GL KA I +DRKVL+DLA+    +F  IV   +++L 
Sbjct: 61  WIARINAASRELGITYSKFMAGLKKAQIDIDRKVLADLAVKDPAAFGAIVAKVKAQLA 118


>gi|212638373|ref|YP_002314893.1| 50S ribosomal protein L20 [Anoxybacillus flavithermus WK1]
 gi|226730351|sp|B7GGV3|RL20_ANOFW RecName: Full=50S ribosomal protein L20
 gi|212559853|gb|ACJ32908.1| Ribosomal protein L20 [Anoxybacillus flavithermus WK1]
          Length = 119

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG++G +    + A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRRRRKKILKLAKGYFGSKHRLYKVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  +++  L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLAGIEVNRKMLADLAVNDAAAFTQLANIAKENL 117


>gi|109898811|ref|YP_662066.1| 50S ribosomal protein L20 [Pseudoalteromonas atlantica T6c]
 gi|332306907|ref|YP_004434758.1| ribosomal protein L20 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|123064481|sp|Q15SX6|RL20_PSEA6 RecName: Full=50S ribosomal protein L20
 gi|109701092|gb|ABG41012.1| LSU ribosomal protein L20P [Pseudoalteromonas atlantica T6c]
 gi|332174236|gb|AEE23490.1| ribosomal protein L20 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 118

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+   ++F  +V+ ++  L 
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASVEIDRKILADIAVHDKNAFSALVDAAKGALA 118


>gi|220925396|ref|YP_002500698.1| 50S ribosomal protein L20 [Methylobacterium nodulans ORS 2060]
 gi|254800329|sp|B8IP77|RL20_METNO RecName: Full=50S ribosomal protein L20
 gi|219950003|gb|ACL60395.1| ribosomal protein L20 [Methylobacterium nodulans ORS 2060]
          Length = 125

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 78/122 (63%), Positives = 98/122 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQR+NAAVR + L YS+FI+GL KAGIV+DRK LS+LAI +  +F  +VE +++ L  +
Sbjct: 61  WIQRLNAAVREHGLTYSRFIDGLAKAGIVVDRKALSELAIHEPAAFSAVVEKAKAALPAE 120

Query: 121 VA 122
            A
Sbjct: 121 TA 122


>gi|304320478|ref|YP_003854121.1| 50S ribosomal protein L20 [Parvularcula bermudensis HTCC2503]
 gi|303299380|gb|ADM08979.1| 50S ribosomal protein L20 [Parvularcula bermudensis HTCC2503]
          Length = 119

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 86/119 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V  A+HKK++  AKG+YG R    R A  AV+++ QYAYRDR+ +KR+FR L
Sbjct: 1   MSRVKTGTVRKARHKKIIGQAKGYYGARHRLFRTANQAVEKAGQYAYRDRKARKREFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAAVR + L YS F+NGL KAGI +DRK+L+DLA  + +SF  IVE ++  L  
Sbjct: 61  WIQRINAAVREHGLTYSVFMNGLAKAGIEVDRKMLADLAAREPESFAAIVEKAKGALAA 119


>gi|121605744|ref|YP_983073.1| 50S ribosomal protein L20 [Polaromonas naphthalenivorans CJ2]
 gi|166219675|sp|A1VR74|RL20_POLNA RecName: Full=50S ribosomal protein L20
 gi|120594713|gb|ABM38152.1| LSU ribosomal protein L20P [Polaromonas naphthalenivorans CJ2]
          Length = 119

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 74/119 (62%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKEAVMKAGQYAYRDRRNKKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + L YSQF NGL KAGI +DRKVLSD+AI    +F  IVE ++++L+ 
Sbjct: 61  WIARINAASRSFGLTYSQFANGLKKAGIEIDRKVLSDMAIHDSAAFGAIVEQAKAKLVA 119


>gi|83949944|ref|ZP_00958677.1| ribosomal protein L20 [Roseovarius nubinhibens ISM]
 gi|83837843|gb|EAP77139.1| ribosomal protein L20 [Roseovarius nubinhibens ISM]
          Length = 121

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 96/121 (79%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRKNT R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKNTFRVATQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + D+F  IV+ +++ L 
Sbjct: 61  WIQRINAAVRAHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPDAFGAIVDQAKAALP 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|327439268|dbj|BAK15633.1| ribosomal protein L20 [Solibacillus silvestris StLB046]
          Length = 119

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KKVLK AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKVLKLAKGYYGSKHTLYKVANQAVMKSGQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+T   +F ++ E ++  + 
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKVAGIEVNRKMLADLAVTDSTAFAQLAEEAKKAVA 118


>gi|152980705|ref|YP_001353180.1| 50S ribosomal protein L20 [Janthinobacterium sp. Marseille]
 gi|166219653|sp|A6SY33|RL20_JANMA RecName: Full=50S ribosomal protein L20
 gi|151280782|gb|ABR89192.1| large subunit ribosomal protein L20 [Janthinobacterium sp.
           Marseille]
          Length = 119

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRR    R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLDQAKGYRGRRSKVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + L YS F+NGL +A I LDRKVL+D+A+    +F  IV   ++ +  
Sbjct: 61  WITRINAASREHGLTYSVFMNGLKRASIELDRKVLADMAVMDKPAFAAIVNQVKANIAA 119


>gi|48474627|sp|Q9ALJ1|RL20_VIBME RecName: Full=50S ribosomal protein L20
 gi|12831415|gb|AAK02073.1| large subunit ribosomal protein L20 [Vibrio metschnikovii]
          Length = 117

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKILKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRTKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFSVLVEKAKAAL 117


>gi|253996952|ref|YP_003049016.1| 50S ribosomal protein L20 [Methylotenera mobilis JLW8]
 gi|253983631|gb|ACT48489.1| ribosomal protein L20 [Methylotenera mobilis JLW8]
          Length = 119

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 72/119 (60%), Positives = 90/119 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVIARARHKKVLKAAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQKKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R + L YS+F+NGL KA I +DRKVL+DLA+    +F K VEL+++ L  
Sbjct: 61  WIARINAGSREFGLTYSRFMNGLKKAAIEVDRKVLADLAVFDKAAFAKFVELAKAGLAA 119


>gi|134095003|ref|YP_001100078.1| 50S ribosomal protein L20 [Herminiimonas arsenicoxydans]
 gi|166219652|sp|A4G616|RL20_HERAR RecName: Full=50S ribosomal protein L20
 gi|133738906|emb|CAL61953.1| 50S ribosomal subunit protein L20 [Herminiimonas arsenicoxydans]
          Length = 119

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRR    R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLDQAKGYRGRRSKVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + L YS F+NGL +A I LDRKVL+D+A+    +F  IV   ++ +  
Sbjct: 61  WITRINAASREHGLTYSVFMNGLKRASIELDRKVLADMAVMDKPAFAAIVNQVKTTIAA 119


>gi|170743417|ref|YP_001772072.1| 50S ribosomal protein L20 [Methylobacterium sp. 4-46]
 gi|226730421|sp|B0UPJ6|RL20_METS4 RecName: Full=50S ribosomal protein L20
 gi|168197691|gb|ACA19638.1| ribosomal protein L20 [Methylobacterium sp. 4-46]
          Length = 125

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 78/122 (63%), Positives = 97/122 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ +KR+FRSL
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNRKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQR+NAA R + L YS+ I+GL KAGIV+DRK LS+LAI +  +F  +VE +R+ L  +
Sbjct: 61  WIQRLNAAAREHGLTYSRLIDGLAKAGIVVDRKALSELAIHEPAAFAAVVEQARAALPAE 120

Query: 121 VA 122
            A
Sbjct: 121 TA 122


>gi|171058431|ref|YP_001790780.1| 50S ribosomal protein L20 [Leptothrix cholodnii SP-6]
 gi|226730415|sp|B1XYZ6|RL20_LEPCP RecName: Full=50S ribosomal protein L20
 gi|170775876|gb|ACB34015.1| ribosomal protein L20 [Leptothrix cholodnii SP-6]
          Length = 118

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRRKN  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRKNVYRIAKQAVMKAGQYAYRDRRAKKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L YS+FI GL KA I +DRKVLSD+AI    +F  IV+  +++L 
Sbjct: 61  WIARINAASRSLGLTYSKFIAGLKKAQIDIDRKVLSDMAIHDPAAFGSIVDKVKAQLA 118


>gi|222110649|ref|YP_002552913.1| 50S ribosomal protein l20 [Acidovorax ebreus TPSY]
 gi|254800319|sp|B9MHY1|RL20_DIAST RecName: Full=50S ribosomal protein L20
 gi|221730093|gb|ACM32913.1| ribosomal protein L20 [Acidovorax ebreus TPSY]
          Length = 119

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 71/119 (59%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  +++L  
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKASIEVDRKMLADLAVHDKAAFGSIVEQVKAKLAA 119


>gi|209551837|ref|YP_002283754.1| 50S ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226730442|sp|B5ZXR9|RL20_RHILW RecName: Full=50S ribosomal protein L20
 gi|209537593|gb|ACI57528.1| ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 134

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 81/118 (68%), Positives = 99/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVNAAKKALE 118


>gi|313888422|ref|ZP_07822090.1| ribosomal protein L20 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845619|gb|EFR33012.1| ribosomal protein L20 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 116

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 81/116 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HK +LK +KG++G +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRGVNAKKRHKNILKQSKGYFGAKSKLFRTANQAVMKSLNYAYIGRKQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  ++YS+FI+GL KA I ++RK+LS++AI     F K+VE+++ +
Sbjct: 61  WITRINAAARINGMSYSKFISGLKKANITINRKMLSEMAINDPAGFAKLVEIAKEQ 116


>gi|138896277|ref|YP_001126730.1| 50S ribosomal protein L20 [Geobacillus thermodenitrificans NG80-2]
 gi|166219647|sp|A4IRN1|RL20_GEOTN RecName: Full=50S ribosomal protein L20
 gi|134267790|gb|ABO67985.1| Ribosomal protein L20 [Geobacillus thermodenitrificans NG80-2]
          Length = 119

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    R A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGPVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ ++GL  AG+ ++RK+L+DLA+    +F ++ +L+++ L
Sbjct: 61  WIARINAAARQNGLSYSRLMHGLKLAGVEVNRKMLADLAVNDQAAFAQLADLAKANL 117


>gi|239827994|ref|YP_002950618.1| 50S ribosomal protein L20 [Geobacillus sp. WCH70]
 gi|259646188|sp|C5D636|RL20_GEOSW RecName: Full=50S ribosomal protein L20
 gi|239808287|gb|ACS25352.1| ribosomal protein L20 [Geobacillus sp. WCH70]
          Length = 119

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    R A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R++ L+YS+F++GL  AG+ ++RK+L+DLA+    +F ++ +L+++ L
Sbjct: 61  WIARINAAARMHGLSYSRFMHGLKLAGVEVNRKMLADLAVNDQAAFAQLADLAKANL 117


>gi|154687019|ref|YP_001422180.1| 50S ribosomal protein L20 [Bacillus amyloliquefaciens FZB42]
 gi|166219606|sp|A7Z7H3|RL20_BACA2 RecName: Full=50S ribosomal protein L20
 gi|154352870|gb|ABS74949.1| RplT [Bacillus amyloliquefaciens FZB42]
          Length = 119

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G VS  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVSRQRRKKVLKLAKGYFGSKHRLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L +F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLTAFNQLADAAKAQL 117


>gi|160915884|ref|ZP_02078092.1| hypothetical protein EUBDOL_01907 [Eubacterium dolichum DSM 3991]
 gi|158432360|gb|EDP10649.1| hypothetical protein EUBDOL_01907 [Eubacterium dolichum DSM 3991]
          Length = 171

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 76/118 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + A   V  S +YAY DR+  KR+ R L
Sbjct: 1   MARVKGGYVTRQRRKKVLKLAKGYFGSKHILYKTAHEQVMHSFKYAYNDRKDLKRNMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ D++YS+ ++GL  A + ++RK+LS++AI     F  IVE +++ L 
Sbjct: 61  WIARINAAARMNDISYSRLMHGLKLANVTINRKMLSEIAIHDAAGFTAIVETAKNALA 118


>gi|119472426|ref|ZP_01614544.1| 50S ribosomal protein L20 [Alteromonadales bacterium TW-7]
 gi|332534268|ref|ZP_08410112.1| 50S ribosomal protein L20 [Pseudoalteromonas haloplanktis ANT/505]
 gi|119444948|gb|EAW26246.1| 50S ribosomal protein L20 [Alteromonadales bacterium TW-7]
 gi|332036264|gb|EGI72736.1| 50S ribosomal protein L20 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 119

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+FINGL K  + +DRK+L+D+A+    +F  +VE ++  L  
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKTSVEIDRKILADIAVYDQVAFAALVEKAKEGLAA 119


>gi|241207215|ref|YP_002978311.1| 50S ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240861105|gb|ACS58772.1| ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 134

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 99/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKGFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVSAAKKALE 118


>gi|117618760|ref|YP_856847.1| ribosomal protein L20 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|145298936|ref|YP_001141777.1| 50S ribosomal protein L20 [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|166219602|sp|A0KKP6|RL20_AERHH RecName: Full=50S ribosomal protein L20
 gi|166219603|sp|A4SMA7|RL20_AERS4 RecName: Full=50S ribosomal protein L20
 gi|117560167|gb|ABK37115.1| ribosomal protein L20 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|142851708|gb|ABO90029.1| ribosomal protein L20 [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 118

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K+AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVMKAAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+ INGL KA I +DRK+LSD+A+    +F  +VE +++ L+
Sbjct: 61  WIARINAAARQNGLSYSRLINGLKKASIEIDRKILSDIAVHDKLAFTALVEKAKAALV 118


>gi|56964452|ref|YP_176183.1| 50S ribosomal protein L20 [Bacillus clausii KSM-K16]
 gi|60390297|sp|Q5WEI8|RL20_BACSK RecName: Full=50S ribosomal protein L20
 gi|56910695|dbj|BAD65222.1| 50S ribosomal protein L20 [Bacillus clausii KSM-K16]
          Length = 119

 Score =  157 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    ++A+  V +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYVARRRRKKVLKLAKGYYGSKHTLFKSAQGQVMKSLQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F ++ + ++  L
Sbjct: 61  WITRINAAARLNGLSYSRLMHGLKLAEINVNRKMLADLAVNDEKAFAQLADKAKESL 117


>gi|260774301|ref|ZP_05883216.1| LSU ribosomal protein L20p [Vibrio metschnikovii CIP 69.14]
 gi|260611262|gb|EEX36466.1| LSU ribosomal protein L20p [Vibrio metschnikovii CIP 69.14]
          Length = 117

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRTKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFSVLVEKAKAAL 117


>gi|229824397|ref|ZP_04450466.1| hypothetical protein GCWU000282_01718 [Catonella morbi ATCC 51271]
 gi|229786197|gb|EEP22311.1| hypothetical protein GCWU000282_01718 [Catonella morbi ATCC 51271]
          Length = 117

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+ LK AKG+YG +    + AK  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYVTRQRRKRTLKLAKGYYGAKHLLFKTAKQQVMKSYMYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  +NGL KAG+ ++RK+L+DLA+    +F  +VE ++  L
Sbjct: 61  WITRINAAARMNGISYSVLMNGLKKAGVEVNRKMLADLAVHDAAAFTALVEQAKKAL 117


>gi|126728340|ref|ZP_01744156.1| 50S ribosomal protein L20 [Sagittula stellata E-37]
 gi|126711305|gb|EBA10355.1| 50S ribosomal protein L20 [Sagittula stellata E-37]
          Length = 121

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 91/121 (75%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+HKK+   AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR FR+L
Sbjct: 1   MPRVKGGTVTHARHKKITNQAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRQFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR+ D  L YS+FINGL KAGI +DRKVL+DLA+ + D+F  IVE ++  L 
Sbjct: 61  WIQRINAAVRLNDETLTYSRFINGLSKAGIEVDRKVLADLAVHEPDAFAAIVEQAKGALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|260427841|ref|ZP_05781820.1| ribosomal protein L20 [Citreicella sp. SE45]
 gi|260422333|gb|EEX15584.1| ribosomal protein L20 [Citreicella sp. SE45]
          Length = 121

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 93/121 (76%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+HKKVL  AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MARVKGGTVTHARHKKVLDQAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL KAGI +DRKVL+DLA+ + ++F  IVE ++  L 
Sbjct: 61  WIQRINAAVRAHDEALTYSKFINGLTKAGIEVDRKVLADLAVHEPEAFGAIVEQAKGALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|114767104|ref|ZP_01445987.1| 50S ribosomal protein L20 [Pelagibaca bermudensis HTCC2601]
 gi|114540757|gb|EAU43823.1| 50S ribosomal protein L20 [Roseovarius sp. HTCC2601]
          Length = 121

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 93/121 (76%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+HKKVL  AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MARVKGGTVTHARHKKVLDQAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL KAGI +DRKVL+DLA+ + ++F  IV+ ++  L 
Sbjct: 61  WIQRINAAVRAHDEALTYSKFINGLTKAGIEVDRKVLADLAVHEPEAFGAIVDQAKGALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|121610036|ref|YP_997843.1| 50S ribosomal protein L20 [Verminephrobacter eiseniae EF01-2]
 gi|166220802|sp|A1WMG8|RL20_VEREI RecName: Full=50S ribosomal protein L20
 gi|121554676|gb|ABM58825.1| LSU ribosomal protein L20P [Verminephrobacter eiseniae EF01-2]
          Length = 119

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 73/119 (61%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  ++RL V
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKAAIEIDRKMLADLAVHDKAAFGSIVEQVKARLAV 119


>gi|322833536|ref|YP_004213563.1| ribosomal protein L20 [Rahnella sp. Y9602]
 gi|321168737|gb|ADW74436.1| ribosomal protein L20 [Rahnella sp. Y9602]
          Length = 118

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R  D++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNDMSYSKFINGLKKASIEIDRKILADIAVFDKVAFSALVEKAKAALA 118


>gi|256379475|ref|YP_003103135.1| ribosomal protein L20 [Actinosynnema mirum DSM 43827]
 gi|255923778|gb|ACU39289.1| ribosomal protein L20 [Actinosynnema mirum DSM 43827]
          Length = 129

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTTLELASGYRGQRSRLYRKAKEQVLHSLNYAYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINA VR   + Y++FI GL  AGI +DRK+L++LA++   +F  +VEL+++ +  D
Sbjct: 61  WIQRINAGVRANGMTYNRFIQGLRLAGIEVDRKILAELAVSDPTAFAAVVELAKAAMPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|221066197|ref|ZP_03542302.1| ribosomal protein L20 [Comamonas testosteroni KF-1]
 gi|264679163|ref|YP_003279070.1| ribosomal protein L20 [Comamonas testosteroni CNB-2]
 gi|299533559|ref|ZP_07046935.1| 50S ribosomal protein L20 [Comamonas testosteroni S44]
 gi|220711220|gb|EED66588.1| ribosomal protein L20 [Comamonas testosteroni KF-1]
 gi|262209676|gb|ACY33774.1| ribosomal protein L20 [Comamonas testosteroni CNB-2]
 gi|298718465|gb|EFI59446.1| 50S ribosomal protein L20 [Comamonas testosteroni S44]
          Length = 119

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 69/119 (57%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLNLAKGFRGRRGNVFRVAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRK+L+D+A+    +F  IV+  +++L  
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKAAIEIDRKMLADIAVHDKAAFAAIVDQVKAKLAA 119


>gi|157693290|ref|YP_001487752.1| 50S ribosomal protein L20 [Bacillus pumilus SAFR-032]
 gi|194017159|ref|ZP_03055771.1| ribosomal protein L20 [Bacillus pumilus ATCC 7061]
 gi|166984688|sp|A8FG25|RL20_BACP2 RecName: Full=50S ribosomal protein L20
 gi|157682048|gb|ABV63192.1| ribosomal protein L20 [Bacillus pumilus SAFR-032]
 gi|194011027|gb|EDW20597.1| ribosomal protein L20 [Bacillus pumilus ATCC 7061]
          Length = 119

 Score =  157 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G VS  + KKVLK AKG++G +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVSRQRRKKVLKLAKGYFGSKHRLYKVANQQVMKSGNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  +GI ++RK+L+DLA+  L +F ++ + ++++L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAVNDLSAFNQLADAAKAQL 117


>gi|257867130|ref|ZP_05646783.1| ribosomal protein L20 [Enterococcus casseliflavus EC30]
 gi|257871009|ref|ZP_05650662.1| ribosomal protein L20 [Enterococcus gallinarum EG2]
 gi|257873464|ref|ZP_05653117.1| ribosomal protein L20 [Enterococcus casseliflavus EC10]
 gi|257801186|gb|EEV30116.1| ribosomal protein L20 [Enterococcus casseliflavus EC30]
 gi|257805173|gb|EEV33995.1| ribosomal protein L20 [Enterococcus gallinarum EG2]
 gi|257807628|gb|EEV36450.1| ribosomal protein L20 [Enterococcus casseliflavus EC10]
          Length = 119

 Score =  156 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDATAFTALADQAKDAL 117


>gi|295395438|ref|ZP_06805637.1| 50S ribosomal protein L20 [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971760|gb|EFG47636.1| 50S ribosomal protein L20 [Brevibacterium mcbrellneri ATCC 49030]
          Length = 129

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K + +L+ AKG+ G+R    R AK  V  S  Y+YRDRR +K DFR L
Sbjct: 1   MARVKRAINAKKKRRVILERAKGYRGQRSRLYRKAKEQVIHSLVYSYRDRRQRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINA  R   + Y++FI GL  A + +DR++L++LA+     F  +VE+++S L  D
Sbjct: 61  WIQRINAGARANGMTYNRFIQGLKAAQVEVDRRMLAELAVNDPAVFTSLVEVAKSALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|312884191|ref|ZP_07743903.1| 50S ribosomal protein L20 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368239|gb|EFP95779.1| 50S ribosomal protein L20 [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 117

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKTAL 117


>gi|307943570|ref|ZP_07658914.1| ribosomal protein L20 [Roseibium sp. TrichSKD4]
 gi|307773200|gb|EFO32417.1| ribosomal protein L20 [Roseibium sp. TrichSKD4]
          Length = 118

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 99/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK+AKG+YGRRKNTIR AK AV+++ QYAYRDR+ KKR+FRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R + + Y +FI+GL+KAG+ +DRKVLSDLAI Q D+FK +VE ++  L 
Sbjct: 61  WIQRINAATRQHGMTYGRFIDGLNKAGVEVDRKVLSDLAINQPDAFKALVEKAQGALA 118


>gi|227547606|ref|ZP_03977655.1| ribosomal protein L20 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|322689457|ref|YP_004209191.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           157F]
 gi|227211861|gb|EEI79757.1| ribosomal protein L20 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|320460793|dbj|BAJ71413.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           157F]
          Length = 127

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L+++A++  D+FK IV+ +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAEIAVSDPDTFKTIVDAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|332529092|ref|ZP_08405056.1| 50S ribosomal protein L20 [Hylemonella gracilis ATCC 19624]
 gi|332041315|gb|EGI77677.1| 50S ribosomal protein L20 [Hylemonella gracilis ATCC 19624]
          Length = 119

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 71/119 (59%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLNLAKGFRGRRGNVFRIAKEAVMKAGQYAYRDRRAKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRKVL+D+A+  + +F  IVE  +++L  
Sbjct: 61  WIARINAAARQCGLTYSQFANGLKKAQIEIDRKVLADIAVNDMAAFAGIVEKVKAKLAA 119


>gi|90420459|ref|ZP_01228366.1| 50S ribosomal protein L20 [Aurantimonas manganoxydans SI85-9A1]
 gi|90335187|gb|EAS48940.1| 50S ribosomal protein L20 [Aurantimonas manganoxydans SI85-9A1]
          Length = 139

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 99/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK+LK A GFYGRRKNTIRAAKAAVDRS+QYA RDRRVKKR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKILKQAAGFYGRRKNTIRAAKAAVDRSKQYATRDRRVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + + Y +FI+GL+KAGI +DRKVLSD+AI + ++F  + E ++S L 
Sbjct: 61  WIQRINAAVREHGMTYGRFIDGLNKAGIEVDRKVLSDIAIHEPEAFGALCEQAKSALA 118


>gi|332981196|ref|YP_004462637.1| 50S ribosomal protein L20P [Mahella australiensis 50-1 BON]
 gi|332698874|gb|AEE95815.1| LSU ribosomal protein L20P [Mahella australiensis 50-1 BON]
          Length = 119

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  +HKKVLK AKG++G +    +AA  AV ++  YAY  R+++KRDFR L
Sbjct: 1   MARVKSGVTTHRRHKKVLKLAKGYWGGKSKQYKAANEAVMKALAYAYVGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+FINGL KAGI ++RK+L+++A++   +F ++VE+++ ++  
Sbjct: 61  WIARINAASRMNGLSYSKFINGLKKAGIEINRKMLAEMAVSDSKAFTQLVEVAKQQMGA 119


>gi|149191777|ref|ZP_01870015.1| 50S ribosomal protein L20 [Vibrio shilonii AK1]
 gi|260777878|ref|ZP_05886771.1| LSU ribosomal protein L20p [Vibrio coralliilyticus ATCC BAA-450]
 gi|261250896|ref|ZP_05943470.1| LSU ribosomal protein L20p [Vibrio orientalis CIP 102891]
 gi|323493464|ref|ZP_08098586.1| 50S ribosomal protein L20 [Vibrio brasiliensis LMG 20546]
 gi|323499332|ref|ZP_08104309.1| 50S ribosomal protein L20 [Vibrio sinaloensis DSM 21326]
 gi|148834357|gb|EDL51356.1| 50S ribosomal protein L20 [Vibrio shilonii AK1]
 gi|260605891|gb|EEX32176.1| LSU ribosomal protein L20p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260937769|gb|EEX93757.1| LSU ribosomal protein L20p [Vibrio orientalis CIP 102891]
 gi|323312287|gb|EGA65429.1| 50S ribosomal protein L20 [Vibrio brasiliensis LMG 20546]
 gi|323315720|gb|EGA68754.1| 50S ribosomal protein L20 [Vibrio sinaloensis DSM 21326]
          Length = 117

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKAAL 117


>gi|144899425|emb|CAM76289.1| 50S ribosomal protein L20 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 118

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKGF GR     R A   V+++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTTHARHKKILKLAKGFRGRSSTCFRVAIEKVEKALRYAYRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R Y + YS+F+NGL KAGIVLDRKVL+D+A  + +SFK +V+ + + L
Sbjct: 61  WIQRINAGTRQYGMPYSRFMNGLKKAGIVLDRKVLADIAAREPESFKSLVQKAEAAL 117


>gi|307545107|ref|YP_003897586.1| 50S ribosomal protein L20 [Halomonas elongata DSM 2581]
 gi|307217131|emb|CBV42401.1| 50S ribosomal protein L20 [Halomonas elongata DSM 2581]
          Length = 117

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 68/116 (58%), Positives = 88/116 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MTRVKRGVVARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WIQRINA  R + L+YS+F+ GL KAGI +DRKVL+DLA+ +  +F  IVE +++ 
Sbjct: 61  WIQRINAGARQHGLSYSRFVGGLKKAGIEIDRKVLADLAVNEKAAFAAIVEKAKAA 116


>gi|120611520|ref|YP_971198.1| 50S ribosomal protein L20 [Acidovorax citrulli AAC00-1]
 gi|166219595|sp|A1TR36|RL20_ACIAC RecName: Full=50S ribosomal protein L20
 gi|120589984|gb|ABM33424.1| LSU ribosomal protein L20P [Acidovorax citrulli AAC00-1]
          Length = 120

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  +KGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALSKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  +++L  
Sbjct: 61  WIARINAASRELGLTYSQFTNGLKKAAIEIDRKMLADLAVHDKAAFGSIVEQVKAKLAA 119


>gi|89074409|ref|ZP_01160891.1| 50S ribosomal protein L20 [Photobacterium sp. SKA34]
 gi|90579638|ref|ZP_01235447.1| 50S ribosomal protein L20 [Vibrio angustum S14]
 gi|330445798|ref|ZP_08309450.1| ribosomal protein L20 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|89049896|gb|EAR55437.1| 50S ribosomal protein L20 [Photobacterium sp. SKA34]
 gi|90439212|gb|EAS64394.1| 50S ribosomal protein L20 [Vibrio angustum S14]
 gi|328489989|dbj|GAA03947.1| ribosomal protein L20 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 117

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+ INGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGMSYSRLINGLKKASIEIDRKILADIAVFDKATFTVLVEKAKAAL 117


>gi|167757064|ref|ZP_02429191.1| hypothetical protein CLORAM_02613 [Clostridium ramosum DSM 1402]
 gi|237735865|ref|ZP_04566346.1| 50S ribosomal protein L20 [Mollicutes bacterium D7]
 gi|167703239|gb|EDS17818.1| hypothetical protein CLORAM_02613 [Clostridium ramosum DSM 1402]
 gi|229381610|gb|EEO31701.1| 50S ribosomal protein L20 [Coprobacillus sp. D7]
          Length = 119

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 73/118 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KKVLK AKG++G +    + A   V  S  Y+YRDRR  KRD R L
Sbjct: 1   MARVKGGFTTRRRRKKVLKLAKGYFGSKHTLYKTAHEQVMHSLAYSYRDRRQVKRDMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ D++YS+ ++GL  A + ++RK+LS++AI     F  IV  ++  L 
Sbjct: 61  WIARINAAARLNDISYSKLMHGLKLANVEVNRKMLSEIAICDPKGFTAIVNTAKKALA 118


>gi|212715581|ref|ZP_03323709.1| hypothetical protein BIFCAT_00480 [Bifidobacterium catenulatum DSM
           16992]
 gi|225351392|ref|ZP_03742415.1| hypothetical protein BIFPSEUDO_02986 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|212660948|gb|EEB21523.1| hypothetical protein BIFCAT_00480 [Bifidobacterium catenulatum DSM
           16992]
 gi|225157736|gb|EEG71019.1| hypothetical protein BIFPSEUDO_02986 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 127

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LAI+  ++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAISDPETFKAIVEQAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|91784425|ref|YP_559631.1| 50S ribosomal protein L20 [Burkholderia xenovorans LB400]
 gi|115351415|ref|YP_773254.1| 50S ribosomal protein L20 [Burkholderia ambifaria AMMD]
 gi|170695987|ref|ZP_02887125.1| ribosomal protein L20 [Burkholderia graminis C4D1M]
 gi|170701129|ref|ZP_02892103.1| ribosomal protein L20 [Burkholderia ambifaria IOP40-10]
 gi|171318445|ref|ZP_02907600.1| ribosomal protein L20 [Burkholderia ambifaria MEX-5]
 gi|172060454|ref|YP_001808106.1| 50S ribosomal protein L20 [Burkholderia ambifaria MC40-6]
 gi|187924729|ref|YP_001896371.1| 50S ribosomal protein L20 [Burkholderia phytofirmans PsJN]
 gi|209516672|ref|ZP_03265525.1| ribosomal protein L20 [Burkholderia sp. H160]
 gi|295677045|ref|YP_003605569.1| ribosomal protein L20 [Burkholderia sp. CCGE1002]
 gi|296163124|ref|ZP_06845895.1| ribosomal protein L20 [Burkholderia sp. Ch1-1]
 gi|307730399|ref|YP_003907623.1| 50S ribosomal protein L20 [Burkholderia sp. CCGE1003]
 gi|323526733|ref|YP_004228886.1| 50S ribosomal protein L20 [Burkholderia sp. CCGE1001]
 gi|122323388|sp|Q0BG03|RL20_BURCM RecName: Full=50S ribosomal protein L20
 gi|123168270|sp|Q13WG0|RL20_BURXL RecName: Full=50S ribosomal protein L20
 gi|226730364|sp|B1YP16|RL20_BURA4 RecName: Full=50S ribosomal protein L20
 gi|226730369|sp|B2SZF9|RL20_BURPP RecName: Full=50S ribosomal protein L20
 gi|91688379|gb|ABE31579.1| LSU ribosomal protein L20P [Burkholderia xenovorans LB400]
 gi|115281403|gb|ABI86920.1| LSU ribosomal protein L20P [Burkholderia ambifaria AMMD]
 gi|170133951|gb|EDT02305.1| ribosomal protein L20 [Burkholderia ambifaria IOP40-10]
 gi|170139067|gb|EDT07257.1| ribosomal protein L20 [Burkholderia graminis C4D1M]
 gi|171096359|gb|EDT41261.1| ribosomal protein L20 [Burkholderia ambifaria MEX-5]
 gi|171992971|gb|ACB63890.1| ribosomal protein L20 [Burkholderia ambifaria MC40-6]
 gi|187715923|gb|ACD17147.1| ribosomal protein L20 [Burkholderia phytofirmans PsJN]
 gi|209502947|gb|EEA02950.1| ribosomal protein L20 [Burkholderia sp. H160]
 gi|295436888|gb|ADG16058.1| ribosomal protein L20 [Burkholderia sp. CCGE1002]
 gi|295886626|gb|EFG66473.1| ribosomal protein L20 [Burkholderia sp. Ch1-1]
 gi|307584934|gb|ADN58332.1| ribosomal protein L20 [Burkholderia sp. CCGE1003]
 gi|323383735|gb|ADX55826.1| ribosomal protein L20 [Burkholderia sp. CCGE1001]
          Length = 119

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++K AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKIIKLAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR +D+ YS FINGL KA I LDRKVL+D+A+    +F  IV+  ++ +  
Sbjct: 61  WITRINAAVRQHDMTYSVFINGLKKASIELDRKVLADMAVFDKAAFAAIVQQVKAAVAA 119


>gi|301629971|ref|XP_002944105.1| PREDICTED: 50S ribosomal protein L20-like [Xenopus (Silurana)
           tropicalis]
          Length = 119

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 72/119 (60%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVYRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  ++RL  
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKAAIEIDRKMLADLAVHDKAAFGSIVEQVKARLAA 119


>gi|255326343|ref|ZP_05367427.1| ribosomal protein L20 [Rothia mucilaginosa ATCC 25296]
 gi|255296560|gb|EET75893.1| ribosomal protein L20 [Rothia mucilaginosa ATCC 25296]
          Length = 126

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L  A G+ G+R    R AK  V  S  Y+Y  RR KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRTILDRASGYRGQRSRLYRKAKEQVTHSLVYSYDHRRKKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +  +F  +VE++++ L  D
Sbjct: 61  WIQRINAASRAQGLTYNRFIQGLKAAGVEVDRRMLAELAVNEPAAFNALVEIAKNNLPED 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|90407014|ref|ZP_01215204.1| 50S ribosomal protein L20 [Psychromonas sp. CNPT3]
 gi|90311885|gb|EAS39980.1| 50S ribosomal protein L20 [Psychromonas sp. CNPT3]
          Length = 118

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQRKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE+++  L 
Sbjct: 61  WIARINAASRISGLSYSRFINGLKKASVEIDRKILADIAVFDKATFAHLVEVAKKALA 118


>gi|15615700|ref|NP_244004.1| 50S ribosomal protein L20 [Bacillus halodurans C-125]
 gi|14195132|sp|Q9K869|RL20_BACHD RecName: Full=50S ribosomal protein L20
 gi|10175760|dbj|BAB06857.1| 50S ribosomal protein L20 [Bacillus halodurans C-125]
          Length = 119

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    ++A+  V +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYVARRRRKKVLKLAKGYFGSKHTLFKSAQGQVMKSLQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLAI    +F ++ E +++ L
Sbjct: 61  WITRINAAARLNGLSYSRLMHGLKLAGINVNRKMLADLAINDEKAFAQLAEKAKASL 117


>gi|332284516|ref|YP_004416427.1| 50S ribosomal protein L20 [Pusillimonas sp. T7-7]
 gi|330428469|gb|AEC19803.1| 50S ribosomal protein L20 [Pusillimonas sp. T7-7]
          Length = 119

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K+AKG+ GRR N  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIKAAKGYRGRRGNVFRIAKQAVMKAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   ++YS FI G  KA I LDRKVL+D+A+     F  +VE ++S L  
Sbjct: 61  WITRINAACRELGVSYSVFIAGTKKASIELDRKVLADMAVNDKAGFAAVVEQAKSALAA 119


>gi|300856607|ref|YP_003781591.1| 50S ribosomal protein L20 [Clostridium ljungdahlii DSM 13528]
 gi|300436722|gb|ADK16489.1| 50S ribosomal protein L20 [Clostridium ljungdahlii DSM 13528]
          Length = 119

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 59/119 (49%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   HKK+LK AKG+YG +    R A   V R+ +Y+Y  RR+KKRDFR L
Sbjct: 1   MARVKRAVNARKHHKKILKLAKGYYGGKSRLFRTANETVLRALRYSYIGRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+FING+  AGI ++RK+LS++AI     F ++VE+++ +L  
Sbjct: 61  WIARINAATRMNGLSYSKFINGIKTAGINMNRKMLSEIAINDPKGFTELVEVAKKQLNA 119


>gi|260597640|ref|YP_003210211.1| 50S ribosomal protein L20 [Cronobacter turicensis z3032]
 gi|260216817|emb|CBA30302.1| 50S ribosomal protein L20 [Cronobacter turicensis z3032]
          Length = 118

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVMARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKAALA 118


>gi|297538935|ref|YP_003674704.1| 50S ribosomal protein L20 [Methylotenera sp. 301]
 gi|297258282|gb|ADI30127.1| ribosomal protein L20 [Methylotenera sp. 301]
          Length = 119

 Score =  156 bits (395), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 71/119 (59%), Positives = 89/119 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVIARARHKKVLKAAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQKKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L YS+F+NGL  A I +DRKVL+DLA+    +F K VE++++ L V
Sbjct: 61  WIARINAGARELGLTYSRFMNGLKIASIEVDRKVLADLAVFDKAAFAKFVEMAKTALAV 119


>gi|169831540|ref|YP_001717522.1| 50S ribosomal protein L20 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|226730388|sp|B1I4I8|RL20_DESAP RecName: Full=50S ribosomal protein L20
 gi|169638384|gb|ACA59890.1| ribosomal protein L20 [Candidatus Desulforudis audaxviator MP104C]
          Length = 120

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 59/120 (49%), Positives = 85/120 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  VV+  +HKKVLK AKG++G +    R A   V RS  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKNAVVARKRHKKVLKLAKGYWGAKSKLYRVANQQVMRSLLYAYRDRRAKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+  ++Y++FI GL +AG+ ++RKVL++LA+    +F ++V++++++L   
Sbjct: 61  WITRINAAARLNGMSYNRFIEGLRRAGVEINRKVLAELAVKDQAAFGQLVQVAKAQLESK 120


>gi|171742547|ref|ZP_02918354.1| hypothetical protein BIFDEN_01660 [Bifidobacterium dentium ATCC
           27678]
 gi|283456367|ref|YP_003360931.1| 50S ribosomal protein L20P [Bifidobacterium dentium Bd1]
 gi|306822460|ref|ZP_07455838.1| 50S ribosomal protein L20 [Bifidobacterium dentium ATCC 27679]
 gi|309801412|ref|ZP_07695539.1| ribosomal protein L20 [Bifidobacterium dentium JCVIHMP022]
 gi|171278161|gb|EDT45822.1| hypothetical protein BIFDEN_01660 [Bifidobacterium dentium ATCC
           27678]
 gi|283103001|gb|ADB10107.1| rplT LSU ribosomal protein L20P [Bifidobacterium dentium Bd1]
 gi|304554005|gb|EFM41914.1| 50S ribosomal protein L20 [Bifidobacterium dentium ATCC 27679]
 gi|308221927|gb|EFO78212.1| ribosomal protein L20 [Bifidobacterium dentium JCVIHMP022]
          Length = 127

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LA++  ++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAVSDPETFKAIVEQAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|23099605|ref|NP_693071.1| 50S ribosomal protein L20 [Oceanobacillus iheyensis HTE831]
 gi|31563139|sp|Q8EPF7|RL20_OCEIH RecName: Full=50S ribosomal protein L20
 gi|22777835|dbj|BAC14106.1| 50S ribosomal protein L20 [Oceanobacillus iheyensis HTE831]
          Length = 118

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+VLK AKG+YG ++   + AK  V +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKRVLKLAKGYYGSKRTLFKTAKQQVIKSGQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R++DL+YS+ ++GL  AGI ++RK+LSDLAI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARMHDLSYSKLMHGLKVAGIDINRKMLSDLAISDEKAFAQLVSQAKEAL 117


>gi|163942307|ref|YP_001647191.1| 50S ribosomal protein L20 [Bacillus weihenstephanensis KBAB4]
 gi|229013776|ref|ZP_04170904.1| 50S ribosomal protein L20 [Bacillus mycoides DSM 2048]
 gi|229032218|ref|ZP_04188191.1| 50S ribosomal protein L20 [Bacillus cereus AH1271]
 gi|229062257|ref|ZP_04199578.1| 50S ribosomal protein L20 [Bacillus cereus AH603]
 gi|229135408|ref|ZP_04264196.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST196]
 gi|229169300|ref|ZP_04297010.1| 50S ribosomal protein L20 [Bacillus cereus AH621]
 gi|229175282|ref|ZP_04302797.1| 50S ribosomal protein L20 [Bacillus cereus MM3]
 gi|226730356|sp|A9VJN6|RL20_BACWK RecName: Full=50S ribosomal protein L20
 gi|163864504|gb|ABY45563.1| ribosomal protein L20 [Bacillus weihenstephanensis KBAB4]
 gi|228608114|gb|EEK65421.1| 50S ribosomal protein L20 [Bacillus cereus MM3]
 gi|228614063|gb|EEK71178.1| 50S ribosomal protein L20 [Bacillus cereus AH621]
 gi|228648051|gb|EEL04098.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST196]
 gi|228716985|gb|EEL68666.1| 50S ribosomal protein L20 [Bacillus cereus AH603]
 gi|228728998|gb|EEL80001.1| 50S ribosomal protein L20 [Bacillus cereus AH1271]
 gi|228747445|gb|EEL97320.1| 50S ribosomal protein L20 [Bacillus mycoides DSM 2048]
          Length = 118

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKSTLFKVANQQVMKSLMYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  ++++ +
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKNAGIEVNRKMLADLAVHDEKAFAELATVAKNNI 117


>gi|114332288|ref|YP_748510.1| 50S ribosomal protein L20 [Nitrosomonas eutropha C91]
 gi|122313051|sp|Q0ADN7|RL20_NITEC RecName: Full=50S ribosomal protein L20
 gi|114309302|gb|ABI60545.1| LSU ribosomal protein L20P [Nitrosomonas eutropha C91]
          Length = 119

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V + A+HKKVLK AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRSVTARARHKKVLKLAKGYRGRRKNIYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAAVR   + YS F+NGL K+GI LDRKVL+DLA+    +F+KI    ++ L 
Sbjct: 61  WIARINAAVRELGMTYSTFMNGLKKSGIGLDRKVLADLAVFDKAAFEKITNQVKTSLA 118


>gi|283458459|ref|YP_003363085.1| 50S ribosomal protein L20 [Rothia mucilaginosa DY-18]
 gi|283134500|dbj|BAI65265.1| ribosomal protein L20 [Rothia mucilaginosa DY-18]
          Length = 138

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 77/122 (63%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            RVKR V +  K + +L  A G+ G+R    R AK  V  S  Y+Y  RR KK DFR LW
Sbjct: 14  ARVKRAVNAHKKRRTILDRASGYRGQRSRLYRKAKEQVTHSLVYSYDHRRKKKGDFRRLW 73

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVDV 121
           IQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +  +F  +VE++++ L  D 
Sbjct: 74  IQRINAASRAQGLTYNRFIQGLKAAGVEVDRRMLAELAVNEPAAFNALVEIAKNNLPEDT 133

Query: 122 AS 123
           ++
Sbjct: 134 SA 135


>gi|313899576|ref|ZP_07833085.1| ribosomal protein L20 [Clostridium sp. HGF2]
 gi|312955683|gb|EFR37342.1| ribosomal protein L20 [Clostridium sp. HGF2]
          Length = 120

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 76/118 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KKVLK AKG+YG +    + A   V  S +YAY DR+  KR+ R L
Sbjct: 1   MARVKGGYTTRQRRKKVLKLAKGYYGAKHILYKTAHEQVMHSFKYAYNDRKDLKRNMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ +++YS+ ++GL  A + ++RK+LS++AI     F KIVE ++S L 
Sbjct: 61  WIARINAAARMNEISYSKLMHGLKLANVTINRKMLSEIAIHDPKGFTKIVETAKSALE 118


>gi|84393196|ref|ZP_00991959.1| 50S ribosomal protein L20 [Vibrio splendidus 12B01]
 gi|86147531|ref|ZP_01065842.1| 50S ribosomal protein L20 [Vibrio sp. MED222]
 gi|148982345|ref|ZP_01816722.1| 50S ribosomal protein L20 [Vibrionales bacterium SWAT-3]
 gi|218709224|ref|YP_002416845.1| 50S ribosomal protein L20 [Vibrio splendidus LGP32]
 gi|254800351|sp|B7VN20|RL20_VIBSL RecName: Full=50S ribosomal protein L20
 gi|84376162|gb|EAP93047.1| 50S ribosomal protein L20 [Vibrio splendidus 12B01]
 gi|85834699|gb|EAQ52846.1| 50S ribosomal protein L20 [Vibrio sp. MED222]
 gi|145960525|gb|EDK25888.1| 50S ribosomal protein L20 [Vibrionales bacterium SWAT-3]
 gi|218322243|emb|CAV18362.1| 50S ribosomal subunit protein L20 [Vibrio splendidus LGP32]
          Length = 117

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKASL 117


>gi|325568473|ref|ZP_08144840.1| 50S ribosomal protein L20 [Enterococcus casseliflavus ATCC 12755]
 gi|325158242|gb|EGC70395.1| 50S ribosomal protein L20 [Enterococcus casseliflavus ATCC 12755]
          Length = 121

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + SR  L 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDATAFTALADQSRQALE 118


>gi|296135848|ref|YP_003643090.1| ribosomal protein L20 [Thiomonas intermedia K12]
 gi|294340013|emb|CAZ88377.1| 50S ribosomal subunit protein L20 [Thiomonas sp. 3As]
 gi|295795970|gb|ADG30760.1| ribosomal protein L20 [Thiomonas intermedia K12]
          Length = 118

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRRKN  R AK AV ++ QYAYRDRR KKR+FRSL
Sbjct: 1   MPRVKRGVTARARHKKVLDLAKGFRGRRKNVYRIAKEAVMKAGQYAYRDRRAKKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAAVR   + YS F+NG+ KA I +DRKVL+D+A+    +F KIV   ++ + 
Sbjct: 61  WITRINAAVRQSGMTYSVFMNGMKKAQIEIDRKVLADMAVHDAAAFAKIVAQVKAAMA 118


>gi|237653683|ref|YP_002889997.1| 50S ribosomal protein L20 [Thauera sp. MZ1T]
 gi|237624930|gb|ACR01620.1| ribosomal protein L20 [Thauera sp. MZ1T]
          Length = 119

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLSQAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YS F+NGL KA I +DRKVL+DLA+    +F  I E +R++L  
Sbjct: 61  WIARINAAARELGLTYSVFMNGLKKAAIEIDRKVLADLAVFDKPAFAAIAEQARAKLAA 119


>gi|116250036|ref|YP_765874.1| 50S ribosomal protein L20 [Rhizobium leguminosarum bv. viciae 3841]
 gi|166220733|sp|Q1MMP4|RL20_RHIL3 RecName: Full=50S ribosomal protein L20
 gi|115254684|emb|CAK05758.1| putative 50S ribosomal protein L20 [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 134

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 99/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKGFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVSAAKKALE 118


>gi|323702720|ref|ZP_08114381.1| ribosomal protein L20 [Desulfotomaculum nigrificans DSM 574]
 gi|323532383|gb|EGB22261.1| ribosomal protein L20 [Desulfotomaculum nigrificans DSM 574]
          Length = 118

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  VVS  +H+K+LK AKG+ G R    R A  AV ++  YAYRDRR KKRDFR L
Sbjct: 1   MPRAKSSVVSRNRHRKILKLAKGYRGSRSKLYRVANQAVMKALFYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  ++YS+FINGL KAG+ ++RK+L+DLA+    +F ++V++++S L 
Sbjct: 61  WIARINAAARMNGMSYSKFINGLKKAGVEVNRKMLADLAVNDAQAFSQLVQVAKSNLA 118


>gi|261212789|ref|ZP_05927073.1| LSU ribosomal protein L20p [Vibrio sp. RC341]
 gi|260837854|gb|EEX64531.1| LSU ribosomal protein L20p [Vibrio sp. RC341]
          Length = 117

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKGAL 117


>gi|323143352|ref|ZP_08078040.1| ribosomal protein L20 [Succinatimonas hippei YIT 12066]
 gi|322416870|gb|EFY07516.1| ribosomal protein L20 [Succinatimonas hippei YIT 12066]
          Length = 119

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 73/119 (61%), Positives = 88/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK+AKG+YG R  T R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVTARARHKKVLKAAKGYYGARSRTYRVAVQAVTKAGQYAYRDRRQKKRQFREL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R +DL+YSQF+NGL KA I +DRKVLS+LAI    +FK I + +R+ L  
Sbjct: 61  WIVRINAAARQHDLSYSQFMNGLKKANIEIDRKVLSELAINDKAAFKAIADQARAALNA 119


>gi|218680048|ref|ZP_03527945.1| 50S ribosomal protein L20 [Rhizobium etli CIAT 894]
          Length = 134

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 81/118 (68%), Positives = 99/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVAAHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVNAAKKALE 118


>gi|114706183|ref|ZP_01439086.1| 50S ribosomal protein L20 [Fulvimarina pelagi HTCC2506]
 gi|114539029|gb|EAU42150.1| 50S ribosomal protein L20 [Fulvimarina pelagi HTCC2506]
          Length = 140

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 101/118 (85%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIRAAKAAVDRS+QYA RDRR KKR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRAAKAAVDRSKQYATRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++FK + + S++ L 
Sbjct: 61  WIQRINAAVREHGLTYGRFIDGLNKAGIEVDRKVLSDIAIHEPEAFKALCDQSKTALE 118


>gi|167040675|ref|YP_001663660.1| 50S ribosomal protein L20 [Thermoanaerobacter sp. X514]
 gi|289578710|ref|YP_003477337.1| ribosomal protein L20 [Thermoanaerobacter italicus Ab9]
 gi|297544944|ref|YP_003677246.1| 50S ribosomal protein L20 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|300914716|ref|ZP_07132032.1| ribosomal protein L20 [Thermoanaerobacter sp. X561]
 gi|307724050|ref|YP_003903801.1| 50S ribosomal protein L20 [Thermoanaerobacter sp. X513]
 gi|226730467|sp|B0K3L3|RL20_THEPX RecName: Full=50S ribosomal protein L20
 gi|166854915|gb|ABY93324.1| ribosomal protein L20 [Thermoanaerobacter sp. X514]
 gi|289528423|gb|ADD02775.1| ribosomal protein L20 [Thermoanaerobacter italicus Ab9]
 gi|296842719|gb|ADH61235.1| ribosomal protein L20 [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|300889651|gb|EFK84797.1| ribosomal protein L20 [Thermoanaerobacter sp. X561]
 gi|307581111|gb|ADN54510.1| ribosomal protein L20 [Thermoanaerobacter sp. X513]
          Length = 119

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG++G +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MARVKFGKVTRRRRKKILKLAKGYWGAKSKLFRVANQAVMKSLMYAYIGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + ++YS+FINGL KAGI ++RK+LS++AI    +F+++V +++  L  
Sbjct: 61  WITRINAAARAHGISYSRFINGLKKAGIEINRKMLSEMAIHDEKAFEELVNIAKQHLNA 119


>gi|84684099|ref|ZP_01012001.1| 50S ribosomal protein L20 [Maritimibacter alkaliphilus HTCC2654]
 gi|84667852|gb|EAQ14320.1| 50S ribosomal protein L20 [Rhodobacterales bacterium HTCC2654]
          Length = 120

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 69/120 (57%), Positives = 91/120 (75%), Gaps = 2/120 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKVL +AKG+YGRR    + A  AVD++ QYA RDR+ +KR+FRSL
Sbjct: 1   MSRVKGGTTTHARHKKVLDAAKGYYGRRSTNFKTATQAVDKANQYATRDRKNRKRNFRSL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + D+F  IV+ +++ L 
Sbjct: 61  WIQRINAAVRAHDEALTYSKFINGLATAGIEVDRKVLADLAVNEPDAFGAIVDKAKAALA 120


>gi|190889928|ref|YP_001976470.1| 50S ribosomal protein L20 [Rhizobium etli CIAT 652]
 gi|218514449|ref|ZP_03511289.1| 50S ribosomal protein L20 [Rhizobium etli 8C-3]
 gi|226730441|sp|B3PYE1|RL20_RHIE6 RecName: Full=50S ribosomal protein L20
 gi|190695207|gb|ACE89292.1| 50S ribosomal protein L20 [Rhizobium etli CIAT 652]
 gi|327191954|gb|EGE58935.1| 50S ribosomal protein L20 [Rhizobium etli CNPAF512]
          Length = 134

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 100/118 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKAAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAFGALVNAAKKALE 118


>gi|54309337|ref|YP_130357.1| 50S ribosomal protein L20 [Photobacterium profundum SS9]
 gi|60390457|sp|Q6LQ71|RL20_PHOPR RecName: Full=50S ribosomal protein L20
 gi|46913773|emb|CAG20555.1| Putative large subunit ribosomal protein L20 [Photobacterium
           profundum SS9]
          Length = 117

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ INGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGLSYSRLINGLKKASIEIDRKILADIAVFDKATFTVLVEKAKAAL 117


>gi|228993300|ref|ZP_04153216.1| 50S ribosomal protein L20 [Bacillus pseudomycoides DSM 12442]
 gi|228999353|ref|ZP_04158932.1| 50S ribosomal protein L20 [Bacillus mycoides Rock3-17]
 gi|229006908|ref|ZP_04164538.1| 50S ribosomal protein L20 [Bacillus mycoides Rock1-4]
 gi|228754308|gb|EEM03723.1| 50S ribosomal protein L20 [Bacillus mycoides Rock1-4]
 gi|228760298|gb|EEM09265.1| 50S ribosomal protein L20 [Bacillus mycoides Rock3-17]
 gi|228766368|gb|EEM15011.1| 50S ribosomal protein L20 [Bacillus pseudomycoides DSM 12442]
          Length = 118

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKNTLFKVANQQVMKSLLYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  ++++ L
Sbjct: 61  WITRINAAARINGLSYSRLMHGLKVAGIEVNRKMLADLAVHDEKAFAELATVAKNNL 117


>gi|15601055|ref|NP_232686.1| 50S ribosomal protein L20 [Vibrio cholerae O1 biovar eltor str.
           N16961]
 gi|121591863|ref|ZP_01679034.1| ribosomal protein L20 [Vibrio cholerae 2740-80]
 gi|121730163|ref|ZP_01682557.1| ribosomal protein L20 [Vibrio cholerae V52]
 gi|147672501|ref|YP_001215775.1| 50S ribosomal protein L20 [Vibrio cholerae O395]
 gi|153803258|ref|ZP_01957844.1| ribosomal protein L20 [Vibrio cholerae MZO-3]
 gi|153817494|ref|ZP_01970161.1| ribosomal protein L20 [Vibrio cholerae NCTC 8457]
 gi|153824065|ref|ZP_01976732.1| ribosomal protein L20 [Vibrio cholerae B33]
 gi|153827715|ref|ZP_01980382.1| ribosomal protein L20 [Vibrio cholerae MZO-2]
 gi|153829056|ref|ZP_01981723.1| ribosomal protein L20 [Vibrio cholerae 623-39]
 gi|227811913|ref|YP_002811923.1| ribosomal protein L20 [Vibrio cholerae M66-2]
 gi|229506556|ref|ZP_04396065.1| LSU ribosomal protein L20p [Vibrio cholerae BX 330286]
 gi|229510648|ref|ZP_04400128.1| LSU ribosomal protein L20p [Vibrio cholerae B33]
 gi|229514762|ref|ZP_04404223.1| LSU ribosomal protein L20p [Vibrio cholerae TMA 21]
 gi|229517221|ref|ZP_04406666.1| LSU ribosomal protein L20p [Vibrio cholerae RC9]
 gi|229522963|ref|ZP_04412377.1| LSU ribosomal protein L20p [Vibrio cholerae TM 11079-80]
 gi|229526099|ref|ZP_04415503.1| LSU ribosomal protein L20p [Vibrio cholerae bv. albensis VL426]
 gi|229527750|ref|ZP_04417141.1| LSU ribosomal protein L20p [Vibrio cholerae 12129(1)]
 gi|229606035|ref|YP_002876739.1| 50S ribosomal protein L20 [Vibrio cholerae MJ-1236]
 gi|254225617|ref|ZP_04919225.1| ribosomal protein L20 [Vibrio cholerae V51]
 gi|254284962|ref|ZP_04959928.1| ribosomal protein L20 [Vibrio cholerae AM-19226]
 gi|254850511|ref|ZP_05239861.1| 50S ribosomal protein L20 [Vibrio cholerae MO10]
 gi|255745911|ref|ZP_05419858.1| LSU ribosomal protein L20p [Vibrio cholera CIRS 101]
 gi|258623267|ref|ZP_05718274.1| 50S ribosomal protein L20 [Vibrio mimicus VM573]
 gi|258625492|ref|ZP_05720384.1| 50S ribosomal protein L20 [Vibrio mimicus VM603]
 gi|262163532|ref|ZP_06031278.1| LSU ribosomal protein L20p [Vibrio cholerae INDRE 91/1]
 gi|262164338|ref|ZP_06032076.1| LSU ribosomal protein L20p [Vibrio mimicus VM223]
 gi|262168209|ref|ZP_06035907.1| LSU ribosomal protein L20p [Vibrio cholerae RC27]
 gi|262173545|ref|ZP_06041222.1| LSU ribosomal protein L20p [Vibrio mimicus MB-451]
 gi|262403449|ref|ZP_06080007.1| LSU ribosomal protein L20p [Vibrio sp. RC586]
 gi|297579607|ref|ZP_06941534.1| ribosomal protein L20 [Vibrio cholerae RC385]
 gi|60393653|sp|P0A479|RL20_VIBCH RecName: Full=50S ribosomal protein L20
 gi|60393654|sp|P0A480|RL20_VIBMI RecName: Full=50S ribosomal protein L20
 gi|172047340|sp|A5EZ15|RL20_VIBC3 RecName: Full=50S ribosomal protein L20
 gi|254800350|sp|C3LUW1|RL20_VIBCM RecName: Full=50S ribosomal protein L20
 gi|9657687|gb|AAF96198.1| ribosomal protein L20 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|11345547|gb|AAG34727.1| ribosomal protein L20 [Vibrio mimicus]
 gi|121546270|gb|EAX56566.1| ribosomal protein L20 [Vibrio cholerae 2740-80]
 gi|121628082|gb|EAX60622.1| ribosomal protein L20 [Vibrio cholerae V52]
 gi|124121198|gb|EAY39941.1| ribosomal protein L20 [Vibrio cholerae MZO-3]
 gi|125621832|gb|EAZ50158.1| ribosomal protein L20 [Vibrio cholerae V51]
 gi|126511919|gb|EAZ74513.1| ribosomal protein L20 [Vibrio cholerae NCTC 8457]
 gi|126518415|gb|EAZ75638.1| ribosomal protein L20 [Vibrio cholerae B33]
 gi|146314884|gb|ABQ19424.1| ribosomal protein L20 [Vibrio cholerae O395]
 gi|148875485|gb|EDL73620.1| ribosomal protein L20 [Vibrio cholerae 623-39]
 gi|149737810|gb|EDM52715.1| ribosomal protein L20 [Vibrio cholerae MZO-2]
 gi|150424965|gb|EDN16742.1| ribosomal protein L20 [Vibrio cholerae AM-19226]
 gi|227011055|gb|ACP07266.1| ribosomal protein L20 [Vibrio cholerae M66-2]
 gi|227014958|gb|ACP11167.1| ribosomal protein L20 [Vibrio cholerae O395]
 gi|229334112|gb|EEN99597.1| LSU ribosomal protein L20p [Vibrio cholerae 12129(1)]
 gi|229336257|gb|EEO01275.1| LSU ribosomal protein L20p [Vibrio cholerae bv. albensis VL426]
 gi|229340180|gb|EEO05188.1| LSU ribosomal protein L20p [Vibrio cholerae TM 11079-80]
 gi|229345257|gb|EEO10230.1| LSU ribosomal protein L20p [Vibrio cholerae RC9]
 gi|229348742|gb|EEO13700.1| LSU ribosomal protein L20p [Vibrio cholerae TMA 21]
 gi|229353093|gb|EEO18033.1| LSU ribosomal protein L20p [Vibrio cholerae B33]
 gi|229356907|gb|EEO21825.1| LSU ribosomal protein L20p [Vibrio cholerae BX 330286]
 gi|229372521|gb|ACQ62943.1| LSU ribosomal protein L20p [Vibrio cholerae MJ-1236]
 gi|254846216|gb|EET24630.1| 50S ribosomal protein L20 [Vibrio cholerae MO10]
 gi|255735665|gb|EET91063.1| LSU ribosomal protein L20p [Vibrio cholera CIRS 101]
 gi|258582198|gb|EEW07055.1| 50S ribosomal protein L20 [Vibrio mimicus VM603]
 gi|258584453|gb|EEW09195.1| 50S ribosomal protein L20 [Vibrio mimicus VM573]
 gi|261890903|gb|EEY36890.1| LSU ribosomal protein L20p [Vibrio mimicus MB-451]
 gi|262023452|gb|EEY42155.1| LSU ribosomal protein L20p [Vibrio cholerae RC27]
 gi|262026718|gb|EEY45385.1| LSU ribosomal protein L20p [Vibrio mimicus VM223]
 gi|262028099|gb|EEY46758.1| LSU ribosomal protein L20p [Vibrio cholerae INDRE 91/1]
 gi|262349953|gb|EEY99088.1| LSU ribosomal protein L20p [Vibrio sp. RC586]
 gi|297535253|gb|EFH74087.1| ribosomal protein L20 [Vibrio cholerae RC385]
 gi|327485488|gb|AEA79894.1| LSU ribosomal protein L20p [Vibrio cholerae LMA3894-4]
 gi|327485493|gb|AEA79899.1| LSU ribosomal protein L20p [Vibrio cholerae LMA3894-4]
          Length = 117

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKGAL 117


>gi|134299472|ref|YP_001112968.1| 50S ribosomal protein L20 [Desulfotomaculum reducens MI-1]
 gi|172044281|sp|A4J4Z0|RL20_DESRM RecName: Full=50S ribosomal protein L20
 gi|134052172|gb|ABO50143.1| LSU ribosomal protein L20P [Desulfotomaculum reducens MI-1]
          Length = 118

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  VVS  +H+K+LK AKG+ G R    R A  AV +   YAYRDRR KKRDFR L
Sbjct: 1   MPRAKSSVVSRNRHRKILKLAKGYRGSRSKLFRVANQAVMKGLFYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+FINGL KAG+ ++RK+L+DLA+    +F ++VEL++S+L 
Sbjct: 61  WIARINAATRMNGLSYSRFINGLKKAGVEVNRKMLADLAVNDAKAFGQLVELAKSKLA 118


>gi|119026092|ref|YP_909937.1| 50S ribosomal protein L20 [Bifidobacterium adolescentis ATCC 15703]
 gi|154488865|ref|ZP_02029714.1| hypothetical protein BIFADO_02173 [Bifidobacterium adolescentis
           L2-32]
 gi|166219611|sp|A1A2C2|RL20_BIFAA RecName: Full=50S ribosomal protein L20
 gi|118765676|dbj|BAF39855.1| 50S ribosomal protein L20 [Bifidobacterium adolescentis ATCC 15703]
 gi|154083002|gb|EDN82047.1| hypothetical protein BIFADO_02173 [Bifidobacterium adolescentis
           L2-32]
          Length = 127

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LA++  ++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAVSDPEAFKAIVEQAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|158321003|ref|YP_001513510.1| ribosomal protein L20 [Alkaliphilus oremlandii OhILAs]
 gi|166984655|sp|A8MI82|RL20_ALKOO RecName: Full=50S ribosomal protein L20
 gi|158141202|gb|ABW19514.1| ribosomal protein L20 [Alkaliphilus oremlandii OhILAs]
          Length = 119

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 60/119 (50%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  +HKKVLK AKGF G R    R A   V +S +YAY  R+++KRDFR L
Sbjct: 1   MARVKTGKTAHKRHKKVLKLAKGFRGARSKLFRPANQFVMKSLKYAYIGRKLRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+F+NGL  AGI ++RKVLS++AI   + F ++VE ++ +L  
Sbjct: 61  WITRINAATRANGLSYSKFMNGLKLAGIDMNRKVLSEMAIYDKEGFAQLVETAKQKLNA 119


>gi|172058197|ref|YP_001814657.1| 50S ribosomal protein L20 [Exiguobacterium sibiricum 255-15]
 gi|171990718|gb|ACB61640.1| ribosomal protein L20 [Exiguobacterium sibiricum 255-15]
          Length = 119

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KK LK AKG+YG +    + AK  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYTTRQRRKKQLKLAKGYYGSKHTLFKVAKQQVMKSLMYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+T   +F  + + ++++L  
Sbjct: 61  WITRINAAARINGLSYSRMMHGLKLAGIDVNRKMLADLAVTDATAFASLADTAKAKLNA 119


>gi|326317190|ref|YP_004234862.1| 50S ribosomal protein L20 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323374026|gb|ADX46295.1| ribosomal protein L20 [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 120

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  +KGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALSKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRK+L+DLA+    +F  IVE  + +L  
Sbjct: 61  WIARINAASRELGLTYSQFTNGLKKAAIEIDRKMLADLAVHDKAAFGSIVEQVKVKLAA 119


>gi|163801058|ref|ZP_02194958.1| 50S ribosomal protein L20 [Vibrio sp. AND4]
 gi|159175407|gb|EDP60204.1| 50S ribosomal protein L20 [Vibrio sp. AND4]
          Length = 117

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKSAFAVLVEKAKAAL 117


>gi|257064215|ref|YP_003143887.1| LSU ribosomal protein L20P [Slackia heliotrinireducens DSM 20476]
 gi|256791868|gb|ACV22538.1| LSU ribosomal protein L20P [Slackia heliotrinireducens DSM 20476]
          Length = 117

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 88/117 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK AKG+YG +  + RAAK  V  S QYAYRDRR KKR+ R L
Sbjct: 1   MPRVKRAVHAHKKRRVVLKRAKGYYGAKSRSYRAAKEQVQHSLQYAYRDRRNKKREIRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YS+F+NGL KAG+ LDRKVLSD+AIT  D+F ++V+++++ L
Sbjct: 61  WITRINAACRINDMSYSRFMNGLKKAGVELDRKVLSDMAITDPDAFAQLVQVAKAAL 117


>gi|319779413|ref|YP_004130326.1| LSU ribosomal protein L20p [Taylorella equigenitalis MCE9]
 gi|317109437|gb|ADU92183.1| LSU ribosomal protein L20p [Taylorella equigenitalis MCE9]
          Length = 119

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/119 (59%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++K AKGF GRR N  R AK AV R+ QYAYRDRR KKR FRSL
Sbjct: 1   MPRVKRGVTARARHKKIIKLAKGFRGRRGNVFRVAKQAVMRAGQYAYRDRRNKKRSFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR   + YS FI GL KA I LDRKVL+D+A+     F  IV+ ++  L  
Sbjct: 61  WIARINAAVREQGMTYSAFIAGLKKAAISLDRKVLADMAVNDKPGFAVIVKQAKVALGA 119


>gi|88800314|ref|ZP_01115880.1| Ribosomal protein L20 [Reinekea sp. MED297]
 gi|88776891|gb|EAR08100.1| Ribosomal protein L20 [Reinekea sp. MED297]
          Length = 118

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKKVLK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKVLKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  RV  L+YS+FINGL KA + +DRKVL+D+A+    +F  I E +++ L 
Sbjct: 61  WIARINAEARVNGLSYSKFINGLKKADVEIDRKVLADIAVHDKSAFAAIAEQAKASLA 118


>gi|224476769|ref|YP_002634375.1| 50S ribosomal protein L20 [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254800339|sp|B9DNC4|RL20_STACT RecName: Full=50S ribosomal protein L20
 gi|222421376|emb|CAL28190.1| 50S ribosomal protein L20 [Staphylococcus carnosus subsp. carnosus
           TM300]
          Length = 118

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KKV+K AKG++G ++   + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKVIKLAKGYFGAKRTLYKTAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + ++YS+ +NGL +A I ++RK+LS++AI+   +F ++VE +++ L
Sbjct: 61  WITRINAAARNHGMSYSKLMNGLKQADIDINRKMLSEIAISDDKAFGELVEKAKAAL 117


>gi|110004468|emb|CAK98805.1| 50s ribosomal protein l20 [Spiroplasma citri]
          Length = 119

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KK++K AKG++G +    + AK  V +S  YA+RDR+ +KRDFRSL
Sbjct: 1   MARVKGGSTTRKRRKKIIKEAKGYFGTKSTHYKKAKEQVMKSWSYAFRDRKQRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D++YSQF+NGL+K  I ++RK+LS+LAI   + FK +VE S+  L
Sbjct: 61  WIQRINAAVREHDMSYSQFMNGLNKTNIEVNRKILSELAIHNPNEFKVLVEKSKQAL 117


>gi|132760|sp|P13070|RL20_BACST RecName: Full=50S ribosomal protein L20
 gi|39963|emb|CAA34314.1| unnamed protein product [Geobacillus stearothermophilus]
          Length = 119

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    R A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGPVTRRRRKKVLKLAKGYFGAKHALYRVANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+ ++GL  AG+ ++RK+++DLA+    +F ++ +L+++ L
Sbjct: 61  WIVRINAAARQNGLSYSRLMHGLKLAGVEVNRKIVADLAVNDQAAFAQLADLAKANL 117


>gi|319403568|emb|CBI77150.1| 50S ribosomal protein L20 [Bartonella rochalimae ATCC BAA-1498]
 gi|319406480|emb|CBI80121.1| 50S ribosomal protein L20 [Bartonella sp. 1-1C]
          Length = 133

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 96/118 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVLK AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVVAHAKHKKVLKQAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVRV  L Y +FI+GL KAGI +DRK+LSD+AI     F  +V+ ++  L 
Sbjct: 61  WIQRINAAVRVEGLTYGRFIDGLTKAGIEIDRKILSDIAIYDPTVFIALVDSAKKALE 118


>gi|90410624|ref|ZP_01218640.1| 50S ribosomal protein L20 [Photobacterium profundum 3TCK]
 gi|90328865|gb|EAS45149.1| 50S ribosomal protein L20 [Photobacterium profundum 3TCK]
          Length = 117

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+ INGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGMSYSRLINGLKKASIEIDRKILADIAVFDKATFTVLVEKAKAAL 117


>gi|77360342|ref|YP_339917.1| 50S ribosomal protein L20 [Pseudoalteromonas haloplanktis TAC125]
 gi|109893137|sp|Q3IL78|RL20_PSEHT RecName: Full=50S ribosomal protein L20
 gi|76875253|emb|CAI86474.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Pseudoalteromonas haloplanktis TAC125]
          Length = 120

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/119 (54%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+FI+GL K  + +DRK+L+D+A+    +F  +VE ++  L  
Sbjct: 61  WIARINAASRQNGLSYSRFISGLKKTSVEIDRKILADIAVYDQVAFAALVEKAKEGLAA 119


>gi|85059399|ref|YP_455101.1| 50S ribosomal protein L20 [Sodalis glossinidius str. 'morsitans']
 gi|109893154|sp|Q2NT29|RL20_SODGM RecName: Full=50S ribosomal protein L20
 gi|84779919|dbj|BAE74696.1| 50S ribosomal protein L20 [Sodalis glossinidius str. 'morsitans']
          Length = 118

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  + + ++  L+
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASIEIDRKILADIAVFDKVAFAALADKAKGDLV 118


>gi|300744016|ref|ZP_07073036.1| ribosomal protein L20 [Rothia dentocariosa M567]
 gi|311113268|ref|YP_003984490.1| 50S ribosomal protein L20 [Rothia dentocariosa ATCC 17931]
 gi|300380377|gb|EFJ76940.1| ribosomal protein L20 [Rothia dentocariosa M567]
 gi|310944762|gb|ADP41056.1| 50S ribosomal protein L20 [Rothia dentocariosa ATCC 17931]
          Length = 126

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L  A G+ G+R    R AK  V  S  Y+Y  RR KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRTILDRASGYRGQRSRLYRKAKEQVTHSLVYSYDHRRKKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +  +F  +VE+++  L  D
Sbjct: 61  WIQRINAASRAQGLTYNRFIQGLKAAGVEVDRRMLAELAVNEPAAFNALVEIAKKNLPED 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|319794588|ref|YP_004156228.1| ribosomal protein l20 [Variovorax paradoxus EPS]
 gi|315597051|gb|ADU38117.1| ribosomal protein L20 [Variovorax paradoxus EPS]
          Length = 119

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRVAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NG+ KAGI +DRK+L+D+A+    +F  IVE  +++L  
Sbjct: 61  WIARINAASRELGLTYSQFANGIRKAGIEIDRKMLADIAVHDKAAFAGIVEQVKAKLAA 119


>gi|73540972|ref|YP_295492.1| 50S ribosomal protein L20 [Ralstonia eutropha JMP134]
 gi|94310108|ref|YP_583318.1| 50S ribosomal protein L20 [Cupriavidus metallidurans CH34]
 gi|113867360|ref|YP_725849.1| 50S ribosomal protein L20 [Ralstonia eutropha H16]
 gi|194289386|ref|YP_002005293.1| 50S ribosomal protein l20 [Cupriavidus taiwanensis LMG 19424]
 gi|109893141|sp|Q472N5|RL20_RALEJ RecName: Full=50S ribosomal protein L20
 gi|123329355|sp|Q0KBZ0|RL20_RALEH RecName: Full=50S ribosomal protein L20
 gi|166220732|sp|Q1LP77|RL20_RALME RecName: Full=50S ribosomal protein L20
 gi|226730383|sp|B3R4J4|RL20_CUPTR RecName: Full=50S ribosomal protein L20
 gi|72118385|gb|AAZ60648.1| LSU ribosomal protein L20P [Ralstonia eutropha JMP134]
 gi|93353960|gb|ABF08049.1| 50S ribosomal subunit protein L20 [Cupriavidus metallidurans CH34]
 gi|113526136|emb|CAJ92481.1| LSU ribosomal protein L20 [Ralstonia eutropha H16]
 gi|193223221|emb|CAQ69226.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Cupriavidus taiwanensis LMG 19424]
          Length = 118

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIDAAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R + + YS F+NGL KA I LDRKVLSD+AI    +F  IV   ++ + 
Sbjct: 61  WIARINAATREHGMTYSVFMNGLKKASIELDRKVLSDMAIHDKPAFAAIVNQVKATVA 118


>gi|317131313|ref|YP_004090627.1| ribosomal protein L20 [Ethanoligenens harbinense YUAN-3]
 gi|315469292|gb|ADU25896.1| ribosomal protein L20 [Ethanoligenens harbinense YUAN-3]
          Length = 117

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  + KK+LK AKG++G +    R A  AV +S  YAY  R++KKRDFRSL
Sbjct: 1   MARVKGAMMTRKRRKKILKLAKGYWGGKSRLFRTANEAVMKSLSYAYVGRKLKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS FINGL KAGIVL+RK+LS+LA++    F  +VE +++ L
Sbjct: 61  WITRISAACKLNGMNYSTFINGLKKAGIVLNRKILSELAVSDSAGFAALVEKAKAAL 117


>gi|289422364|ref|ZP_06424210.1| ribosomal protein L20 [Peptostreptococcus anaerobius 653-L]
 gi|289157199|gb|EFD05818.1| ribosomal protein L20 [Peptostreptococcus anaerobius 653-L]
          Length = 118

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+G+ +  +HKK+LK AKGF G R    + +   V +S + AY  R+ KKRDFR L
Sbjct: 1   MARVKKGMNAHKRHKKILKLAKGFRGSRSKLFKTSNQFVMKSLKNAYVGRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R+ D++YS+F++GL KA I ++RK+LS++AI     F ++VE+++S+L 
Sbjct: 61  WIQRINAACRMNDISYSKFMHGLKKADIEVNRKMLSEMAIADPQGFAQLVEVAKSKLA 118


>gi|27365719|ref|NP_761247.1| 50S ribosomal protein L20 [Vibrio vulnificus CMCP6]
 gi|28898056|ref|NP_797661.1| 50S ribosomal protein L20 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37680126|ref|NP_934735.1| 50S ribosomal protein L20 [Vibrio vulnificus YJ016]
 gi|91223966|ref|ZP_01259230.1| 50S ribosomal protein L20 [Vibrio alginolyticus 12G01]
 gi|153835366|ref|ZP_01988033.1| ribosomal protein L20 [Vibrio harveyi HY01]
 gi|153839392|ref|ZP_01992059.1| ribosomal protein L20 [Vibrio parahaemolyticus AQ3810]
 gi|156974367|ref|YP_001445274.1| 50S ribosomal protein L20 [Vibrio harveyi ATCC BAA-1116]
 gi|260366358|ref|ZP_05778797.1| ribosomal protein L20 [Vibrio parahaemolyticus K5030]
 gi|260770316|ref|ZP_05879249.1| LSU ribosomal protein L20p [Vibrio furnissii CIP 102972]
 gi|260878406|ref|ZP_05890761.1| ribosomal protein L20 [Vibrio parahaemolyticus AN-5034]
 gi|260896985|ref|ZP_05905481.1| ribosomal protein L20 [Vibrio parahaemolyticus Peru-466]
 gi|260901784|ref|ZP_05910179.1| ribosomal protein L20 [Vibrio parahaemolyticus AQ4037]
 gi|262394484|ref|YP_003286338.1| 50S ribosomal protein L20p [Vibrio sp. Ex25]
 gi|269963854|ref|ZP_06178166.1| 50S ribosomal protein L20 [Vibrio harveyi 1DA3]
 gi|269966328|ref|ZP_06180415.1| 50S ribosomal protein L20 [Vibrio alginolyticus 40B]
 gi|320156125|ref|YP_004188504.1| 50S ribosomal protein L20p [Vibrio vulnificus MO6-24/O]
 gi|39931706|sp|Q7MK68|RL20_VIBVY RecName: Full=50S ribosomal protein L20
 gi|60393655|sp|P0A481|RL20_VIBPA RecName: Full=50S ribosomal protein L20
 gi|60393656|sp|P0A482|RL20_VIBVU RecName: Full=50S ribosomal protein L20
 gi|166220804|sp|A7N012|RL20_VIBHB RecName: Full=50S ribosomal protein L20
 gi|23452623|gb|AAN33108.1| large subunit ribosomal protein L20 [Vibrio vulnificus]
 gi|27361868|gb|AAO10774.1| ribosomal protein L20 [Vibrio vulnificus CMCP6]
 gi|28806270|dbj|BAC59545.1| large subunit ribosomal protein L20 [Vibrio parahaemolyticus RIMD
           2210633]
 gi|37198872|dbj|BAC94706.1| ribosomal protein L20 [Vibrio vulnificus YJ016]
 gi|91191458|gb|EAS77723.1| 50S ribosomal protein L20 [Vibrio alginolyticus 12G01]
 gi|148868114|gb|EDL67278.1| ribosomal protein L20 [Vibrio harveyi HY01]
 gi|149747087|gb|EDM58075.1| ribosomal protein L20 [Vibrio parahaemolyticus AQ3810]
 gi|156525961|gb|ABU71047.1| hypothetical protein VIBHAR_02082 [Vibrio harveyi ATCC BAA-1116]
 gi|260615654|gb|EEX40840.1| LSU ribosomal protein L20p [Vibrio furnissii CIP 102972]
 gi|262338078|gb|ACY51873.1| LSU ribosomal protein L20p [Vibrio sp. Ex25]
 gi|269829067|gb|EEZ83314.1| 50S ribosomal protein L20 [Vibrio alginolyticus 40B]
 gi|269831341|gb|EEZ85488.1| 50S ribosomal protein L20 [Vibrio harveyi 1DA3]
 gi|308087810|gb|EFO37505.1| ribosomal protein L20 [Vibrio parahaemolyticus Peru-466]
 gi|308091019|gb|EFO40714.1| ribosomal protein L20 [Vibrio parahaemolyticus AN-5034]
 gi|308108153|gb|EFO45693.1| ribosomal protein L20 [Vibrio parahaemolyticus AQ4037]
 gi|308113195|gb|EFO50735.1| ribosomal protein L20 [Vibrio parahaemolyticus K5030]
 gi|315181385|gb|ADT88298.1| 50S ribosomal protein L20 [Vibrio furnissii NCTC 11218]
 gi|319931437|gb|ADV86301.1| LSU ribosomal protein L20p [Vibrio vulnificus MO6-24/O]
 gi|328472986|gb|EGF43834.1| 50S ribosomal protein L20 [Vibrio parahaemolyticus 10329]
          Length = 117

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKAAL 117


>gi|256751284|ref|ZP_05492164.1| ribosomal protein L20 [Thermoanaerobacter ethanolicus CCSD1]
 gi|256749839|gb|EEU62863.1| ribosomal protein L20 [Thermoanaerobacter ethanolicus CCSD1]
          Length = 119

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG++G +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MARVKFGKVTRRRRKKILKLAKGYWGAKSKLFRVANQAVMKSLMYAYIGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + ++YS+FINGL KAGI ++RK+LS++AI    +F ++V +++ +L  
Sbjct: 61  WITRINAAARAHGISYSRFINGLKKAGIEINRKMLSEMAINDEKAFAELVNIAKQQLNA 119


>gi|319892725|ref|YP_004149600.1| LSU ribosomal protein L20p [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317162421|gb|ADV05964.1| LSU ribosomal protein L20p [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464242|gb|ADX76395.1| ribosomal protein L20 [Staphylococcus pseudintermedius ED99]
          Length = 118

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGAKSTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL +AGI ++RK+LS++AI+   +F ++V  +++ L
Sbjct: 61  WITRINAAARQHDMSYSRLMNGLKQAGIDVNRKMLSEIAISDEKAFAELVNQAKAAL 117


>gi|302878341|ref|YP_003846905.1| 50S ribosomal protein L20 [Gallionella capsiferriformans ES-2]
 gi|302581130|gb|ADL55141.1| ribosomal protein L20 [Gallionella capsiferriformans ES-2]
          Length = 119

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A HKK+L  AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVVARATHKKLLAKAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQKKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + + YS F+NGL KA I +DRKVLSD+AI    +F++ V  +++ L V
Sbjct: 61  WIARINAAAREFGMPYSVFMNGLKKADIQIDRKVLSDIAIFDKAAFEQFVVQAKASLAV 119


>gi|239814879|ref|YP_002943789.1| 50S ribosomal protein L20 [Variovorax paradoxus S110]
 gi|259646203|sp|C5CUU5|RL20_VARPS RecName: Full=50S ribosomal protein L20
 gi|239801456|gb|ACS18523.1| ribosomal protein L20 [Variovorax paradoxus S110]
          Length = 119

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRTKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NG+ KAGI +DRK+L+D+A+    +F  IVE  +++L  
Sbjct: 61  WIARINAASRELGLTYSQFANGIRKAGIEIDRKMLADIAVHDKAAFAGIVEQVKAKLAA 119


>gi|89101228|ref|ZP_01174054.1| 50S ribosomal protein L20 [Bacillus sp. NRRL B-14911]
 gi|89084057|gb|EAR63232.1| 50S ribosomal protein L20 [Bacillus sp. NRRL B-14911]
          Length = 119

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 79/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSLMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L++LA+    +F ++  +++  L 
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKVAGIEVNRKMLAELAVADEKAFAELASVAKQNLS 118


>gi|328957062|ref|YP_004374448.1| 50S ribosomal protein L20 [Carnobacterium sp. 17-4]
 gi|328673386|gb|AEB29432.1| 50S ribosomal protein L20 [Carnobacterium sp. 17-4]
          Length = 120

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG+YG +    + AK  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKILKLAKGYYGSKHILFKTAKQQVMKSYTYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ +++YS F++GL  A I ++RK+L+++A+T   +F  + E +++ L
Sbjct: 61  WIARINAAARLNNMSYSTFMHGLKLAEIDVNRKMLAEIAVTDAAAFTALAEQAKTAL 117


>gi|152976956|ref|YP_001376473.1| 50S ribosomal protein L20 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189041848|sp|A7GTM0|RL20_BACCN RecName: Full=50S ribosomal protein L20
 gi|152025708|gb|ABS23478.1| ribosomal protein L20 [Bacillus cytotoxicus NVH 391-98]
          Length = 118

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK++K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKMIKLAKGYYGSKHTLFKVANQQVMKSLLYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  ++++ L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLAGIEVNRKMLADLAVHDEKAFAELATVAKNNL 117


>gi|83590591|ref|YP_430600.1| 50S ribosomal protein L20 [Moorella thermoacetica ATCC 39073]
 gi|109893121|sp|Q2RHN2|RL20_MOOTA RecName: Full=50S ribosomal protein L20
 gi|83573505|gb|ABC20057.1| LSU ribosomal protein L20P [Moorella thermoacetica ATCC 39073]
          Length = 121

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV    +HKK+LK AKG++G +    R A   V +S  YAY  RR +K DFR L
Sbjct: 1   MARVKRGVTKHQRHKKILKLAKGYFGAKSKLFRPANEQVIKSLAYAYAHRRQRKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  +NYS+ +NGL KAG+ ++RK+L+D+A+     F ++V++++ +L
Sbjct: 61  WIARINAAARMNGINYSRLVNGLKKAGVEINRKMLADMAVNDQAGFNRLVDIAKEKL 117


>gi|229180891|ref|ZP_04308226.1| 50S ribosomal protein L20 [Bacillus cereus 172560W]
 gi|228602448|gb|EEK59934.1| 50S ribosomal protein L20 [Bacillus cereus 172560W]
          Length = 118

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKNTLFKVANQQVMKSLMYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  +++S +
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKNAGIEVNRKMLADLAVHDEKAFAELATVAKSNI 117


>gi|78044004|ref|YP_360405.1| 50S ribosomal protein L20 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|109893103|sp|Q3ABS9|RL20_CARHZ RecName: Full=50S ribosomal protein L20
 gi|77996119|gb|ABB15018.1| ribosomal protein L20 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 117

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  VVS  +HKK+LK AKG++G +    R AK  V +S  YAYRDRR +KR+FR L
Sbjct: 1   MPRAKSSVVSRKRHKKILKLAKGYFGAKSKLFRVAKQQVMKSLMYAYRDRRARKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R++ L YS+ +NGL KAG+ ++RK+L+DLA+   ++F ++VE+++  L
Sbjct: 61  WITRINAAARMHGLTYSRMMNGLKKAGVEINRKMLADLAVNDKNAFAELVEIAKKNL 117


>gi|148555346|ref|YP_001262928.1| 50S ribosomal protein L20 [Sphingomonas wittichii RW1]
 gi|166220788|sp|A5V924|RL20_SPHWW RecName: Full=50S ribosomal protein L20
 gi|148500536|gb|ABQ68790.1| LSU ribosomal protein L20P [Sphingomonas wittichii RW1]
          Length = 125

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 92/121 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKHK++L +AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR+L
Sbjct: 1   MARVKRGTTTHAKHKRILGAAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   L Y  F++GL  AGI LDRKVL+D+A+ + ++F  I+  +++ L   
Sbjct: 61  WIQRINAAVRAEGLTYGVFMHGLKLAGIELDRKVLADIAMHEGEAFSGIIAQAKAALPEG 120

Query: 121 V 121
            
Sbjct: 121 A 121


>gi|319938143|ref|ZP_08012541.1| 50S ribosomal protein L20 [Coprobacillus sp. 29_1]
 gi|319806664|gb|EFW03313.1| 50S ribosomal protein L20 [Coprobacillus sp. 29_1]
          Length = 119

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 50/118 (42%), Positives = 75/118 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KK+LK AKG++G +    + A   V  S +YAYRDR+  KR+ R L
Sbjct: 1   MARVKGGYTTRRRRKKILKLAKGYFGSKHTLYKTAHEQVMNSFEYAYRDRKALKREMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ +++YSQ ++GL  A + ++RK+LS++AI     F  IV+ ++  L 
Sbjct: 61  WIARINAAARMNEISYSQLMHGLKLANVEVNRKMLSEIAIADPKGFTAIVDTAKKALA 118


>gi|197294239|ref|YP_001798780.1| 50S ribosomal protein L20/unknown domain fusion protein [Candidatus
           Phytoplasma australiense]
 gi|171853566|emb|CAM11432.1| 50S ribosomal protein L20 [Candidatus Phytoplasma australiense]
          Length = 294

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 50/119 (42%), Positives = 69/119 (57%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M +V        + KKVLK AKG++G +    + A   V RS QYAYRDR+ +KRDFR L
Sbjct: 1   MAKVNFAPARHQRRKKVLKMAKGYFGSKSTLYKTAHEQVMRSLQYAYRDRKQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA      + YS+ ++GL  A + +DRK L+ LA    + F   V+L++S L  
Sbjct: 61  WITRINAGGMSLGIKYSRLMHGLSLAKVDIDRKTLAGLAHLHPEVFSDYVKLAKSSLEQ 119


>gi|74317028|ref|YP_314768.1| 50S ribosomal protein L20 [Thiobacillus denitrificans ATCC 25259]
 gi|109893167|sp|Q3SK31|RL20_THIDA RecName: Full=50S ribosomal protein L20
 gi|74056523|gb|AAZ96963.1| ribosomal protein L20 [Thiobacillus denitrificans ATCC 25259]
          Length = 119

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 86/119 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A HKK+L +AKG+ GRRKN  R A  AV ++ QY YRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARASHKKILDAAKGYRGRRKNVFRVANEAVMKAGQYQYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + L YS F+NGL +A I +DRKVLSD+AI   D+F KIV+  +++L  
Sbjct: 61  WIARINAAARQHGLTYSVFMNGLSRAEIGVDRKVLSDIAIFDKDAFAKIVDQVKAKLAA 119


>gi|30248958|ref|NP_841028.1| 50S ribosomal protein L20 [Nitrosomonas europaea ATCC 19718]
 gi|39931890|sp|Q82VV4|RL20_NITEU RecName: Full=50S ribosomal protein L20
 gi|30138575|emb|CAD84866.1| Ribosomal protein L20 [Nitrosomonas europaea ATCC 19718]
          Length = 119

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAKARHKKILKLAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   + YS F+NG+ KAGI LDRK+L+DLA+    +F+KI    ++ L 
Sbjct: 61  WIARINAAARELGMTYSTFMNGIRKAGISLDRKILADLAVFDKVAFEKITNQVKAGLA 118


>gi|319651795|ref|ZP_08005920.1| 50S ribosomal protein L20 [Bacillus sp. 2_A_57_CT2]
 gi|317396447|gb|EFV77160.1| 50S ribosomal protein L20 [Bacillus sp. 2_A_57_CT2]
          Length = 119

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 80/118 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG++G +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVIKLAKGYFGSKHTLYKVANQQVMKSLMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           W+ RINAA R+  L+YS+ ++GL  AGI ++RK+L++LAI    +F ++  +++ +L 
Sbjct: 61  WVTRINAAARMNGLSYSRLMHGLKLAGIEVNRKMLAELAIADEKAFAELASVAKQQLS 118


>gi|40062679|gb|AAR37592.1| ribosomal protein L20 [uncultured marine bacterium 314]
          Length = 118

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 77/117 (65%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S A+HKKVLK  KG YGRRKNTIR AK A++++ QYAYRDRR KKR+FRSL
Sbjct: 1   MARVKRGVTSHARHKKVLKQVKGQYGRRKNTIRVAKQALEKAMQYAYRDRRAKKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   + YS+FINGL+K+GI LDRKVL+D+A    ++FK IV+  +S L
Sbjct: 61  WIQRINAGVRAEGITYSKFINGLNKSGIKLDRKVLADIAYNNPEAFKSIVKKVQSSL 117


>gi|84500415|ref|ZP_00998664.1| 50S ribosomal protein L20 [Oceanicola batsensis HTCC2597]
 gi|84391368|gb|EAQ03700.1| 50S ribosomal protein L20 [Oceanicola batsensis HTCC2597]
          Length = 120

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 71/120 (59%), Positives = 94/120 (78%), Gaps = 2/120 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKVLK+AKG+YGRR  T + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVLKAAKGYYGRRSTTFKVATQAVDKANQYATRDRKARKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + D+F  IV+ +++ L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPDAFGAIVDKAKAALA 120


>gi|229087129|ref|ZP_04219279.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-44]
 gi|228696197|gb|EEL49032.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-44]
          Length = 118

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKNTLFKVANQQVMKSLMYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++   +++ L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKNAGIEVNRKMLADLAVHDEKAFAELATAAKNNL 117


>gi|167751465|ref|ZP_02423592.1| hypothetical protein EUBSIR_02461 [Eubacterium siraeum DSM 15702]
 gi|167655273|gb|EDR99402.1| hypothetical protein EUBSIR_02461 [Eubacterium siraeum DSM 15702]
 gi|291530274|emb|CBK95859.1| LSU ribosomal protein L20P [Eubacterium siraeum 70/3]
 gi|291557089|emb|CBL34206.1| LSU ribosomal protein L20P [Eubacterium siraeum V10Sc8a]
          Length = 117

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K  + +  +  K LK AKG++G +    + AK AV +S QYAY  RR+KKRDFR L
Sbjct: 1   MARIKGALATRKRRNKTLKLAKGYWGGKSRLFKTAKEAVWKSGQYAYISRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA ++   NYS FINGL KA I L+RK+LS++AI     F  +VE +++ L
Sbjct: 61  WIARINAACKMNGTNYSTFINGLKKANIGLNRKMLSEIAINDPAGFTALVEKAKAAL 117


>gi|23335403|ref|ZP_00120639.1| COG0292: Ribosomal protein L20 [Bifidobacterium longum DJO10A]
 gi|189439097|ref|YP_001954178.1| 50S ribosomal protein L20 [Bifidobacterium longum DJO10A]
 gi|239621211|ref|ZP_04664242.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|312132534|ref|YP_003999873.1| rplt [Bifidobacterium longum subsp. longum BBMN68]
 gi|317482509|ref|ZP_07941525.1| ribosomal protein L20 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322691425|ref|YP_004220995.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|226730358|sp|B3DQT4|RL20_BIFLD RecName: Full=50S ribosomal protein L20
 gi|189427532|gb|ACD97680.1| Ribosomal protein L20 [Bifidobacterium longum DJO10A]
 gi|239515672|gb|EEQ55539.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|291516705|emb|CBK70321.1| LSU ribosomal protein L20P [Bifidobacterium longum subsp. longum
           F8]
 gi|311773468|gb|ADQ02956.1| RplT [Bifidobacterium longum subsp. longum BBMN68]
 gi|316916061|gb|EFV37467.1| ribosomal protein L20 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456281|dbj|BAJ66903.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. longum JCM
           1217]
          Length = 127

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L+++A++  D+FK IV+ +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAEIAVSDPDTFKTIVDAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|53719555|ref|YP_108541.1| 50S ribosomal protein L20 [Burkholderia pseudomallei K96243]
 gi|53725299|ref|YP_102784.1| 50S ribosomal protein L20 [Burkholderia mallei ATCC 23344]
 gi|76811509|ref|YP_333293.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1710b]
 gi|78066089|ref|YP_368858.1| 50S ribosomal protein L20 [Burkholderia sp. 383]
 gi|83720846|ref|YP_443108.1| 50S ribosomal protein L20 [Burkholderia thailandensis E264]
 gi|107022551|ref|YP_620878.1| 50S ribosomal protein L20 [Burkholderia cenocepacia AU 1054]
 gi|116689500|ref|YP_835123.1| 50S ribosomal protein L20 [Burkholderia cenocepacia HI2424]
 gi|121600171|ref|YP_992863.1| 50S ribosomal protein L20 [Burkholderia mallei SAVP1]
 gi|124383575|ref|YP_001026203.1| 50S ribosomal protein L20 [Burkholderia mallei NCTC 10229]
 gi|126439011|ref|YP_001058755.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 668]
 gi|126448576|ref|YP_001080527.1| 50S ribosomal protein L20 [Burkholderia mallei NCTC 10247]
 gi|126455404|ref|YP_001066008.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1106a]
 gi|134282222|ref|ZP_01768927.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 305]
 gi|134295550|ref|YP_001119285.1| 50S ribosomal protein L20 [Burkholderia vietnamiensis G4]
 gi|161524949|ref|YP_001579961.1| 50S ribosomal protein L20 [Burkholderia multivorans ATCC 17616]
 gi|167587360|ref|ZP_02379748.1| ribosomal protein L20 [Burkholderia ubonensis Bu]
 gi|170732805|ref|YP_001764752.1| 50S ribosomal protein L20 [Burkholderia cenocepacia MC0-3]
 gi|186476313|ref|YP_001857783.1| 50S ribosomal protein L20 [Burkholderia phymatum STM815]
 gi|189350303|ref|YP_001945931.1| 50S ribosomal protein L20 [Burkholderia multivorans ATCC 17616]
 gi|206559850|ref|YP_002230614.1| 50S ribosomal protein L20 [Burkholderia cenocepacia J2315]
 gi|217423695|ref|ZP_03455196.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 576]
 gi|221197736|ref|ZP_03570782.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD2M]
 gi|221204706|ref|ZP_03577723.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD2]
 gi|221214901|ref|ZP_03587869.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD1]
 gi|226199674|ref|ZP_03795227.1| 50S ribosomal protein L20 [Burkholderia pseudomallei Pakistan 9]
 gi|237812019|ref|YP_002896470.1| ribosomal protein L20 [Burkholderia pseudomallei MSHR346]
 gi|238027728|ref|YP_002911959.1| 50S ribosomal protein L20 [Burkholderia glumae BGR1]
 gi|238562602|ref|ZP_00440145.2| 50S ribosomal protein L20 [Burkholderia mallei GB8 horse 4]
 gi|242318100|ref|ZP_04817116.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1106b]
 gi|251767931|ref|ZP_02268877.2| 50S ribosomal protein L20 [Burkholderia mallei PRL-20]
 gi|254178226|ref|ZP_04884881.1| 50S ribosomal protein L20 [Burkholderia mallei ATCC 10399]
 gi|254180001|ref|ZP_04886600.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1655]
 gi|254188585|ref|ZP_04895096.1| 50S ribosomal protein L20 [Burkholderia pseudomallei Pasteur 52237]
 gi|254197460|ref|ZP_04903882.1| 50S ribosomal protein L20 [Burkholderia pseudomallei S13]
 gi|254199736|ref|ZP_04906102.1| 50S ribosomal protein L20 [Burkholderia mallei FMH]
 gi|254206058|ref|ZP_04912410.1| 50S ribosomal protein L20 [Burkholderia mallei JHU]
 gi|254245607|ref|ZP_04938928.1| Ribosomal protein L20 [Burkholderia cenocepacia PC184]
 gi|254260097|ref|ZP_04951151.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1710a]
 gi|254297836|ref|ZP_04965289.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 406e]
 gi|254358429|ref|ZP_04974702.1| 50S ribosomal protein L20 [Burkholderia mallei 2002721280]
 gi|330816672|ref|YP_004360377.1| 50S ribosomal protein L20 [Burkholderia gladioli BSR3]
 gi|60390321|sp|Q62KI5|RL20_BURMA RecName: Full=50S ribosomal protein L20
 gi|60390332|sp|Q63TM5|RL20_BURPS RecName: Full=50S ribosomal protein L20
 gi|109893100|sp|Q3JT10|RL20_BURP1 RecName: Full=50S ribosomal protein L20
 gi|109893101|sp|Q39H52|RL20_BURS3 RecName: Full=50S ribosomal protein L20
 gi|109893102|sp|Q2SVE1|RL20_BURTA RecName: Full=50S ribosomal protein L20
 gi|123371646|sp|Q1BWV0|RL20_BURCA RecName: Full=50S ribosomal protein L20
 gi|166219615|sp|A0K6V3|RL20_BURCH RecName: Full=50S ribosomal protein L20
 gi|166219616|sp|A3MJU1|RL20_BURM7 RecName: Full=50S ribosomal protein L20
 gi|166219617|sp|A2S2N4|RL20_BURM9 RecName: Full=50S ribosomal protein L20
 gi|166219618|sp|A1V3R0|RL20_BURMS RecName: Full=50S ribosomal protein L20
 gi|166219619|sp|A3NUI7|RL20_BURP0 RecName: Full=50S ribosomal protein L20
 gi|166219620|sp|A3N8T4|RL20_BURP6 RecName: Full=50S ribosomal protein L20
 gi|166219621|sp|A4JDU7|RL20_BURVG RecName: Full=50S ribosomal protein L20
 gi|226730365|sp|B1K094|RL20_BURCC RecName: Full=50S ribosomal protein L20
 gi|226730366|sp|B4E7I8|RL20_BURCJ RecName: Full=50S ribosomal protein L20
 gi|226730367|sp|A9ABF6|RL20_BURM1 RecName: Full=50S ribosomal protein L20
 gi|226730368|sp|B2JJJ4|RL20_BURP8 RecName: Full=50S ribosomal protein L20
 gi|52209969|emb|CAH35941.1| 50S ribosomal protein L20 [Burkholderia pseudomallei K96243]
 gi|52428722|gb|AAU49315.1| ribosomal protein L20 [Burkholderia mallei ATCC 23344]
 gi|76580962|gb|ABA50437.1| ribosomal protein L20 [Burkholderia pseudomallei 1710b]
 gi|77966834|gb|ABB08214.1| LSU ribosomal protein L20P [Burkholderia sp. 383]
 gi|83654671|gb|ABC38734.1| ribosomal protein L20 [Burkholderia thailandensis E264]
 gi|105892740|gb|ABF75905.1| LSU ribosomal protein L20P [Burkholderia cenocepacia AU 1054]
 gi|116647589|gb|ABK08230.1| LSU ribosomal protein L20P [Burkholderia cenocepacia HI2424]
 gi|121228981|gb|ABM51499.1| 50S ribosomal protein L20 [Burkholderia mallei SAVP1]
 gi|124291595|gb|ABN00864.1| 50S ribosomal protein L20 [Burkholderia mallei NCTC 10229]
 gi|124870383|gb|EAY62099.1| Ribosomal protein L20 [Burkholderia cenocepacia PC184]
 gi|126218504|gb|ABN82010.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 668]
 gi|126229046|gb|ABN92586.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1106a]
 gi|126241446|gb|ABO04539.1| 50S ribosomal protein L20 [Burkholderia mallei NCTC 10247]
 gi|134138707|gb|ABO54450.1| LSU ribosomal protein L20P [Burkholderia vietnamiensis G4]
 gi|134246260|gb|EBA46349.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 305]
 gi|147749332|gb|EDK56406.1| 50S ribosomal protein L20 [Burkholderia mallei FMH]
 gi|147753501|gb|EDK60566.1| 50S ribosomal protein L20 [Burkholderia mallei JHU]
 gi|148027556|gb|EDK85577.1| 50S ribosomal protein L20 [Burkholderia mallei 2002721280]
 gi|157807770|gb|EDO84940.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 406e]
 gi|157936264|gb|EDO91934.1| 50S ribosomal protein L20 [Burkholderia pseudomallei Pasteur 52237]
 gi|160342378|gb|ABX15464.1| ribosomal protein L20 [Burkholderia multivorans ATCC 17616]
 gi|160699265|gb|EDP89235.1| 50S ribosomal protein L20 [Burkholderia mallei ATCC 10399]
 gi|169654201|gb|EDS86894.1| 50S ribosomal protein L20 [Burkholderia pseudomallei S13]
 gi|169816047|gb|ACA90630.1| ribosomal protein L20 [Burkholderia cenocepacia MC0-3]
 gi|184192772|gb|ACC70737.1| ribosomal protein L20 [Burkholderia phymatum STM815]
 gi|184210541|gb|EDU07584.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1655]
 gi|189334325|dbj|BAG43395.1| large subunit ribosomal protein L20 [Burkholderia multivorans ATCC
           17616]
 gi|198035891|emb|CAR51783.1| 50S ribosomal protein L20 [Burkholderia cenocepacia J2315]
 gi|217393553|gb|EEC33574.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 576]
 gi|221165128|gb|EED97606.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD1]
 gi|221175563|gb|EEE07993.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD2]
 gi|221181668|gb|EEE14069.1| 50S ribosomal protein L20 [Burkholderia multivorans CGD2M]
 gi|225928260|gb|EEH24294.1| 50S ribosomal protein L20 [Burkholderia pseudomallei Pakistan 9]
 gi|237506728|gb|ACQ99046.1| ribosomal protein L20 [Burkholderia pseudomallei MSHR346]
 gi|237876922|gb|ACR29255.1| 50S ribosomal protein L20 [Burkholderia glumae BGR1]
 gi|238522287|gb|EEP85732.1| 50S ribosomal protein L20 [Burkholderia mallei GB8 horse 4]
 gi|242141339|gb|EES27741.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1106b]
 gi|243061338|gb|EES43524.1| 50S ribosomal protein L20 [Burkholderia mallei PRL-20]
 gi|254218786|gb|EET08170.1| 50S ribosomal protein L20 [Burkholderia pseudomallei 1710a]
 gi|325528724|gb|EGD05794.1| 50S ribosomal protein L20 [Burkholderia sp. TJI49]
 gi|327369065|gb|AEA60421.1| 50S ribosomal protein L20 [Burkholderia gladioli BSR3]
          Length = 119

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/119 (57%), Positives = 86/119 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++  AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKIINLAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR +D+ YS FINGL KA I LDRKVL+D+A+    +F  IV+  ++ +  
Sbjct: 61  WITRINAAVRQHDMTYSVFINGLKKASIELDRKVLADMAVFDKAAFAAIVKQVKAAVAA 119


>gi|256394617|ref|YP_003116181.1| 50S ribosomal protein L20 [Catenulispora acidiphila DSM 44928]
 gi|256360843|gb|ACU74340.1| ribosomal protein L20 [Catenulispora acidiphila DSM 44928]
          Length = 129

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRVVLEQASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKDRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH A + +DRK+L++LA+   D+F+ +VE+++  L  D
Sbjct: 61  WIQRINAAVRAEGMTYNRFIQGLHLANVEVDRKMLAELAVNDADAFRALVEVAKKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|89052942|ref|YP_508393.1| 50S ribosomal protein L20 [Jannaschia sp. CCS1]
 gi|109893118|sp|Q28V94|RL20_JANSC RecName: Full=50S ribosomal protein L20
 gi|88862491|gb|ABD53368.1| LSU ribosomal protein L20P [Jannaschia sp. CCS1]
          Length = 119

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 89/119 (74%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K G V+  +HKKV+ +AKG+YG R    R A  AVD++ QYA RDR+ +KR FR+L
Sbjct: 1   MSRTKGGTVTHRRHKKVIDAAKGYYGARSTNFRTATQAVDKANQYATRDRKNRKRQFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +D  L YS+FINGL KAGI +DRKVL+DLA+ + D+F  IV+ +++ L
Sbjct: 61  WIQRINAAVRQHDEALTYSRFINGLAKAGIEVDRKVLADLAVHEPDAFSAIVDQAKAAL 119


>gi|320531670|ref|ZP_08032610.1| ribosomal protein L20 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320136090|gb|EFW28098.1| ribosomal protein L20 [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 126

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YA+RDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEKASGYRGQRSRLYRKAKEQVTHSGVYAFRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA RV  L Y++FI GL  AG+ +DR++L++LA+ + + FK +VE++R  L  D
Sbjct: 61  WIQRINAAARVEGLTYNRFIQGLGLAGVEIDRRMLAELAVNEPEGFKALVEVARKALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|222152875|ref|YP_002562052.1| 50S ribosomal protein L20 [Streptococcus uberis 0140J]
 gi|254800343|sp|B9DU42|RL20_STRU0 RecName: Full=50S ribosomal protein L20
 gi|222113688|emb|CAR41626.1| 50S ribosomal protein L20 [Streptococcus uberis 0140J]
          Length = 119

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+     F  + + ++ +L 
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLADIEVNRKMLADLAVNDAAGFTALADAAKDKLA 118


>gi|150389422|ref|YP_001319471.1| ribosomal protein L20 [Alkaliphilus metalliredigens QYMF]
 gi|166984625|sp|A6TNP4|RL20_ALKMQ RecName: Full=50S ribosomal protein L20
 gi|149949284|gb|ABR47812.1| ribosomal protein L20 [Alkaliphilus metalliredigens QYMF]
          Length = 119

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+GV +  +HKKVLK AKGF G R    R A   V ++ ++AY  R+++KRDFR L
Sbjct: 1   MARVKKGVTARKRHKKVLKLAKGFRGARSKLFRPANQFVMKALRHAYVGRKLRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+FI+GL  +GI ++RKVLS++AI   + F ++VE ++ +L  
Sbjct: 61  WITRINAATRINGLSYSKFISGLKLSGIEMNRKVLSEMAIHDKEGFAQLVETAKQKLNA 119


>gi|262275833|ref|ZP_06053642.1| LSU ribosomal protein L20p [Grimontia hollisae CIP 101886]
 gi|262219641|gb|EEY70957.1| LSU ribosomal protein L20p [Grimontia hollisae CIP 101886]
          Length = 117

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASIEIDRKILADIAVFDKVAFSALVEKAKAAL 117


>gi|295839839|ref|ZP_06826772.1| ribosomal protein L20 [Streptomyces sp. SPB74]
 gi|302518072|ref|ZP_07270414.1| ribosomal protein L20 [Streptomyces sp. SPB78]
 gi|318061735|ref|ZP_07980456.1| 50S ribosomal protein L20 [Streptomyces sp. SA3_actG]
 gi|318080744|ref|ZP_07988076.1| 50S ribosomal protein L20 [Streptomyces sp. SA3_actF]
 gi|197698678|gb|EDY45611.1| ribosomal protein L20 [Streptomyces sp. SPB74]
 gi|302426967|gb|EFK98782.1| ribosomal protein L20 [Streptomyces sp. SPB78]
          Length = 128

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 75/123 (60%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRSVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A I +DRK+L++LA+    +F  +VE ++  L  D
Sbjct: 61  WIQRINAAARANGITYNRFIQGLKAANIEVDRKILAELAVHDAGAFAALVEAAQKALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|257877208|ref|ZP_05656861.1| ribosomal protein L20 [Enterococcus casseliflavus EC20]
 gi|257811374|gb|EEV40194.1| ribosomal protein L20 [Enterococcus casseliflavus EC20]
          Length = 119

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 76/117 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ + GL  A I ++RK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIARINAAARMNGLSYSKLMYGLKLAEIDINRKMLADLAVNDAAAFTALADQAKDAL 117


>gi|306820004|ref|ZP_07453654.1| 50S ribosomal protein L20 [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
 gi|304551952|gb|EFM39893.1| 50S ribosomal protein L20 [Eubacterium yurii subsp. margaretiae
           ATCC 43715]
          Length = 119

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 76/117 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+ + +  +HKK+LK AKGF G R    + A   V ++  YAY  R+ KKR+FR L
Sbjct: 1   MARVKKALNAKKRHKKILKLAKGFRGARSKLFKTANQFVMKALAYAYIGRKQKKRNFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R Y L+YSQF++GL  + I ++RK+LS++AI     F+ +V+ S+  L
Sbjct: 61  WITRINAGTRQYGLSYSQFMHGLKLSKIDINRKMLSEIAIKDPAGFEALVKTSKQAL 117


>gi|94676716|ref|YP_588907.1| 50S ribosomal protein L20 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|166219610|sp|Q1LT07|RL20_BAUCH RecName: Full=50S ribosomal protein L20
 gi|94219866|gb|ABF14025.1| ribosomal protein L20 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 120

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK A G+YG R    R A  AV ++ QY YRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKLANGYYGARSRVYRVAFQAVLKAGQYCYRDRRCKKRQFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR + + YS F+N L KA I +DRK+L+++AI+   +F  + E ++S L
Sbjct: 61  WITRINAAVRQHGITYSCFMNSLKKASIHIDRKILAEIAISDKVAFATLAEKAKSIL 117


>gi|59711825|ref|YP_204601.1| 50S ribosomal protein L20 [Vibrio fischeri ES114]
 gi|197334380|ref|YP_002156019.1| ribosomal protein L20 [Vibrio fischeri MJ11]
 gi|81310956|sp|Q5E5I3|RL20_VIBF1 RecName: Full=50S ribosomal protein L20
 gi|226730472|sp|B5FDV4|RL20_VIBFM RecName: Full=50S ribosomal protein L20
 gi|59479926|gb|AAW85713.1| 50S ribosomal subunit protein L20 [Vibrio fischeri ES114]
 gi|197315870|gb|ACH65317.1| ribosomal protein L20 [Vibrio fischeri MJ11]
          Length = 117

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R  +++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAAARQNEMSYSRFINGLKKASIEIDRKILADIAVFDKVAFAALVEKAKAAL 117


>gi|291614195|ref|YP_003524352.1| ribosomal protein L20 [Sideroxydans lithotrophicus ES-1]
 gi|291584307|gb|ADE11965.1| ribosomal protein L20 [Sideroxydans lithotrophicus ES-1]
          Length = 119

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRR +  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLNLAKGYRGRRNSVYRIAKEAVMKAGQYAYRDRRQRKRQFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   + YS F+NGL KA I +DRKVL+DLA+    +F +IV  +++ L  
Sbjct: 61  WIARINAAAREQGMAYSVFMNGLKKAAIEIDRKVLADLAVFDKAAFSQIVAQAKASLGA 119


>gi|239978527|ref|ZP_04701051.1| 50S ribosomal protein L20 [Streptomyces albus J1074]
 gi|291450423|ref|ZP_06589813.1| 50S ribosomal protein L20 [Streptomyces albus J1074]
 gi|291353372|gb|EFE80274.1| 50S ribosomal protein L20 [Streptomyces albus J1074]
          Length = 128

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 75/123 (60%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A I +DRK+L+DLA+    +F  +VE ++  L  D
Sbjct: 61  WIQRINAAARANGVTYNRFIQGLKAANIEVDRKILADLAVNDAPAFAALVEAAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|289550565|ref|YP_003471469.1| LSU ribosomal protein L20p [Staphylococcus lugdunensis HKU09-01]
 gi|315658059|ref|ZP_07910932.1| 50S ribosomal protein L20 [Staphylococcus lugdunensis M23590]
 gi|289180097|gb|ADC87342.1| LSU ribosomal protein L20p [Staphylococcus lugdunensis HKU09-01]
 gi|315496949|gb|EFU85271.1| 50S ribosomal protein L20 [Staphylococcus lugdunensis M23590]
          Length = 118

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDMSYSRLMNGLKKADIDINRKMLSEIAISDEKAFGELVSKAKEAL 117


>gi|223044107|ref|ZP_03614146.1| ribosomal protein L20 [Staphylococcus capitis SK14]
 gi|314933833|ref|ZP_07841198.1| ribosomal protein L20 [Staphylococcus caprae C87]
 gi|222442501|gb|EEE48607.1| ribosomal protein L20 [Staphylococcus capitis SK14]
 gi|313653983|gb|EFS17740.1| ribosomal protein L20 [Staphylococcus caprae C87]
          Length = 118

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDISYSRLMNGLKKAEIDINRKMLSEIAISDDKAFGELVTKAKEAL 117


>gi|326795749|ref|YP_004313569.1| 50S ribosomal protein L20 [Marinomonas mediterranea MMB-1]
 gi|326546513|gb|ADZ91733.1| 50S ribosomal protein L20 [Marinomonas mediterranea MMB-1]
          Length = 118

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVQARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+FI GL KA I +DRKVL+DLA+ + + F  IVE +++ L 
Sbjct: 61  WIARINAAARINGLSYSRFIAGLKKASIEIDRKVLADLAVYEKEVFAAIVEKAKASLA 118


>gi|313890634|ref|ZP_07824262.1| ribosomal protein L20 [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121151|gb|EFR44262.1| ribosomal protein L20 [Streptococcus pseudoporcinus SPIN 20026]
          Length = 119

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+T    F  + + ++ +L
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVTDAAGFTALADAAKDKL 117


>gi|317403227|gb|EFV83746.1| 50S ribosomal protein L20 [Achromobacter xylosoxidans C54]
          Length = 119

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 86/119 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVISAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR + ++YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L  
Sbjct: 61  WITRINAAVREHGVSYSVFIAGLKKAAIELDRKVLADLAVRDKAGFAAIVQQAKAALAA 119


>gi|119897373|ref|YP_932586.1| 50S ribosomal protein L20 [Azoarcus sp. BH72]
 gi|166219605|sp|A1K4E4|RL20_AZOSB RecName: Full=50S ribosomal protein L20
 gi|119669786|emb|CAL93699.1| 50S ribosomal protein L20 [Azoarcus sp. BH72]
          Length = 119

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLDQAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YS F+NGL KA + +DRKVL+DLA+    +F  + E +R++L  
Sbjct: 61  WIARINAAARELGLTYSTFMNGLKKAAVEVDRKVLADLAVFDKPAFAALAEQARAKLAA 119


>gi|30022648|ref|NP_834279.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 14579]
 gi|30264643|ref|NP_847020.1| 50S ribosomal protein L20 [Bacillus anthracis str. Ames]
 gi|42783750|ref|NP_980997.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 10987]
 gi|47530114|ref|YP_021463.1| 50S ribosomal protein L20 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49187464|ref|YP_030716.1| 50S ribosomal protein L20 [Bacillus anthracis str. Sterne]
 gi|49481332|ref|YP_038619.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52140932|ref|YP_085894.1| 50S ribosomal protein L20 [Bacillus cereus E33L]
 gi|65321941|ref|ZP_00394900.1| COG0292: Ribosomal protein L20 [Bacillus anthracis str. A2012]
 gi|118479721|ref|YP_896872.1| 50S ribosomal protein L20 [Bacillus thuringiensis str. Al Hakam]
 gi|165871477|ref|ZP_02216124.1| ribosomal protein L20 [Bacillus anthracis str. A0488]
 gi|167641572|ref|ZP_02399819.1| ribosomal protein L20 [Bacillus anthracis str. A0193]
 gi|170708680|ref|ZP_02899118.1| ribosomal protein L20 [Bacillus anthracis str. A0389]
 gi|177653145|ref|ZP_02935432.1| ribosomal protein L20 [Bacillus anthracis str. A0174]
 gi|190569443|ref|ZP_03022323.1| ribosomal protein L20 [Bacillus anthracis Tsiankovskii-I]
 gi|196034550|ref|ZP_03101959.1| ribosomal protein L20 [Bacillus cereus W]
 gi|196047727|ref|ZP_03114929.1| ribosomal protein L20 [Bacillus cereus 03BB108]
 gi|206969475|ref|ZP_03230429.1| 50S ribosomal protein L20 [Bacillus cereus AH1134]
 gi|217962052|ref|YP_002340622.1| 50S ribosomal protein L20 [Bacillus cereus AH187]
 gi|218234716|ref|YP_002369368.1| 50S ribosomal protein L20 [Bacillus cereus B4264]
 gi|218899726|ref|YP_002448137.1| ribosomal protein L20 [Bacillus cereus G9842]
 gi|218905800|ref|YP_002453634.1| ribosomal protein L20 [Bacillus cereus AH820]
 gi|222098035|ref|YP_002532092.1| 50S ribosomal protein l20 [Bacillus cereus Q1]
 gi|225866550|ref|YP_002751928.1| 50S ribosomal protein L20 [Bacillus cereus 03BB102]
 gi|227817357|ref|YP_002817366.1| 50S ribosomal protein L20 [Bacillus anthracis str. CDC 684]
 gi|228903090|ref|ZP_04067226.1| 50S ribosomal protein L20 [Bacillus thuringiensis IBL 4222]
 gi|228910396|ref|ZP_04074211.1| 50S ribosomal protein L20 [Bacillus thuringiensis IBL 200]
 gi|228917212|ref|ZP_04080769.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228923316|ref|ZP_04086604.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228929620|ref|ZP_04092638.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935880|ref|ZP_04098690.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228941751|ref|ZP_04104298.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228948298|ref|ZP_04110581.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228954841|ref|ZP_04116861.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228960841|ref|ZP_04122476.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228967669|ref|ZP_04128690.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228974675|ref|ZP_04135241.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228981269|ref|ZP_04141569.1| 50S ribosomal protein L20 [Bacillus thuringiensis Bt407]
 gi|228987820|ref|ZP_04147929.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229019797|ref|ZP_04176600.1| 50S ribosomal protein L20 [Bacillus cereus AH1273]
 gi|229027590|ref|ZP_04183808.1| 50S ribosomal protein L20 [Bacillus cereus AH1272]
 gi|229048280|ref|ZP_04193848.1| 50S ribosomal protein L20 [Bacillus cereus AH676]
 gi|229072074|ref|ZP_04205283.1| 50S ribosomal protein L20 [Bacillus cereus F65185]
 gi|229076075|ref|ZP_04209043.1| 50S ribosomal protein L20 [Bacillus cereus Rock4-18]
 gi|229081825|ref|ZP_04214317.1| 50S ribosomal protein L20 [Bacillus cereus Rock4-2]
 gi|229093670|ref|ZP_04224770.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-42]
 gi|229099034|ref|ZP_04229968.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-29]
 gi|229105200|ref|ZP_04235849.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-28]
 gi|229112037|ref|ZP_04241580.1| 50S ribosomal protein L20 [Bacillus cereus Rock1-15]
 gi|229118064|ref|ZP_04247423.1| 50S ribosomal protein L20 [Bacillus cereus Rock1-3]
 gi|229124139|ref|ZP_04253331.1| 50S ribosomal protein L20 [Bacillus cereus 95/8201]
 gi|229129856|ref|ZP_04258822.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-Cer4]
 gi|229141298|ref|ZP_04269836.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST26]
 gi|229147131|ref|ZP_04275490.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST24]
 gi|229152767|ref|ZP_04280950.1| 50S ribosomal protein L20 [Bacillus cereus m1550]
 gi|229158176|ref|ZP_04286243.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 4342]
 gi|229163564|ref|ZP_04291514.1| 50S ribosomal protein L20 [Bacillus cereus R309803]
 gi|229186829|ref|ZP_04313984.1| 50S ribosomal protein L20 [Bacillus cereus BGSC 6E1]
 gi|229192773|ref|ZP_04319731.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 10876]
 gi|229198721|ref|ZP_04325419.1| 50S ribosomal protein L20 [Bacillus cereus m1293]
 gi|229602516|ref|YP_002868852.1| 50S ribosomal protein L20 [Bacillus anthracis str. A0248]
 gi|254686934|ref|ZP_05150792.1| 50S ribosomal protein L20 [Bacillus anthracis str. CNEVA-9066]
 gi|254724498|ref|ZP_05186281.1| 50S ribosomal protein L20 [Bacillus anthracis str. A1055]
 gi|254736681|ref|ZP_05194387.1| 50S ribosomal protein L20 [Bacillus anthracis str. Western North
           America USA6153]
 gi|254741719|ref|ZP_05199406.1| 50S ribosomal protein L20 [Bacillus anthracis str. Kruger B]
 gi|254754684|ref|ZP_05206719.1| 50S ribosomal protein L20 [Bacillus anthracis str. Vollum]
 gi|254757516|ref|ZP_05209543.1| 50S ribosomal protein L20 [Bacillus anthracis str. Australia 94]
 gi|296505046|ref|YP_003666746.1| 50S ribosomal protein L20 [Bacillus thuringiensis BMB171]
 gi|301056079|ref|YP_003794290.1| 50S ribosomal protein L20 [Bacillus anthracis CI]
 gi|39931863|sp|Q817H7|RL20_BACCR RecName: Full=50S ribosomal protein L20
 gi|39931870|sp|Q81L17|RL20_BACAN RecName: Full=50S ribosomal protein L20
 gi|60390325|sp|Q633M3|RL20_BACCZ RecName: Full=50S ribosomal protein L20
 gi|60390444|sp|Q6HCV7|RL20_BACHK RecName: Full=50S ribosomal protein L20
 gi|60390502|sp|Q72ZG4|RL20_BACC1 RecName: Full=50S ribosomal protein L20
 gi|166219607|sp|A0RJH2|RL20_BACAH RecName: Full=50S ribosomal protein L20
 gi|226730352|sp|B7JR80|RL20_BACC0 RecName: Full=50S ribosomal protein L20
 gi|226730353|sp|B7IJX1|RL20_BACC2 RecName: Full=50S ribosomal protein L20
 gi|226730354|sp|B7HF86|RL20_BACC4 RecName: Full=50S ribosomal protein L20
 gi|226730355|sp|B7HRL2|RL20_BACC7 RecName: Full=50S ribosomal protein L20
 gi|254800296|sp|C3PAG2|RL20_BACAA RecName: Full=50S ribosomal protein L20
 gi|254800297|sp|C3L8V1|RL20_BACAC RecName: Full=50S ribosomal protein L20
 gi|254800298|sp|C1EUR7|RL20_BACC3 RecName: Full=50S ribosomal protein L20
 gi|254800299|sp|B9J073|RL20_BACCQ RecName: Full=50S ribosomal protein L20
 gi|29898206|gb|AAP11480.1| LSU ribosomal protein L20P [Bacillus cereus ATCC 14579]
 gi|30259318|gb|AAP28506.1| 50S ribosomal protein L20 [Bacillus anthracis str. Ames]
 gi|42739680|gb|AAS43605.1| ribosomal protein L20 [Bacillus cereus ATCC 10987]
 gi|47505262|gb|AAT33938.1| ribosomal protein L20 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49181391|gb|AAT56767.1| ribosomal protein L20 [Bacillus anthracis str. Sterne]
 gi|49332888|gb|AAT63534.1| ribosomal protein L20 (50S ribosomal protein L20) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51974401|gb|AAU15951.1| ribosomal protein L20 (50S ribosomal protein L20) [Bacillus cereus
           E33L]
 gi|118418946|gb|ABK87365.1| LSU ribosomal protein L20P [Bacillus thuringiensis str. Al Hakam]
 gi|164712774|gb|EDR18304.1| ribosomal protein L20 [Bacillus anthracis str. A0488]
 gi|167510457|gb|EDR85856.1| ribosomal protein L20 [Bacillus anthracis str. A0193]
 gi|170126360|gb|EDS95249.1| ribosomal protein L20 [Bacillus anthracis str. A0389]
 gi|172081669|gb|EDT66740.1| ribosomal protein L20 [Bacillus anthracis str. A0174]
 gi|190559448|gb|EDV13453.1| ribosomal protein L20 [Bacillus anthracis Tsiankovskii-I]
 gi|195993092|gb|EDX57051.1| ribosomal protein L20 [Bacillus cereus W]
 gi|196021448|gb|EDX60153.1| ribosomal protein L20 [Bacillus cereus 03BB108]
 gi|206735163|gb|EDZ52331.1| 50S ribosomal protein L20 [Bacillus cereus AH1134]
 gi|217064563|gb|ACJ78813.1| ribosomal protein L20 [Bacillus cereus AH187]
 gi|218162673|gb|ACK62665.1| ribosomal protein L20 [Bacillus cereus B4264]
 gi|218535940|gb|ACK88338.1| ribosomal protein L20 [Bacillus cereus AH820]
 gi|218544691|gb|ACK97085.1| ribosomal protein L20 [Bacillus cereus G9842]
 gi|221242093|gb|ACM14803.1| ribosomal protein L20 (50S ribosomal protein L20) [Bacillus cereus
           Q1]
 gi|225790737|gb|ACO30954.1| 50S ribosomal protein L20 [Bacillus cereus 03BB102]
 gi|227007913|gb|ACP17656.1| 50S ribosomal protein L20 [Bacillus anthracis str. CDC 684]
 gi|228584743|gb|EEK42863.1| 50S ribosomal protein L20 [Bacillus cereus m1293]
 gi|228590612|gb|EEK48473.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 10876]
 gi|228596566|gb|EEK54231.1| 50S ribosomal protein L20 [Bacillus cereus BGSC 6E1]
 gi|228619946|gb|EEK76822.1| 50S ribosomal protein L20 [Bacillus cereus R309803]
 gi|228625134|gb|EEK81894.1| 50S ribosomal protein L20 [Bacillus cereus ATCC 4342]
 gi|228630587|gb|EEK87233.1| 50S ribosomal protein L20 [Bacillus cereus m1550]
 gi|228636380|gb|EEK92851.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST24]
 gi|228642079|gb|EEK98372.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-ST26]
 gi|228653547|gb|EEL09419.1| 50S ribosomal protein L20 [Bacillus cereus BDRD-Cer4]
 gi|228659441|gb|EEL15089.1| 50S ribosomal protein L20 [Bacillus cereus 95/8201]
 gi|228665287|gb|EEL20770.1| 50S ribosomal protein L20 [Bacillus cereus Rock1-3]
 gi|228671360|gb|EEL26661.1| 50S ribosomal protein L20 [Bacillus cereus Rock1-15]
 gi|228678126|gb|EEL32354.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-28]
 gi|228684262|gb|EEL38206.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-29]
 gi|228689757|gb|EEL43564.1| 50S ribosomal protein L20 [Bacillus cereus Rock3-42]
 gi|228701413|gb|EEL53907.1| 50S ribosomal protein L20 [Bacillus cereus Rock4-2]
 gi|228706938|gb|EEL59143.1| 50S ribosomal protein L20 [Bacillus cereus Rock4-18]
 gi|228711008|gb|EEL62974.1| 50S ribosomal protein L20 [Bacillus cereus F65185]
 gi|228723005|gb|EEL74382.1| 50S ribosomal protein L20 [Bacillus cereus AH676]
 gi|228733709|gb|EEL84485.1| 50S ribosomal protein L20 [Bacillus cereus AH1272]
 gi|228741522|gb|EEL91719.1| 50S ribosomal protein L20 [Bacillus cereus AH1273]
 gi|228771868|gb|EEM20325.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228778469|gb|EEM26736.1| 50S ribosomal protein L20 [Bacillus thuringiensis Bt407]
 gi|228785078|gb|EEM33091.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228792045|gb|EEM39626.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228798863|gb|EEM45842.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228804830|gb|EEM51429.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228811285|gb|EEM57623.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228817963|gb|EEM64041.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228823648|gb|EEM69470.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830007|gb|EEM75626.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228836270|gb|EEM81623.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228842413|gb|EEM87504.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228849162|gb|EEM94001.1| 50S ribosomal protein L20 [Bacillus thuringiensis IBL 200]
 gi|228856499|gb|EEN01023.1| 50S ribosomal protein L20 [Bacillus thuringiensis IBL 4222]
 gi|229266924|gb|ACQ48561.1| 50S ribosomal protein L20 [Bacillus anthracis str. A0248]
 gi|296326098|gb|ADH09026.1| 50S ribosomal protein L20 [Bacillus thuringiensis BMB171]
 gi|300378248|gb|ADK07152.1| 50S ribosomal protein L20 [Bacillus cereus biovar anthracis str.
           CI]
 gi|324328466|gb|ADY23726.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar finitimus
           YBT-020]
 gi|326942356|gb|AEA18252.1| 50S ribosomal protein L20 [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 118

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKNTLFKVANQQVMKSLMYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  ++++ +
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKNAGIEVNRKMLADLAVHDEKAFAELATVAKNNI 117


>gi|121601857|ref|YP_989562.1| 50S ribosomal protein L20 [Bartonella bacilliformis KC583]
 gi|166219609|sp|A1UUA9|RL20_BARBK RecName: Full=50S ribosomal protein L20
 gi|120614034|gb|ABM44635.1| ribosomal protein L20 [Bartonella bacilliformis KC583]
          Length = 133

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 79/118 (66%), Positives = 95/118 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKK+LK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKILKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR+  L Y +FI+GL KAGI +DRKVLSD+AI +   F  +V  ++  L 
Sbjct: 61  WIQRINAAVRMEGLTYGRFIDGLSKAGIEIDRKVLSDIAIHEPTVFSALVASAKKALE 118


>gi|28869578|ref|NP_792197.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|66045405|ref|YP_235246.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. syringae B728a]
 gi|71735586|ref|YP_274357.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|77458161|ref|YP_347666.1| 50S ribosomal protein L20 [Pseudomonas fluorescens Pf0-1]
 gi|213970492|ref|ZP_03398619.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato T1]
 gi|237801012|ref|ZP_04589473.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|257486169|ref|ZP_05640210.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289623633|ref|ZP_06456587.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647149|ref|ZP_06478492.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|289673301|ref|ZP_06494191.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. syringae FF5]
 gi|298486704|ref|ZP_07004761.1| LSU ribosomal protein L20p [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|301384177|ref|ZP_07232595.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato Max13]
 gi|302062683|ref|ZP_07254224.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato K40]
 gi|302132640|ref|ZP_07258630.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|302187616|ref|ZP_07264289.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. syringae 642]
 gi|330810590|ref|YP_004355052.1| 50S ribosomal protein L20 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|60393651|sp|P0A159|RL20_PSESM RecName: Full=50S ribosomal protein L20
 gi|60393652|sp|P0A160|RL20_PSESY RecName: Full=50S ribosomal protein L20
 gi|81308306|sp|Q4ZUG4|RL20_PSEU2 RecName: Full=50S ribosomal protein L20
 gi|109893135|sp|Q48JS0|RL20_PSE14 RecName: Full=50S ribosomal protein L20
 gi|109893138|sp|Q3KEX9|RL20_PSEPF RecName: Full=50S ribosomal protein L20
 gi|1171434|gb|AAB05016.1| ribosomal protein L20 [Pseudomonas syringae pv. syringae]
 gi|28852820|gb|AAO55892.1| ribosomal protein L20 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|63256112|gb|AAY37208.1| Ribosomal protein L20, bacterial and organelle form [Pseudomonas
           syringae pv. syringae B728a]
 gi|71556139|gb|AAZ35350.1| ribosomal protein L20 [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|77382164|gb|ABA73677.1| 50S ribosomal protein L20 [Pseudomonas fluorescens Pf0-1]
 gi|213924663|gb|EEB58231.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tomato T1]
 gi|298158787|gb|EFH99850.1| LSU ribosomal protein L20p [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320324305|gb|EFW80384.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320328573|gb|EFW84575.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|327378698|gb|AEA70048.1| 50S ribosomal protein L20 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|330867698|gb|EGH02407.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330876792|gb|EGH10941.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330888319|gb|EGH20980.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. mori str.
           301020]
 gi|330898076|gb|EGH29495.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330943374|gb|EGH45743.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330951869|gb|EGH52129.1| 50S ribosomal protein L20 [Pseudomonas syringae Cit 7]
 gi|330967295|gb|EGH67555.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|330973948|gb|EGH74014.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330989238|gb|EGH87341.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331010499|gb|EGH90555.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331016136|gb|EGH96192.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
 gi|331023869|gb|EGI03926.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 118

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  RV  L+YS+FI GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARVNGLSYSRFIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKATLA 118


>gi|253998432|ref|YP_003050495.1| 50S ribosomal protein L20 [Methylovorus sp. SIP3-4]
 gi|313200507|ref|YP_004039165.1| 50S ribosomal protein L20 [Methylovorus sp. MP688]
 gi|253985111|gb|ACT49968.1| ribosomal protein L20 [Methylovorus sp. SIP3-4]
 gi|312439823|gb|ADQ83929.1| ribosomal protein L20 [Methylovorus sp. MP688]
          Length = 120

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 71/119 (59%), Positives = 88/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVL +AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVIARARHKKVLDAAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R Y L YS+FINGL K+ I +DRKVL+DLA+    +F K  EL++S L  
Sbjct: 61  WIARINAGAREYGLTYSRFINGLKKSAIEVDRKVLADLAVFDKVAFAKFAELAKSGLAA 119


>gi|262091754|gb|ACY25343.1| LSU ribosomal protein L20P [uncultured actinobacterium]
          Length = 118

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  KHK +L+ AKG+YG R  T R+A   V  S QYA+RDRR +K +FRSL
Sbjct: 1   MARVKRAVHARKKHKAILEKAKGYYGDRSRTFRSANEQVLHSGQYAFRDRRAEKGEFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINA  R  D +YS+ I+GL+KAG+ +DRK+++DLA+    +F K+VE ++  L+
Sbjct: 61  WIQRINAGCRQNDFSYSRLIDGLNKAGVTVDRKIMADLAVHDPAAFTKLVETAKGALV 118


>gi|94499188|ref|ZP_01305726.1| Ribosomal protein L20 [Oceanobacter sp. RED65]
 gi|94428820|gb|EAT13792.1| Ribosomal protein L20 [Oceanobacter sp. RED65]
          Length = 117

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKKVLK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKVLKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R+  L+YS+FINGL  A I +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARINGLSYSRFINGLKNASIEIDRKVLADLAVNEKAAFAALVEKAKASL 117


>gi|148251833|ref|YP_001236418.1| 50S ribosomal protein L20 [Bradyrhizobium sp. BTAi1]
 gi|166219612|sp|A5E8L8|RL20_BRASB RecName: Full=50S ribosomal protein L20
 gi|146404006|gb|ABQ32512.1| LSU ribosomal protein L20P [Bradyrhizobium sp. BTAi1]
          Length = 119

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 76/119 (63%), Positives = 99/119 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKHKKV K+AKG+YGRRKNTIR AK AV+++ QYA+RDR+ KKR FR+L
Sbjct: 1   MSRVKRGVTAHAKHKKVFKAAKGYYGRRKNTIRTAKQAVEKAGQYAFRDRKRKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQR+NAAVR ++L YS+FI+GL K+GI +DRKVLSDLAI +  +F+ IVE +++ L  
Sbjct: 61  WIQRLNAAVRPFELTYSRFIDGLSKSGITVDRKVLSDLAINEPAAFQAIVEKAKAALAA 119


>gi|329116076|ref|ZP_08244793.1| ribosomal protein L20 [Streptococcus parauberis NCFD 2020]
 gi|326906481|gb|EGE53395.1| ribosomal protein L20 [Streptococcus parauberis NCFD 2020]
          Length = 119

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV+  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVARKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+     F  + + ++++L
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVHDAAGFTALADAAKNKL 117


>gi|5825616|gb|AAD53322.1|AF179591_4 ribosomal protein L20 [Vibrio cholerae]
 gi|3095164|gb|AAC38423.1| ribosomal protein L20 [Vibrio cholerae]
          Length = 117

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARPRVYRVAFQAVIKAGQYAYRDRRAKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKGAL 117


>gi|226330395|ref|ZP_03805913.1| hypothetical protein PROPEN_04313 [Proteus penneri ATCC 35198]
 gi|225201190|gb|EEG83544.1| hypothetical protein PROPEN_04313 [Proteus penneri ATCC 35198]
          Length = 118

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R KRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARAKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASIEIDRKILADIAVFDKVAFAALVEKAKGALA 118


>gi|323356731|ref|YP_004223127.1| ribosomal protein L20 [Microbacterium testaceum StLB037]
 gi|323273102|dbj|BAJ73247.1| ribosomal protein L20 [Microbacterium testaceum StLB037]
          Length = 127

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVILERASGYRGQRSRLYRKAKEQVTHSLVYAYRDRRKRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +   F  +V+ +++ L  D
Sbjct: 61  WIQRINAASRQNGLTYNRFIQGLGLAGVQVDRRMLAELAVNEPAVFASLVQTAKAALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|224542063|ref|ZP_03682602.1| hypothetical protein CATMIT_01237 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524996|gb|EEF94101.1| hypothetical protein CATMIT_01237 [Catenibacterium mitsuokai DSM
           15897]
          Length = 119

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KK LK AKG++G +    + A   V  S +YAYRDRR  KR+ R L
Sbjct: 1   MARVKGGFTTRRRRKKTLKLAKGYFGSKHALYKTAHEQVMHSLKYAYRDRRQLKREMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ D++YS F++GL  A + ++RK+LS++AI   + FK + +L++ +L 
Sbjct: 61  WIARINAACRMNDMSYSTFMHGLKLAEVNVNRKMLSEIAIADPEGFKALTDLAKEQLA 118


>gi|326382699|ref|ZP_08204390.1| 50S ribosomal protein L20 [Gordonia neofelifaecis NRRL B-59395]
 gi|326198818|gb|EGD56001.1| 50S ribosomal protein L20 [Gordonia neofelifaecis NRRL B-59395]
          Length = 126

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 83/123 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+++KG+ G+R    R AK     S  YAYRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA RV D+ Y++FI GL  AG+ +DRKVL+D+A+T   +F  +VE++R+ L  D
Sbjct: 61  WITRINAAARVNDITYNRFIQGLKLAGVEVDRKVLADIAVTDPAAFTGLVEVARAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|332686212|ref|YP_004455986.1| 50S ribosomal protein L20p [Melissococcus plutonius ATCC 35311]
 gi|332370221|dbj|BAK21177.1| LSU ribosomal protein L20p [Melissococcus plutonius ATCC 35311]
          Length = 119

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G VS  + KK+LK AKG+YG +    ++AK  V  S  YA+RDRR KKRDFR L
Sbjct: 1   MARVKGGTVSRKRRKKILKLAKGYYGSKHTLFKSAKEQVMNSYYYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + ++  L 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDATAFTVLADQAKEALS 118


>gi|227494666|ref|ZP_03924982.1| 50S ribosomal protein L20 [Actinomyces coleocanis DSM 15436]
 gi|226831848|gb|EEH64231.1| 50S ribosomal protein L20 [Actinomyces coleocanis DSM 15436]
          Length = 126

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y+YRDRRV+KR+ R L
Sbjct: 1   MARVKRAVNAQKKRRVVLERASGYRGQRSRLYRKAKEQVTHSMVYSYRDRRVRKREMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAAVR   + Y++FI GL  AGI +DR++LS+LAI+   +F  +VE +R  L  D
Sbjct: 61  WITRINAAVRENGMTYNRFIQGLALAGIEVDRRMLSELAISDPAAFTALVEAARKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|220931405|ref|YP_002508313.1| ribosomal protein L20 [Halothermothrix orenii H 168]
 gi|219992715|gb|ACL69318.1| ribosomal protein L20 [Halothermothrix orenii H 168]
          Length = 119

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  + KK+LK AKG++G R    R A  AV +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKRGYKARRRRKKILKMAKGYFGGRSKLFRPANQAVMKSLHYAYRDRRARKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FI+GL KA I ++RK+L+D+AI   +SF ++  +++  L
Sbjct: 61  WITRINAAARQEGISYSKFIHGLKKADIQINRKMLADMAIKDKESFSELAAIAKKEL 117


>gi|297155952|gb|ADI05664.1| 50S ribosomal protein L20 [Streptomyces bingchenggensis BCW-1]
          Length = 127

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 76/123 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A I +DRK+L+DLA+   ++F  +VE ++  L  D
Sbjct: 61  WIQRINAAARANGITYNRFIQGLKAANIEVDRKILADLAVNDANAFAALVEAAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|239932316|ref|ZP_04689269.1| 50S ribosomal protein L20 [Streptomyces ghanaensis ATCC 14672]
 gi|291440680|ref|ZP_06580070.1| 50S ribosomal protein L20 [Streptomyces ghanaensis ATCC 14672]
 gi|302561590|ref|ZP_07313932.1| 50S ribosomal protein L20 [Streptomyces griseoflavus Tu4000]
 gi|291343575|gb|EFE70531.1| 50S ribosomal protein L20 [Streptomyces ghanaensis ATCC 14672]
 gi|302479208|gb|EFL42301.1| 50S ribosomal protein L20 [Streptomyces griseoflavus Tu4000]
          Length = 127

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 76/123 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A + +DRK+L++LA+    +F  +VE+++  L  D
Sbjct: 61  WIQRINAAARANGITYNRFIQGLKAANVEVDRKILAELAVNDATAFAALVEVAQKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|187929054|ref|YP_001899541.1| 50S ribosomal protein L20 [Ralstonia pickettii 12J]
 gi|309782530|ref|ZP_07677253.1| ribosomal protein L20 [Ralstonia sp. 5_7_47FAA]
 gi|226730440|sp|B2UGJ5|RL20_RALPJ RecName: Full=50S ribosomal protein L20
 gi|187725944|gb|ACD27109.1| ribosomal protein L20 [Ralstonia pickettii 12J]
 gi|308918621|gb|EFP64295.1| ribosomal protein L20 [Ralstonia sp. 5_7_47FAA]
          Length = 118

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKGF GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVISAAKGFRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R + L YS+F+NGL KA I LDRKVLSD+AI    +F  IV   ++ + 
Sbjct: 61  WIARINAGAREHGLTYSKFMNGLKKASIELDRKVLSDMAIHDKVAFAAIVNQVKANVA 118


>gi|23465929|ref|NP_696532.1| 50S ribosomal protein L20 [Bifidobacterium longum NCC2705]
 gi|213691796|ref|YP_002322382.1| ribosomal protein L20 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|296454371|ref|YP_003661514.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|31563169|sp|Q8G4L1|RL20_BIFLO RecName: Full=50S ribosomal protein L20
 gi|254800301|sp|B7GQC4|RL20_BIFLI RecName: Full=50S ribosomal protein L20
 gi|23326638|gb|AAN25168.1| 50S ribosomal protein L20 [Bifidobacterium longum NCC2705]
 gi|213523257|gb|ACJ52004.1| ribosomal protein L20 [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|296183802|gb|ADH00684.1| ribosomal protein L20 [Bifidobacterium longum subsp. longum JDM301]
 gi|320457890|dbj|BAJ68511.1| 50S ribosomal protein L20 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 127

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L+++A++  ++FK IV+ +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAEIAVSDPNTFKTIVDAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|69248642|ref|ZP_00604787.1| Ribosomal protein L20, bacterial and organelle form [Enterococcus
           faecium DO]
 gi|257878891|ref|ZP_05658544.1| ribosomal protein L20 [Enterococcus faecium 1,230,933]
 gi|257881527|ref|ZP_05661180.1| ribosomal protein L20 [Enterococcus faecium 1,231,502]
 gi|257890749|ref|ZP_05670402.1| ribosomal protein L20 [Enterococcus faecium 1,231,410]
 gi|258615037|ref|ZP_05712807.1| 50S ribosomal protein L20 [Enterococcus faecium DO]
 gi|260558450|ref|ZP_05830646.1| ribosomal protein L20 [Enterococcus faecium C68]
 gi|261207172|ref|ZP_05921861.1| ribosomal protein L20 [Enterococcus faecium TC 6]
 gi|289565293|ref|ZP_06445744.1| 50S ribosomal protein L20 [Enterococcus faecium D344SRF]
 gi|293560313|ref|ZP_06676810.1| ribosomal protein L20 [Enterococcus faecium E1162]
 gi|293567754|ref|ZP_06679095.1| ribosomal protein L20 [Enterococcus faecium E1071]
 gi|294615066|ref|ZP_06694952.1| ribosomal protein L20 [Enterococcus faecium E1636]
 gi|294617096|ref|ZP_06696763.1| ribosomal protein L20 [Enterococcus faecium E1679]
 gi|294620926|ref|ZP_06700127.1| ribosomal protein L20 [Enterococcus faecium U0317]
 gi|314938985|ref|ZP_07846250.1| ribosomal protein L20 [Enterococcus faecium TX0133a04]
 gi|314943464|ref|ZP_07850231.1| ribosomal protein L20 [Enterococcus faecium TX0133C]
 gi|314948243|ref|ZP_07851637.1| ribosomal protein L20 [Enterococcus faecium TX0082]
 gi|314951603|ref|ZP_07854649.1| ribosomal protein L20 [Enterococcus faecium TX0133A]
 gi|314991534|ref|ZP_07857010.1| ribosomal protein L20 [Enterococcus faecium TX0133B]
 gi|314994867|ref|ZP_07859994.1| ribosomal protein L20 [Enterococcus faecium TX0133a01]
 gi|68194367|gb|EAN08876.1| Ribosomal protein L20, bacterial and organelle form [Enterococcus
           faecium DO]
 gi|257813119|gb|EEV41877.1| ribosomal protein L20 [Enterococcus faecium 1,230,933]
 gi|257817185|gb|EEV44513.1| ribosomal protein L20 [Enterococcus faecium 1,231,502]
 gi|257827109|gb|EEV53735.1| ribosomal protein L20 [Enterococcus faecium 1,231,410]
 gi|260075624|gb|EEW63930.1| ribosomal protein L20 [Enterococcus faecium C68]
 gi|260078800|gb|EEW66502.1| ribosomal protein L20 [Enterococcus faecium TC 6]
 gi|289162949|gb|EFD10798.1| 50S ribosomal protein L20 [Enterococcus faecium D344SRF]
 gi|291589339|gb|EFF21146.1| ribosomal protein L20 [Enterococcus faecium E1071]
 gi|291592008|gb|EFF23631.1| ribosomal protein L20 [Enterococcus faecium E1636]
 gi|291596654|gb|EFF27880.1| ribosomal protein L20 [Enterococcus faecium E1679]
 gi|291599537|gb|EFF30553.1| ribosomal protein L20 [Enterococcus faecium U0317]
 gi|291605763|gb|EFF35200.1| ribosomal protein L20 [Enterococcus faecium E1162]
 gi|313590849|gb|EFR69694.1| ribosomal protein L20 [Enterococcus faecium TX0133a01]
 gi|313593818|gb|EFR72663.1| ribosomal protein L20 [Enterococcus faecium TX0133B]
 gi|313596297|gb|EFR75142.1| ribosomal protein L20 [Enterococcus faecium TX0133A]
 gi|313597836|gb|EFR76681.1| ribosomal protein L20 [Enterococcus faecium TX0133C]
 gi|313641694|gb|EFS06274.1| ribosomal protein L20 [Enterococcus faecium TX0133a04]
 gi|313645376|gb|EFS09956.1| ribosomal protein L20 [Enterococcus faecium TX0082]
          Length = 119

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+VLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKRVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + ++  L 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKVAEIDINRKMLADLAVNDAAAFTALADQAKEALA 118


>gi|17546299|ref|NP_519701.1| 50S ribosomal protein L20 [Ralstonia solanacearum GMI1000]
 gi|83748300|ref|ZP_00945325.1| LSU ribosomal protein L20P [Ralstonia solanacearum UW551]
 gi|207724054|ref|YP_002254452.1| 550s ribosomal protein l20 [Ralstonia solanacearum MolK2]
 gi|207742949|ref|YP_002259341.1| 550s ribosomal protein l20 [Ralstonia solanacearum IPO1609]
 gi|300691318|ref|YP_003752313.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Ralstonia solanacearum PSI07]
 gi|300703881|ref|YP_003745483.1| 50S ribosomal protein L20 [Ralstonia solanacearum CFBP2957]
 gi|20978579|sp|Q8XZ26|RL20_RALSO RecName: Full=50S ribosomal protein L20
 gi|17428596|emb|CAD15282.1| probable 550s ribosomal protein l20 [Ralstonia solanacearum
           GMI1000]
 gi|83725032|gb|EAP72185.1| LSU ribosomal protein L20P [Ralstonia solanacearum UW551]
 gi|206589263|emb|CAQ36225.1| 550s ribosomal protein l20 [Ralstonia solanacearum MolK2]
 gi|206594344|emb|CAQ61271.1| 550s ribosomal protein l20 [Ralstonia solanacearum IPO1609]
 gi|299066589|emb|CBJ37779.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Ralstonia solanacearum CMR15]
 gi|299071544|emb|CBJ42868.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Ralstonia solanacearum CFBP2957]
 gi|299078378|emb|CBJ51028.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Ralstonia solanacearum PSI07]
          Length = 118

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIDAAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R + L+YS+F+NGL KA I LDRKVLSD+AI    +F  IV   ++ + 
Sbjct: 61  WIARINAGAREHGLSYSKFMNGLKKASIELDRKVLSDMAIHDKVAFAAIVNQVKANVA 118


>gi|294628443|ref|ZP_06707003.1| 50S ribosomal protein L20 [Streptomyces sp. e14]
 gi|329939049|ref|ZP_08288423.1| 50S ribosomal protein L20 [Streptomyces griseoaurantiacus M045]
 gi|292831776|gb|EFF90125.1| 50S ribosomal protein L20 [Streptomyces sp. e14]
 gi|329301934|gb|EGG45827.1| 50S ribosomal protein L20 [Streptomyces griseoaurantiacus M045]
          Length = 127

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A + +DRK+L++LA+   ++F  +VE+++  L  D
Sbjct: 61  WIQRINAAARANGITYNRFIQGLKAANVEVDRKILAELAVNDANAFAALVEVAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|241663240|ref|YP_002981600.1| 50S ribosomal protein L20 [Ralstonia pickettii 12D]
 gi|240865267|gb|ACS62928.1| ribosomal protein L20 [Ralstonia pickettii 12D]
          Length = 118

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVISAAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R + L YS+F+NGL KA I LDRKVLSD+AI    +F  IV   ++ + 
Sbjct: 61  WIARINAGAREHGLTYSKFMNGLKKASIELDRKVLSDMAIHDKVAFAAIVNQVKANVA 118


>gi|163851055|ref|YP_001639098.1| ribosomal protein L20 [Methylobacterium extorquens PA1]
 gi|240138189|ref|YP_002962661.1| 50S ribosomal protein L20 [Methylobacterium extorquens AM1]
 gi|254560749|ref|YP_003067844.1| 50S ribosomal protein L20 [Methylobacterium extorquens DM4]
 gi|226730417|sp|A9W371|RL20_METEP RecName: Full=50S ribosomal protein L20
 gi|163662660|gb|ABY30027.1| ribosomal protein L20 [Methylobacterium extorquens PA1]
 gi|240008158|gb|ACS39384.1| 50S ribosomal protein L20 [Methylobacterium extorquens AM1]
 gi|254268027|emb|CAX23898.1| 50S ribosomal protein L20 [Methylobacterium extorquens DM4]
          Length = 121

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 76/118 (64%), Positives = 94/118 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQR+NAAVR + L YS+FIN L ++GI +DRK LS+LAI +  +F  +VE ++S L 
Sbjct: 61  WIQRLNAAVREHGLTYSRFINALAQSGIEVDRKALSELAIHEPAAFAAVVEKAKSALP 118


>gi|188580862|ref|YP_001924307.1| 50S ribosomal protein L20 [Methylobacterium populi BJ001]
 gi|226730419|sp|B1ZGB4|RL20_METPB RecName: Full=50S ribosomal protein L20
 gi|179344360|gb|ACB79772.1| ribosomal protein L20 [Methylobacterium populi BJ001]
          Length = 121

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 94/118 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGLQYAYRDRKNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQR+NAAVR + L YS+FIN L K+GI +DRK LS+LAI +  +F  +VE ++S L 
Sbjct: 61  WIQRLNAAVREHGLTYSRFINALAKSGIEVDRKALSELAIHEPAAFAAVVEKAKSALP 118


>gi|293604703|ref|ZP_06687103.1| 50S ribosomal protein L20 [Achromobacter piechaudii ATCC 43553]
 gi|311105458|ref|YP_003978311.1| 50S ribosomal protein L20 [Achromobacter xylosoxidans A8]
 gi|292816872|gb|EFF75953.1| 50S ribosomal protein L20 [Achromobacter piechaudii ATCC 43553]
 gi|310760147|gb|ADP15596.1| ribosomal protein L20 [Achromobacter xylosoxidans A8]
          Length = 119

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 86/119 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR + ++YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L  
Sbjct: 61  WITRINAAVREHGVSYSVFIAGLKKASIELDRKVLADLAVRDKAGFAAIVQQAKAALAA 119


>gi|226311196|ref|YP_002771090.1| 50S ribosomal protein L20 [Brevibacillus brevis NBRC 100599]
 gi|254800303|sp|C0Z9B6|RL20_BREBN RecName: Full=50S ribosomal protein L20
 gi|226094144|dbj|BAH42586.1| 50S ribosomal protein L20 [Brevibacillus brevis NBRC 100599]
          Length = 119

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V+  +HKK+LK AKG++G +    ++A A V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGIVTRRRHKKILKLAKGYFGSKHRLFKSANAQVMKSLLYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++  +++S+L  
Sbjct: 61  WITRINAQARMNGLSYSRLMHGLKVAGIEVNRKMLADLAVNDKAAFNELATVAKSKLNA 119


>gi|116515022|ref|YP_802651.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
 gi|122285582|sp|Q057Z1|RL20_BUCCC RecName: Full=50S ribosomal protein L20
 gi|116256876|gb|ABJ90558.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Cc (Cinara
           cedri)]
          Length = 119

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 89/118 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKV+K AKG+YG R    R A  AV +S QY+YRDRR KKRDFR L
Sbjct: 1   MARVKRGVIAHARHKKVIKLAKGYYGARSRVYRVANQAVIKSGQYSYRDRRNKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAAV+ Y+L+YS+FI GL  + I ++RK+LS++AI    SFKK+V+ S++ L 
Sbjct: 61  WIIRINAAVKNYNLSYSKFIYGLKLSSININRKILSEIAIFDKISFKKLVDYSKNALS 118


>gi|222151590|ref|YP_002560746.1| 50S ribosomal protein L20 [Macrococcus caseolyticus JCSC5402]
 gi|254800327|sp|B9E782|RL20_MACCJ RecName: Full=50S ribosomal protein L20
 gi|222120715|dbj|BAH18050.1| 50S ribosomal protein L20 [Macrococcus caseolyticus JCSC5402]
          Length = 118

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYAYRDRR KKR+FR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAYRDRRQKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL  AGI ++RK+LS++AI+   +F ++V  +++ L
Sbjct: 61  WIARINAAARQHDISYSRLMNGLKVAGIDVNRKMLSEIAISDEKAFAELVNQAKAAL 117


>gi|315126516|ref|YP_004068519.1| 50S ribosomal protein L20 [Pseudoalteromonas sp. SM9913]
 gi|315015030|gb|ADT68368.1| 50S ribosomal protein L20 [Pseudoalteromonas sp. SM9913]
          Length = 120

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 65/119 (54%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+FINGL K  + +DRK+L+D+A+    +F  +V  ++  L  
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKTSVEIDRKILADIAVYDQVAFAALVAKAKEGLAA 119


>gi|167037186|ref|YP_001664764.1| 50S ribosomal protein L20 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|307267645|ref|ZP_07549107.1| ribosomal protein L20 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|320115604|ref|YP_004185763.1| 50S ribosomal protein L20 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|326391473|ref|ZP_08213008.1| ribosomal protein L20 [Thermoanaerobacter ethanolicus JW 200]
 gi|226730466|sp|B0K8B5|RL20_THEP3 RecName: Full=50S ribosomal protein L20
 gi|166856020|gb|ABY94428.1| ribosomal protein L20 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|306917334|gb|EFN47646.1| ribosomal protein L20 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|319928695|gb|ADV79380.1| ribosomal protein L20 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325992499|gb|EGD50956.1| ribosomal protein L20 [Thermoanaerobacter ethanolicus JW 200]
          Length = 119

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG++G +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MARVKFGKVTRRRRKKILKLAKGYFGAKSKLFRVANQAVMKSLMYAYIGRKLRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + ++YS+FINGL KAGI ++RK+LS++AI    +F ++V +++ +L  
Sbjct: 61  WITRINAAARAHGISYSRFINGLKKAGIEINRKMLSEMAINDEKAFAELVNIAKQQLNA 119


>gi|332522613|ref|ZP_08398865.1| ribosomal protein L20 [Streptococcus porcinus str. Jelinkova 176]
 gi|332313877|gb|EGJ26862.1| ribosomal protein L20 [Streptococcus porcinus str. Jelinkova 176]
          Length = 119

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+T    F  + + ++++L
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVTDAAGFTALADAAKNKL 117


>gi|269215919|ref|ZP_06159773.1| ribosomal protein L20 [Slackia exigua ATCC 700122]
 gi|269130178|gb|EEZ61256.1| ribosomal protein L20 [Slackia exigua ATCC 700122]
          Length = 117

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  AKG+YG +  + RAAK  V  S QY YRDRR KKR+ R L
Sbjct: 1   MPRVKRAVNAHKKRRVVLSRAKGYYGAKSRSYRAAKEQVQHSLQYVYRDRRNKKREIRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVLSD+AIT  D+F ++VE+++  L
Sbjct: 61  WITRINAAARISGLSYSKFMNGLKKAGITLDRKVLSDMAITDPDAFAQLVEVAKKAL 117


>gi|329767184|ref|ZP_08258711.1| 50S ribosomal protein L20 [Gemella haemolysans M341]
 gi|328836851|gb|EGF86498.1| 50S ribosomal protein L20 [Gemella haemolysans M341]
          Length = 119

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + AK  V +S  YA+RDRR  KR+FR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYFGSKHTLFKVAKQQVMKSGMYAFRDRRQTKRNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ +NGL  AGI ++RK+LS++AI     F  I E +++ L 
Sbjct: 61  WIVRINAAARLNGLSYSRLMNGLKVAGIDINRKMLSEIAIHDAAGFASICEQAKAALA 118


>gi|241889598|ref|ZP_04776896.1| ribosomal protein L20 [Gemella haemolysans ATCC 10379]
 gi|317495089|ref|ZP_07953460.1| ribosomal protein L20 [Gemella moribillum M424]
 gi|329770369|ref|ZP_08261751.1| 50S ribosomal protein L20 [Gemella sanguinis M325]
 gi|241863220|gb|EER67604.1| ribosomal protein L20 [Gemella haemolysans ATCC 10379]
 gi|316914796|gb|EFV36271.1| ribosomal protein L20 [Gemella moribillum M424]
 gi|328836492|gb|EGF86152.1| 50S ribosomal protein L20 [Gemella sanguinis M325]
          Length = 119

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 79/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    + AK  V +S  YA+RDRR  KR+FR L
Sbjct: 1   MPRVKGGTVTRRRRKKVLKLAKGYFGSKHTLFKVAKQQVMKSGMYAFRDRRQTKRNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ +NGL  AGI ++RK+LS++AI    +F  I E +++ L 
Sbjct: 61  WIVRINAAARLNGLSYSRLMNGLKVAGIDINRKMLSEIAIHDAAAFTSICEQAKAALA 118


>gi|329849637|ref|ZP_08264483.1| ribosomal protein L20 [Asticcacaulis biprosthecum C19]
 gi|328841548|gb|EGF91118.1| ribosomal protein L20 [Asticcacaulis biprosthecum C19]
          Length = 119

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 83/119 (69%), Positives = 93/119 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVVS A+HKKVLK AKGFYGRRKNTIR AKAAVD++ QYAYRDRR KKR+FRSL
Sbjct: 1   MARVKRGVVSHARHKKVLKLAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRRTKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAA R+    YSQFI+GL  AGI +DRKVLSD+A+     FK I E  R+ L  
Sbjct: 61  WIQRINAAARIEGFTYSQFIHGLDVAGIDIDRKVLSDVAMNDEAGFKAIAEKVRTALAA 119


>gi|163744828|ref|ZP_02152188.1| 50S ribosomal protein L20 [Oceanibulbus indolifex HEL-45]
 gi|161381646|gb|EDQ06055.1| 50S ribosomal protein L20 [Oceanibulbus indolifex HEL-45]
          Length = 121

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 94/121 (77%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKK++K+AKG+YGRRKN  + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKIIKAAKGYYGRRKNVFKVATQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ ++  L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPEAFGAIVKQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|288553674|ref|YP_003425609.1| 50S ribosomal protein L20 [Bacillus pseudofirmus OF4]
 gi|288544834|gb|ADC48717.1| 50S ribosomal protein L20 [Bacillus pseudofirmus OF4]
          Length = 119

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG++G +    ++A+  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYVARRRRKKVLKLAKGYFGSKHLLFKSAQGQVMKSLLYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+   ++F ++ E ++S L  
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLAEINVNRKILADLAVNDAEAFAQLAEKAKSSLNA 119


>gi|153008136|ref|YP_001369351.1| 50S ribosomal protein L20 [Ochrobactrum anthropi ATCC 49188]
 gi|239833161|ref|ZP_04681490.1| ribosomal protein L20 [Ochrobactrum intermedium LMG 3301]
 gi|166219670|sp|A6WX18|RL20_OCHA4 RecName: Full=50S ribosomal protein L20
 gi|151560024|gb|ABS13522.1| ribosomal protein L20 [Ochrobactrum anthropi ATCC 49188]
 gi|239825428|gb|EEQ96996.1| ribosomal protein L20 [Ochrobactrum intermedium LMG 3301]
          Length = 134

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 92/118 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL  A GF GRRKNTIR AKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLDQAAGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + D+F  +V  ++  L 
Sbjct: 61  WIQRINAAVREQGLTYGRFIDGLAKAGIEIDRKVLSDIAIHEPDAFGALVASAKKALE 118


>gi|58698330|ref|ZP_00373246.1| ribosomal protein L20 [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|99036098|ref|ZP_01315131.1| hypothetical protein Wendoof_01000021 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|225629870|ref|ZP_03787776.1| ribosomal protein L20 [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225630568|ref|YP_002727359.1| ribosomal protein L20 [Wolbachia sp. wRi]
 gi|254800352|sp|C0R3S6|RL20_WOLWR RecName: Full=50S ribosomal protein L20
 gi|58535154|gb|EAL59237.1| ribosomal protein L20 [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225591278|gb|EEH12412.1| ribosomal protein L20 [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225592549|gb|ACN95568.1| ribosomal protein L20 [Wolbachia sp. wRi]
          Length = 121

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 64/120 (53%), Positives = 86/120 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ GR K+  R A   V+++ QYAYRDRR +KRDFRSL
Sbjct: 1   MARVKRGVTTHARHKKILKLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRTRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R + L Y +F++GL  AGI L+RK+L+++A+   D F K+VE    +L  +
Sbjct: 61  WIIRINAAAREHGLTYGRFMHGLTLAGIDLNRKILAEMAVNYKDDFAKLVETVSGKLAEN 120


>gi|27468271|ref|NP_764908.1| 50S ribosomal protein L20 [Staphylococcus epidermidis ATCC 12228]
 gi|57867161|ref|YP_188816.1| 50S ribosomal protein L20 [Staphylococcus epidermidis RP62A]
 gi|242242942|ref|ZP_04797387.1| 50S ribosomal protein L20 [Staphylococcus epidermidis W23144]
 gi|251811072|ref|ZP_04825545.1| 50S ribosomal protein L20 [Staphylococcus epidermidis BCM-HMP0060]
 gi|282875901|ref|ZP_06284768.1| ribosomal protein L20 [Staphylococcus epidermidis SK135]
 gi|293366373|ref|ZP_06613052.1| 50S ribosomal protein L20 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|31563117|sp|Q8CS77|RL20_STAES RecName: Full=50S ribosomal protein L20
 gi|81819376|sp|Q5HNM5|RL20_STAEQ RecName: Full=50S ribosomal protein L20
 gi|27315817|gb|AAO04952.1|AE016748_186 50S ribosomal protein L20 [Staphylococcus epidermidis ATCC 12228]
 gi|57637819|gb|AAW54607.1| ribosomal protein L20 [Staphylococcus epidermidis RP62A]
 gi|242233543|gb|EES35855.1| 50S ribosomal protein L20 [Staphylococcus epidermidis W23144]
 gi|251805407|gb|EES58064.1| 50S ribosomal protein L20 [Staphylococcus epidermidis BCM-HMP0060]
 gi|281294926|gb|EFA87453.1| ribosomal protein L20 [Staphylococcus epidermidis SK135]
 gi|291319498|gb|EFE59865.1| 50S ribosomal protein L20 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|319400994|gb|EFV89213.1| ribosomal protein L20 [Staphylococcus epidermidis FRI909]
 gi|329724652|gb|EGG61158.1| ribosomal protein L20 [Staphylococcus epidermidis VCU144]
 gi|329733767|gb|EGG70093.1| ribosomal protein L20 [Staphylococcus epidermidis VCU045]
 gi|329737341|gb|EGG73595.1| ribosomal protein L20 [Staphylococcus epidermidis VCU028]
          Length = 118

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDISYSRLMNGLKKAEIDINRKMLSEIAISDDKAFAELVSKAKEAL 117


>gi|254821222|ref|ZP_05226223.1| 50S ribosomal protein L20 [Mycobacterium intracellulare ATCC 13950]
          Length = 131

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK++KG+ G+R    R AK     S QYAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSILKASKGYRGQRSRLYRKAKEQQLHSLQYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+A+    +F  +V+++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAVADPAAFTALVDIARAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|49074300|gb|AAT49394.1| PA2741 [synthetic construct]
          Length = 119

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARQNGLSYSRLIAGLKKAAIEIDRKVLADLAVNEKAAFTAIVEKAKASLA 118


>gi|227550909|ref|ZP_03980958.1| ribosomal protein L20 [Enterococcus faecium TX1330]
 gi|257885799|ref|ZP_05665452.1| ribosomal protein L20 [Enterococcus faecium 1,231,501]
 gi|257887842|ref|ZP_05667495.1| ribosomal protein L20 [Enterococcus faecium 1,141,733]
 gi|257893360|ref|ZP_05673013.1| ribosomal protein L20 [Enterococcus faecium 1,231,408]
 gi|257896540|ref|ZP_05676193.1| ribosomal protein L20 [Enterococcus faecium Com12]
 gi|257899521|ref|ZP_05679174.1| ribosomal protein L20 [Enterococcus faecium Com15]
 gi|293379320|ref|ZP_06625466.1| ribosomal protein L20 [Enterococcus faecium PC4.1]
 gi|293556931|ref|ZP_06675492.1| ribosomal protein L20 [Enterococcus faecium E1039]
 gi|293572982|ref|ZP_06683924.1| ribosomal protein L20 [Enterococcus faecium E980]
 gi|227180007|gb|EEI60979.1| ribosomal protein L20 [Enterococcus faecium TX1330]
 gi|257821655|gb|EEV48785.1| ribosomal protein L20 [Enterococcus faecium 1,231,501]
 gi|257823896|gb|EEV50828.1| ribosomal protein L20 [Enterococcus faecium 1,141,733]
 gi|257829739|gb|EEV56346.1| ribosomal protein L20 [Enterococcus faecium 1,231,408]
 gi|257833105|gb|EEV59526.1| ribosomal protein L20 [Enterococcus faecium Com12]
 gi|257837433|gb|EEV62507.1| ribosomal protein L20 [Enterococcus faecium Com15]
 gi|291601015|gb|EFF31306.1| ribosomal protein L20 [Enterococcus faecium E1039]
 gi|291606884|gb|EFF36264.1| ribosomal protein L20 [Enterococcus faecium E980]
 gi|292642116|gb|EFF60280.1| ribosomal protein L20 [Enterococcus faecium PC4.1]
          Length = 119

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+VLK AKG+YG +    + AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKRVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + ++  L 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKVAEIDINRKMLADLAVNDAAAFTALADQAKDALA 118


>gi|225019251|ref|ZP_03708443.1| hypothetical protein CLOSTMETH_03204 [Clostridium methylpentosum
           DSM 5476]
 gi|224947882|gb|EEG29091.1| hypothetical protein CLOSTMETH_03204 [Clostridium methylpentosum
           DSM 5476]
          Length = 117

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR +++  + KKV+K AKG++G +    R AK AV +S QYAY  R+ KKRDFR +
Sbjct: 1   MARVKRAMMTRKRRKKVMKLAKGYFGGKSKLFRTAKEAVMKSGQYAYIGRKQKKRDFRRI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+A  ++  +NYS FINGL KA I L+RK+LS++AI    +F  + E +++ L
Sbjct: 61  WITRISAGCKMNGMNYSTFINGLKKANITLNRKMLSEIAINDPAAFTALCEKAKAAL 117


>gi|297195411|ref|ZP_06912809.1| 50S ribosomal protein L20 [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197719219|gb|EDY63127.1| 50S ribosomal protein L20 [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 127

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 75/123 (60%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DRK+L++LA+    +F  +VE+++  L  D
Sbjct: 61  WIQRINAAARQNGMTYNRLIQGLKAANIEVDRKILAELAVNDAGAFAALVEVAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|307244175|ref|ZP_07526290.1| ribosomal protein L20 [Peptostreptococcus stomatis DSM 17678]
 gi|306492325|gb|EFM64363.1| ribosomal protein L20 [Peptostreptococcus stomatis DSM 17678]
          Length = 118

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+G+ +  +HKKVLK AKG+ G R    + +   V ++ + AY  R+ KKRDFR L
Sbjct: 1   MARVKKGMNAHKRHKKVLKLAKGYQGSRSKLFKTSNQFVMKALKNAYIGRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R+ D++YS+F+NGL KAG+ ++RK+LS+LAI   D F K+V +++  L 
Sbjct: 61  WIQRINAACRMNDMSYSKFMNGLKKAGVEVNRKMLSELAIADPDGFAKLVAVAKENLA 118


>gi|254252555|ref|ZP_04945873.1| Ribosomal protein L20 [Burkholderia dolosa AUO158]
 gi|124895164|gb|EAY69044.1| Ribosomal protein L20 [Burkholderia dolosa AUO158]
          Length = 119

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 86/119 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++  AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKIINLAKGYRGRRNNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR +D+ YS FI+GL KA I LDRKVL+D+A+    +F  IV+  ++ +  
Sbjct: 61  WITRINAAVRQHDMTYSVFISGLKKASIELDRKVLADMAVFDKAAFAAIVKQVKAAVAA 119


>gi|320093953|ref|ZP_08025782.1| inorganic diphosphatase [Actinomyces sp. oral taxon 178 str. F0338]
 gi|319979111|gb|EFW10625.1| inorganic diphosphatase [Actinomyces sp. oral taxon 178 str. F0338]
          Length = 126

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDR+ +K DFR L
Sbjct: 1   MARVKRSVNAKKKRRTVLEQASGYRGQRSRMYRKAKEQVTHSFVYAYRDRKARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL+ AG+ +DR++L++LA+ +  +F  +V++++  L  D
Sbjct: 61  WIQRINAASRAEGLTYNRFIQGLNLAGVEVDRRMLAELAVNEPAAFTALVKVAKEALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|290961734|ref|YP_003492916.1| 50S ribosomal protein L20 [Streptomyces scabiei 87.22]
 gi|260651260|emb|CBG74382.1| 50S ribosomal protein L20 [Streptomyces scabiei 87.22]
          Length = 127

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 76/123 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEAASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DRK+L++LA+    +F  +VE+++  L  D
Sbjct: 61  WIQRINAAARQNGMTYNRLIQGLKAANIEVDRKILAELAVNDATAFSALVEVAQKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|147678288|ref|YP_001212503.1| 50S ribosomal protein L20 [Pelotomaculum thermopropionicum SI]
 gi|189041873|sp|A5D0U4|RL20_PELTS RecName: Full=50S ribosomal protein L20
 gi|146274385|dbj|BAF60134.1| ribosomal protein L20 [Pelotomaculum thermopropionicum SI]
          Length = 117

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K  VVS  +HKK+LK AKG+ G +    R A   V +S  YAYRDR+ +KRDFR L
Sbjct: 1   MPRAKSSVVSRKRHKKILKLAKGYRGAKSKLYRIANQQVMKSLVYAYRDRKARKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+ +NGL  AG+ ++RK+L+D+A+    +F ++VE+++++L
Sbjct: 61  WITRINAAARMNGISYSRLMNGLKLAGVDINRKMLADMAVNDAQAFGRLVEIAKAKL 117


>gi|295113893|emb|CBL32530.1| LSU ribosomal protein L20P [Enterococcus sp. 7L76]
          Length = 119

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    ++AK  V  S  YA+RDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKSAKEQVMNSYYYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + E ++  L 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDTAAFTALAEQAKDALS 118


>gi|315641761|ref|ZP_07896775.1| 50S ribosomal protein L20 [Enterococcus italicus DSM 15952]
 gi|315482524|gb|EFU73062.1| 50S ribosomal protein L20 [Enterococcus italicus DSM 15952]
          Length = 119

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+VLK AKG+YG +    + AK  V  S  YA+RDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKRVLKLAKGYYGSKHTLFKTAKEQVMNSYNYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + + ++  L 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDASAFTALADQAKDALS 118


>gi|229591576|ref|YP_002873695.1| 50S ribosomal protein L20 [Pseudomonas fluorescens SBW25]
 gi|312961940|ref|ZP_07776437.1| 50S ribosomal protein L20 [Pseudomonas fluorescens WH6]
 gi|259646195|sp|C3JZN4|RL20_PSEFS RecName: Full=50S ribosomal protein L20
 gi|229363442|emb|CAY50639.1| 50S ribosomal protein L20 [Pseudomonas fluorescens SBW25]
 gi|311283750|gb|EFQ62334.1| 50S ribosomal protein L20 [Pseudomonas fluorescens WH6]
          Length = 118

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  RV  L+YS+FI GL KA I +DRKVL++LA+ +   F  IVE +++ L 
Sbjct: 61  WIARINAGARVNGLSYSRFIAGLKKASIEIDRKVLAELAVNEKAVFAAIVEKAKATLA 118


>gi|323490464|ref|ZP_08095671.1| 50S ribosomal protein L20 [Planococcus donghaensis MPA1U2]
 gi|323395868|gb|EGA88707.1| 50S ribosomal protein L20 [Planococcus donghaensis MPA1U2]
          Length = 119

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 53/116 (45%), Positives = 80/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGAKHILFKVANQQVMKSGNYAYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+ +++YS+ ++GL  AGI ++RK+L+++A++   +F  +V+ ++  
Sbjct: 61  WITRINAAARMNEISYSRLMHGLKVAGIDINRKMLAEIAVSDAAAFTALVDQAKKA 116


>gi|58038738|ref|YP_190702.1| 50S ribosomal protein L20 [Gluconobacter oxydans 621H]
 gi|81819171|sp|Q5FUA0|RL20_GLUOX RecName: Full=50S ribosomal protein L20
 gi|58001152|gb|AAW60046.1| LSU ribosomal protein L20P [Gluconobacter oxydans 621H]
          Length = 118

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S A+HKKVL+ AKG+ GR     R A   V+++ +YAYRDRR KKRDFR+L
Sbjct: 1   MARVKRGVTSHARHKKVLELAKGYRGRSSTNYRIALERVEKALRYAYRDRRNKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS+FINGL KAGI +DRKVL+ +A     +F +IV+ +++ L
Sbjct: 61  WIQRINAAVREHGLTYSRFINGLDKAGIEIDRKVLAAIAFDDSAAFGEIVKKAQAAL 117


>gi|297198452|ref|ZP_06915849.1| ribosomal protein L20 [Streptomyces sviceus ATCC 29083]
 gi|197716142|gb|EDY60176.1| ribosomal protein L20 [Streptomyces sviceus ATCC 29083]
          Length = 127

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEAASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A I +DRK+L++LA+    +F  +VE+++  L  D
Sbjct: 61  WIQRINAAARANGITYNRFIQGLKAANIEVDRKILAELAVNDATAFAALVEVAQKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|158426072|ref|YP_001527364.1| 50S ribosomal protein L20 [Azorhizobium caulinodans ORS 571]
 gi|172047850|sp|A8HWM3|RL20_AZOC5 RecName: Full=50S ribosomal protein L20
 gi|158332961|dbj|BAF90446.1| ribosomal protein L20 [Azorhizobium caulinodans ORS 571]
          Length = 119

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 78/119 (65%), Positives = 96/119 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKV K+AKGFYGRRKNTIRAAK+AV+RS QY YRDR+VKKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVFKAAKGFYGRRKNTIRAAKSAVERSMQYNYRDRKVKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINA VR   + Y +FI+GL KAGI +DRKVLSD+A+ + ++ K +VE +++ L  
Sbjct: 61  WIQRINAGVRELGMTYGRFIDGLGKAGIEVDRKVLSDIAVHEPETLKALVEKAQAALAA 119


>gi|78486005|ref|YP_391930.1| 50S ribosomal protein L20 [Thiomicrospira crunogena XCL-2]
 gi|109893166|sp|Q31F17|RL20_THICR RecName: Full=50S ribosomal protein L20
 gi|78364291|gb|ABB42256.1| LSU ribosomal protein L20P [Thiomicrospira crunogena XCL-2]
          Length = 118

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 68/118 (57%), Positives = 87/118 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +H KVLK AKG+YG RK   R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVIARKRHNKVLKQAKGYYGARKKIFRVAKQAVIKAGQYAYRDRRNKKRQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  + YS+FI+GL+KAG+ +DRKVLSD+A+    +F  IVE +++ L 
Sbjct: 61  WIARINAAARLNGMTYSRFISGLNKAGVEVDRKVLSDIAVHDAAAFSAIVEKAKAALA 118


>gi|87122881|ref|ZP_01078749.1| Ribosomal protein L20 [Marinomonas sp. MED121]
 gi|86161832|gb|EAQ63129.1| Ribosomal protein L20 [Marinomonas sp. MED121]
          Length = 118

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVQARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  ++YS+FI GL KA I +DRKVL+DLA+ + + F  IVE +++ L 
Sbjct: 61  WIARINAAARINGMSYSRFIAGLKKAAIEIDRKVLADLAVYEKEVFAAIVEKAKASLA 118


>gi|163856954|ref|YP_001631252.1| 50S ribosomal protein L20 [Bordetella petrii DSM 12804]
 gi|226730361|sp|A9IPU1|RL20_BORPD RecName: Full=50S ribosomal protein L20
 gi|163260682|emb|CAP42984.1| 50S ribosomal protein L20 [Bordetella petrii]
          Length = 119

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR   ++YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L  
Sbjct: 61  WITRINAAVREQGMSYSVFIAGLKKASIDLDRKVLADLAVRDKAGFAAIVQQAKAALSA 119


>gi|302541294|ref|ZP_07293636.1| ribosomal protein L20 [Streptomyces hygroscopicus ATCC 53653]
 gi|302458912|gb|EFL22005.1| ribosomal protein L20 [Streptomyces himastatinicus ATCC 53653]
          Length = 127

 Score =  154 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 76/123 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A I +DRK+L+DLA+   ++F  +VE ++  L  D
Sbjct: 61  WIQRINAAARANGMTYNRFIQGLKAANIEVDRKILADLAVNDANAFAALVEAAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|228475205|ref|ZP_04059931.1| ribosomal protein L20 [Staphylococcus hominis SK119]
 gi|314936217|ref|ZP_07843564.1| ribosomal protein L20 [Staphylococcus hominis subsp. hominis C80]
 gi|228270816|gb|EEK12218.1| ribosomal protein L20 [Staphylococcus hominis SK119]
 gi|313654836|gb|EFS18581.1| ribosomal protein L20 [Staphylococcus hominis subsp. hominis C80]
          Length = 118

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDISYSRLMNGLKKADININRKMLSEIAISDDKAFGELVSKAKDAL 117


>gi|258515610|ref|YP_003191832.1| 50S ribosomal protein L20 [Desulfotomaculum acetoxidans DSM 771]
 gi|257779315|gb|ACV63209.1| ribosomal protein L20 [Desulfotomaculum acetoxidans DSM 771]
          Length = 118

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GV    +HKK+LK AKG+ G R    R A  +V ++  YAYRDR+ +KRDFR L
Sbjct: 1   MSRVKSGVTRRKRHKKILKLAKGYRGSRSKLFRVANQSVMKALSYAYRDRKARKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+Y++F+NGL +AG+ ++RK+L++LA+    SF ++V++++S+L
Sbjct: 61  WIARINAAARTNGLSYNKFMNGLKQAGVEVNRKMLAELAVNDNQSFVQLVQIAKSKL 117


>gi|229817385|ref|ZP_04447667.1| hypothetical protein BIFANG_02647 [Bifidobacterium angulatum DSM
           20098]
 gi|229785174|gb|EEP21288.1| hypothetical protein BIFANG_02647 [Bifidobacterium angulatum DSM
           20098]
          Length = 127

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GLH AGI LDR+ L++LA++  ++FK IV  ++  L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLHLAGIELDRRALAELAVSDPETFKAIVAEAKKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|237747670|ref|ZP_04578150.1| large subunit ribosomal protein L20 [Oxalobacter formigenes OXCC13]
 gi|229379032|gb|EEO29123.1| large subunit ribosomal protein L20 [Oxalobacter formigenes OXCC13]
          Length = 119

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKK+L  AKGF GRR +  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MSRVKRGVTARARHKKILAEAKGFRGRRSSVFRVAKEAVMKAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   ++YS F+NGL KA I LDRKVL+D+A+    +F  IV   ++ +  
Sbjct: 61  WITRINAATRELGMSYSVFMNGLKKASIELDRKVLADMAVADKPAFAAIVNQVKAAIAA 119


>gi|91776352|ref|YP_546108.1| 50S ribosomal protein L20 [Methylobacillus flagellatus KT]
 gi|122399616|sp|Q1GZS0|RL20_METFK RecName: Full=50S ribosomal protein L20
 gi|91710339|gb|ABE50267.1| LSU ribosomal protein L20P [Methylobacillus flagellatus KT]
          Length = 120

 Score =  153 bits (388), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 88/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVL +AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVIARARHKKVLNAAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R Y L YS+FINGL K+ + +DRKVL+DLA+    +F K  EL++S L  
Sbjct: 61  WIARINAGAREYGLTYSRFINGLKKSAVEVDRKVLADLAVFDKQAFAKFAELAKSGLAA 119


>gi|118617268|ref|YP_905600.1| 50S ribosomal protein L20 [Mycobacterium ulcerans Agy99]
 gi|166219666|sp|A0PP60|RL20_MYCUA RecName: Full=50S ribosomal protein L20
 gi|118569378|gb|ABL04129.1| 50S ribosomal protein L20 RplT [Mycobacterium ulcerans Agy99]
          Length = 129

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAHKKRRSVLKASKGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+AIT   +F  +V+++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAITDPAAFTALVDVARAALPED 120

Query: 121 VAS 123
           V++
Sbjct: 121 VSA 123


>gi|42520700|ref|NP_966615.1| 50S ribosomal protein L20 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|60390506|sp|Q73GR7|RL20_WOLPM RecName: Full=50S ribosomal protein L20
 gi|42410440|gb|AAS14549.1| ribosomal protein L20 [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 121

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ GR K+  R A   V+++ QYAYRDRR +KRDFRSL
Sbjct: 1   MARVKRGVTTHARHKKILKLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRTRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + L Y +F++GL  AGI L+RK+L+++A+   D F K+VE    +L  
Sbjct: 61  WIIRINAAAREHGLTYGRFMHGLTLAGIDLNRKILAEMAVNYKDDFAKLVETVSGKLAE 119


>gi|254468984|ref|ZP_05082390.1| ribosomal protein L20 [beta proteobacterium KB13]
 gi|207087794|gb|EDZ65077.1| ribosomal protein L20 [beta proteobacterium KB13]
          Length = 119

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL +AKG+ GRRKN  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARAKHKKVLDAAKGYRGRRKNVFRVAKEAVMKAGQYAYRDRRQKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R + L YS+ INGL KA + +DRKVL+DLA+    +F+K  EL++S +  
Sbjct: 61  WIARINAGAREFGLTYSRLINGLKKASVEVDRKVLADLAVFDKAAFEKYAELAKSNIEA 119


>gi|29375500|ref|NP_814654.1| 50S ribosomal protein L20 [Enterococcus faecalis V583]
 gi|227517835|ref|ZP_03947884.1| 50S ribosomal protein L20 [Enterococcus faecalis TX0104]
 gi|227555027|ref|ZP_03985074.1| 50S ribosomal protein L20 [Enterococcus faecalis HH22]
 gi|229546760|ref|ZP_04435485.1| 50S ribosomal protein L20 [Enterococcus faecalis TX1322]
 gi|229548852|ref|ZP_04437577.1| 50S ribosomal protein L20 [Enterococcus faecalis ATCC 29200]
 gi|255971366|ref|ZP_05421952.1| ribosomal protein L20 [Enterococcus faecalis T1]
 gi|255973985|ref|ZP_05424571.1| ribosomal protein L20 [Enterococcus faecalis T2]
 gi|256617784|ref|ZP_05474630.1| ribosomal protein L20 [Enterococcus faecalis ATCC 4200]
 gi|256761670|ref|ZP_05502250.1| ribosomal protein L20 [Enterococcus faecalis T3]
 gi|256854241|ref|ZP_05559605.1| ribosomal protein L20 [Enterococcus faecalis T8]
 gi|256957228|ref|ZP_05561399.1| ribosomal protein L20 [Enterococcus faecalis DS5]
 gi|256960041|ref|ZP_05564212.1| 50S ribosomal protein L20 [Enterococcus faecalis Merz96]
 gi|256964265|ref|ZP_05568436.1| 50S ribosomal protein L20 [Enterococcus faecalis HIP11704]
 gi|257077800|ref|ZP_05572161.1| 50S ribosomal protein L20 [Enterococcus faecalis JH1]
 gi|257081159|ref|ZP_05575520.1| ribosomal protein L20 [Enterococcus faecalis E1Sol]
 gi|257083828|ref|ZP_05578189.1| 50S ribosomal protein L20 [Enterococcus faecalis Fly1]
 gi|257086253|ref|ZP_05580614.1| ribosomal protein L20 [Enterococcus faecalis D6]
 gi|257089326|ref|ZP_05583687.1| 50S ribosomal protein L20 [Enterococcus faecalis CH188]
 gi|257415478|ref|ZP_05592472.1| ribosomal protein L20 [Enterococcus faecalis AR01/DG]
 gi|257418510|ref|ZP_05595504.1| 50S ribosomal protein L20 [Enterococcus faecalis T11]
 gi|257421160|ref|ZP_05598150.1| 50S ribosomal protein L20 [Enterococcus faecalis X98]
 gi|293383794|ref|ZP_06629701.1| ribosomal protein L20 [Enterococcus faecalis R712]
 gi|293388730|ref|ZP_06633223.1| ribosomal protein L20 [Enterococcus faecalis S613]
 gi|294781326|ref|ZP_06746672.1| ribosomal protein L20 [Enterococcus faecalis PC1.1]
 gi|300859954|ref|ZP_07106042.1| ribosomal protein L20 [Enterococcus faecalis TUSoD Ef11]
 gi|307267991|ref|ZP_07549379.1| ribosomal protein L20 [Enterococcus faecalis TX4248]
 gi|307271915|ref|ZP_07553183.1| ribosomal protein L20 [Enterococcus faecalis TX0855]
 gi|307278389|ref|ZP_07559464.1| ribosomal protein L20 [Enterococcus faecalis TX0860]
 gi|307286723|ref|ZP_07566809.1| ribosomal protein L20 [Enterococcus faecalis TX0109]
 gi|307290932|ref|ZP_07570822.1| ribosomal protein L20 [Enterococcus faecalis TX0411]
 gi|312901542|ref|ZP_07760815.1| ribosomal protein L20 [Enterococcus faecalis TX0470]
 gi|312904476|ref|ZP_07763635.1| ribosomal protein L20 [Enterococcus faecalis TX0635]
 gi|312906990|ref|ZP_07765986.1| ribosomal protein L20 [Enterococcus faecalis DAPTO 512]
 gi|312952817|ref|ZP_07771679.1| ribosomal protein L20 [Enterococcus faecalis TX0102]
 gi|312978752|ref|ZP_07790479.1| ribosomal protein L20 [Enterococcus faecalis DAPTO 516]
 gi|39931897|sp|Q837C7|RL20_ENTFA RecName: Full=50S ribosomal protein L20
 gi|29342960|gb|AAO80724.1| ribosomal protein L20 [Enterococcus faecalis V583]
 gi|227074725|gb|EEI12688.1| 50S ribosomal protein L20 [Enterococcus faecalis TX0104]
 gi|227175853|gb|EEI56825.1| 50S ribosomal protein L20 [Enterococcus faecalis HH22]
 gi|229306081|gb|EEN72077.1| 50S ribosomal protein L20 [Enterococcus faecalis ATCC 29200]
 gi|229308109|gb|EEN74096.1| 50S ribosomal protein L20 [Enterococcus faecalis TX1322]
 gi|255962384|gb|EET94860.1| ribosomal protein L20 [Enterococcus faecalis T1]
 gi|255966857|gb|EET97479.1| ribosomal protein L20 [Enterococcus faecalis T2]
 gi|256597311|gb|EEU16487.1| ribosomal protein L20 [Enterococcus faecalis ATCC 4200]
 gi|256682921|gb|EEU22616.1| ribosomal protein L20 [Enterococcus faecalis T3]
 gi|256709801|gb|EEU24845.1| ribosomal protein L20 [Enterococcus faecalis T8]
 gi|256947724|gb|EEU64356.1| ribosomal protein L20 [Enterococcus faecalis DS5]
 gi|256950537|gb|EEU67169.1| 50S ribosomal protein L20 [Enterococcus faecalis Merz96]
 gi|256954761|gb|EEU71393.1| 50S ribosomal protein L20 [Enterococcus faecalis HIP11704]
 gi|256985830|gb|EEU73132.1| 50S ribosomal protein L20 [Enterococcus faecalis JH1]
 gi|256989189|gb|EEU76491.1| ribosomal protein L20 [Enterococcus faecalis E1Sol]
 gi|256991858|gb|EEU79160.1| 50S ribosomal protein L20 [Enterococcus faecalis Fly1]
 gi|256994283|gb|EEU81585.1| ribosomal protein L20 [Enterococcus faecalis D6]
 gi|256998138|gb|EEU84658.1| 50S ribosomal protein L20 [Enterococcus faecalis CH188]
 gi|257157306|gb|EEU87266.1| ribosomal protein L20 [Enterococcus faecalis ARO1/DG]
 gi|257160338|gb|EEU90298.1| 50S ribosomal protein L20 [Enterococcus faecalis T11]
 gi|257162984|gb|EEU92944.1| 50S ribosomal protein L20 [Enterococcus faecalis X98]
 gi|291078870|gb|EFE16234.1| ribosomal protein L20 [Enterococcus faecalis R712]
 gi|291081887|gb|EFE18850.1| ribosomal protein L20 [Enterococcus faecalis S613]
 gi|294451662|gb|EFG20118.1| ribosomal protein L20 [Enterococcus faecalis PC1.1]
 gi|300850772|gb|EFK78521.1| ribosomal protein L20 [Enterococcus faecalis TUSoD Ef11]
 gi|306498002|gb|EFM67529.1| ribosomal protein L20 [Enterococcus faecalis TX0411]
 gi|306502201|gb|EFM71485.1| ribosomal protein L20 [Enterococcus faecalis TX0109]
 gi|306504895|gb|EFM74090.1| ribosomal protein L20 [Enterococcus faecalis TX0860]
 gi|306511421|gb|EFM80423.1| ribosomal protein L20 [Enterococcus faecalis TX0855]
 gi|306515632|gb|EFM84159.1| ribosomal protein L20 [Enterococcus faecalis TX4248]
 gi|310626975|gb|EFQ10258.1| ribosomal protein L20 [Enterococcus faecalis DAPTO 512]
 gi|310629333|gb|EFQ12616.1| ribosomal protein L20 [Enterococcus faecalis TX0102]
 gi|310632174|gb|EFQ15457.1| ribosomal protein L20 [Enterococcus faecalis TX0635]
 gi|311288459|gb|EFQ67015.1| ribosomal protein L20 [Enterococcus faecalis DAPTO 516]
 gi|311291337|gb|EFQ69893.1| ribosomal protein L20 [Enterococcus faecalis TX0470]
 gi|315027101|gb|EFT39033.1| ribosomal protein L20 [Enterococcus faecalis TX2137]
 gi|315029786|gb|EFT41718.1| ribosomal protein L20 [Enterococcus faecalis TX4000]
 gi|315032455|gb|EFT44387.1| ribosomal protein L20 [Enterococcus faecalis TX0017]
 gi|315034311|gb|EFT46243.1| ribosomal protein L20 [Enterococcus faecalis TX0027]
 gi|315145797|gb|EFT89813.1| ribosomal protein L20 [Enterococcus faecalis TX2141]
 gi|315148073|gb|EFT92089.1| ribosomal protein L20 [Enterococcus faecalis TX4244]
 gi|315149675|gb|EFT93691.1| ribosomal protein L20 [Enterococcus faecalis TX0012]
 gi|315152988|gb|EFT97004.1| ribosomal protein L20 [Enterococcus faecalis TX0031]
 gi|315155219|gb|EFT99235.1| ribosomal protein L20 [Enterococcus faecalis TX0043]
 gi|315157546|gb|EFU01563.1| ribosomal protein L20 [Enterococcus faecalis TX0312]
 gi|315163025|gb|EFU07042.1| ribosomal protein L20 [Enterococcus faecalis TX0645]
 gi|315165224|gb|EFU09241.1| ribosomal protein L20 [Enterococcus faecalis TX1302]
 gi|315167949|gb|EFU11966.1| ribosomal protein L20 [Enterococcus faecalis TX1341]
 gi|315172018|gb|EFU16035.1| ribosomal protein L20 [Enterococcus faecalis TX1342]
 gi|315174841|gb|EFU18858.1| ribosomal protein L20 [Enterococcus faecalis TX1346]
 gi|315574171|gb|EFU86362.1| ribosomal protein L20 [Enterococcus faecalis TX0309B]
 gi|315577302|gb|EFU89493.1| ribosomal protein L20 [Enterococcus faecalis TX0630]
 gi|315581686|gb|EFU93877.1| ribosomal protein L20 [Enterococcus faecalis TX0309A]
 gi|323480096|gb|ADX79535.1| ribosomal protein L20 [Enterococcus faecalis 62]
 gi|327534496|gb|AEA93330.1| 50S ribosomal protein L20 [Enterococcus faecalis OG1RF]
 gi|329577912|gb|EGG59333.1| ribosomal protein L20 [Enterococcus faecalis TX1467]
          Length = 119

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    ++AK  V  S  YA+RDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKSAKEQVMNSYYYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L+DLA+    +F  + E ++  L 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLADLAVNDAAAFTALAEQAKDALS 118


>gi|167645156|ref|YP_001682819.1| 50S ribosomal protein L20 [Caulobacter sp. K31]
 gi|189041852|sp|B0SXZ8|RL20_CAUSK RecName: Full=50S ribosomal protein L20
 gi|167347586|gb|ABZ70321.1| ribosomal protein L20 [Caulobacter sp. K31]
          Length = 119

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 80/119 (67%), Positives = 92/119 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL+ AKGFYGRRKNTIR AKAAVD++ QYAYRDR+V+KR FRSL
Sbjct: 1   MARVKRGVTAHAKHKKVLEQAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRKVRKRAFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINA  RV    YSQFI+GL  AGIV+DRKVLSD+A     +FK I +  R+ L  
Sbjct: 61  WIQRINAGARVEGFTYSQFIHGLDVAGIVIDRKVLSDIAGQDPVAFKAIADKVRAALAA 119


>gi|229820869|ref|YP_002882395.1| ribosomal protein L20 [Beutenbergia cavernae DSM 12333]
 gi|259646175|sp|C5BW32|RL20_BEUC1 RecName: Full=50S ribosomal protein L20
 gi|229566782|gb|ACQ80633.1| ribosomal protein L20 [Beutenbergia cavernae DSM 12333]
          Length = 126

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTTLERASGYRGQRSRLYRKAKEQVTHSLGYAYRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A + +DR++L++LA++   +F  +VEL++  L  D
Sbjct: 61  WIQRINAAARANGITYNRFIQGLKAAEVEVDRRMLAELAVSDPAAFTTLVELAKGALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|254385010|ref|ZP_05000344.1| 50S ribosomal protein L20 [Streptomyces sp. Mg1]
 gi|194343889|gb|EDX24855.1| 50S ribosomal protein L20 [Streptomyces sp. Mg1]
          Length = 130

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S  Y + DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEAASGYRGQRSRLYRKAKEQVTHSLVYNFNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DRK+L++LA+   ++F  +VE+++  L  D
Sbjct: 61  WIQRINAAARQNGMTYNRLIQGLKAANIEVDRKILAELAVNDANAFAALVEVAQKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|294811658|ref|ZP_06770301.1| 50S ribosomal protein L20 [Streptomyces clavuligerus ATCC 27064]
 gi|326440158|ref|ZP_08214892.1| 50S ribosomal protein L20 [Streptomyces clavuligerus ATCC 27064]
 gi|294324257|gb|EFG05900.1| 50S ribosomal protein L20 [Streptomyces clavuligerus ATCC 27064]
          Length = 128

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++ I GL  A + +DRK+L++LA+   ++F  +VE+++  L  D
Sbjct: 61  WIQRINAAARLNGMTYNRLIQGLKAANVEVDRKILAELAVNDANAFAALVEVAQKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|187478561|ref|YP_786585.1| 50S ribosomal protein L20 [Bordetella avium 197N]
 gi|109893098|sp|Q2KZL8|RL20_BORA1 RecName: Full=50S ribosomal protein L20
 gi|115423147|emb|CAJ49678.1| 50S ribosomal protein L20 [Bordetella avium 197N]
          Length = 119

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 71/119 (59%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR   L+YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L  
Sbjct: 61  WITRINAAVREQGLSYSVFIAGLKKAAIELDRKVLADLAVRDKAGFAAIVQQAKAALAA 119


>gi|149374486|ref|ZP_01892260.1| ribosomal protein L20 [Marinobacter algicola DG893]
 gi|149361189|gb|EDM49639.1| ribosomal protein L20 [Marinobacter algicola DG893]
          Length = 117

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVVARRRHKKILSQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA + +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARANGLSYSRLIAGLKKANVEIDRKVLADLAMNEQQAFTAVVEKAKASL 117


>gi|302550250|ref|ZP_07302592.1| ribosomal protein L20 [Streptomyces viridochromogenes DSM 40736]
 gi|302467868|gb|EFL30961.1| ribosomal protein L20 [Streptomyces viridochromogenes DSM 40736]
          Length = 127

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 76/123 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A + +DRK+L++LA+    +F  +VE+++  L  D
Sbjct: 61  WIQRINAAARANGMTYNRFIQGLKAANVEVDRKILAELAVNDAGAFAALVEVAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|70729484|ref|YP_259222.1| 50S ribosomal protein L20 [Pseudomonas fluorescens Pf-5]
 gi|7674209|sp|Q9X6E8|RL20_PSEFL RecName: Full=50S ribosomal protein L20
 gi|109893136|sp|Q4KEW1|RL20_PSEF5 RecName: Full=50S ribosomal protein L20
 gi|4972786|gb|AAD34789.1|AF136400_3 ribosomal protein L20 [Pseudomonas fluorescens]
 gi|68343783|gb|AAY91389.1| ribosomal protein L20 [Pseudomonas fluorescens Pf-5]
          Length = 118

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARNNGLSYSRLIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKATLA 118


>gi|282864274|ref|ZP_06273330.1| ribosomal protein L20 [Streptomyces sp. ACTE]
 gi|282560761|gb|EFB66307.1| ribosomal protein L20 [Streptomyces sp. ACTE]
          Length = 127

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEAASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DRK+L++LA+   ++F  +VE+++  L  D
Sbjct: 61  WIQRINAAARQNGMTYNRLIQGLKAANIEVDRKMLAELAVNDANAFAALVEVAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|15924668|ref|NP_372202.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15927257|ref|NP_374790.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21283351|ref|NP_646439.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MW2]
 gi|49483921|ref|YP_041145.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49486505|ref|YP_043726.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57650550|ref|YP_186563.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus COL]
 gi|82751267|ref|YP_417008.1| 50S ribosomal protein L20 [Staphylococcus aureus RF122]
 gi|87162399|ref|YP_494320.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88195485|ref|YP_500289.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|148268159|ref|YP_001247102.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus JH9]
 gi|150394226|ref|YP_001316901.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus JH1]
 gi|151221784|ref|YP_001332606.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156979996|ref|YP_001442255.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus Mu3]
 gi|221142571|ref|ZP_03567064.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253732330|ref|ZP_04866495.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253734537|ref|ZP_04868702.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255006463|ref|ZP_05145064.2| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257425794|ref|ZP_05602218.1| LSU ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428460|ref|ZP_05604858.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257431094|ref|ZP_05607471.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257433777|ref|ZP_05610135.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus E1410]
 gi|257436693|ref|ZP_05612737.1| LSU ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257794064|ref|ZP_05643043.1| 50S ribosomal protein L20 [Staphylococcus aureus A9781]
 gi|258415768|ref|ZP_05682039.1| 50S ribosomal protein L20 [Staphylococcus aureus A9763]
 gi|258421995|ref|ZP_05684915.1| LSU ribosomal protein L20 [Staphylococcus aureus A9719]
 gi|258424095|ref|ZP_05686977.1| LSU ribosomal protein L20 [Staphylococcus aureus A9635]
 gi|258438247|ref|ZP_05689531.1| 50S ribosomal protein L20 [Staphylococcus aureus A9299]
 gi|258443705|ref|ZP_05692044.1| LSU ribosomal protein L20P [Staphylococcus aureus A8115]
 gi|258445916|ref|ZP_05694092.1| LSU ribosomal protein L20P [Staphylococcus aureus A6300]
 gi|258448403|ref|ZP_05696520.1| 50S ribosomal protein L20 [Staphylococcus aureus A6224]
 gi|258451807|ref|ZP_05699829.1| ribosomal protein L20 [Staphylococcus aureus A5948]
 gi|258454295|ref|ZP_05702264.1| ribosomal protein L20 [Staphylococcus aureus A5937]
 gi|262048653|ref|ZP_06021536.1| 50S ribosomal protein L20 [Staphylococcus aureus D30]
 gi|262052250|ref|ZP_06024455.1| 50S ribosomal protein L20 [Staphylococcus aureus 930918-3]
 gi|269203297|ref|YP_003282566.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282893174|ref|ZP_06301408.1| 50S ribosomal protein L20 [Staphylococcus aureus A8117]
 gi|282904250|ref|ZP_06312138.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus C160]
 gi|282906075|ref|ZP_06313930.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908990|ref|ZP_06316808.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282911306|ref|ZP_06319108.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914475|ref|ZP_06322261.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus M899]
 gi|282916938|ref|ZP_06324696.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282919444|ref|ZP_06327179.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282920219|ref|ZP_06327944.1| 50S ribosomal protein L20 [Staphylococcus aureus A9765]
 gi|282924821|ref|ZP_06332487.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           C101]
 gi|283770743|ref|ZP_06343635.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus H19]
 gi|283958430|ref|ZP_06375881.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|284024727|ref|ZP_06379125.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus 132]
 gi|293503553|ref|ZP_06667400.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510568|ref|ZP_06669273.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293537110|ref|ZP_06671790.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus M1015]
 gi|294848700|ref|ZP_06789446.1| 50S ribosomal protein L20 [Staphylococcus aureus A9754]
 gi|295405989|ref|ZP_06815797.1| 50S ribosomal protein L20 [Staphylococcus aureus A8819]
 gi|295428250|ref|ZP_06820879.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296274894|ref|ZP_06857401.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MR1]
 gi|297207608|ref|ZP_06924043.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245085|ref|ZP_06928962.1| 50S ribosomal protein L20 [Staphylococcus aureus A8796]
 gi|297590787|ref|ZP_06949425.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MN8]
 gi|300911690|ref|ZP_07129134.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304380730|ref|ZP_07363399.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|54039127|sp|P66108|RL20_STAAN RecName: Full=50S ribosomal protein L20
 gi|54039128|sp|P66109|RL20_STAAW RecName: Full=50S ribosomal protein L20
 gi|54041831|sp|P66107|RL20_STAAM RecName: Full=50S ribosomal protein L20
 gi|60390418|sp|Q6G8P7|RL20_STAAS RecName: Full=50S ribosomal protein L20
 gi|60390432|sp|Q6GG27|RL20_STAAR RecName: Full=50S ribosomal protein L20
 gi|73914081|sp|Q5HF94|RL20_STAAC RecName: Full=50S ribosomal protein L20
 gi|109893155|sp|Q2FG58|RL20_STAA3 RecName: Full=50S ribosomal protein L20
 gi|109893156|sp|Q2YTB1|RL20_STAAB RecName: Full=50S ribosomal protein L20
 gi|122539333|sp|Q2FXQ1|RL20_STAA8 RecName: Full=50S ribosomal protein L20
 gi|166220789|sp|A7X3A1|RL20_STAA1 RecName: Full=50S ribosomal protein L20
 gi|172048938|sp|A6QHL2|RL20_STAAE RecName: Full=50S ribosomal protein L20
 gi|189041890|sp|A6U2E6|RL20_STAA2 RecName: Full=50S ribosomal protein L20
 gi|189041891|sp|A5ITK3|RL20_STAA9 RecName: Full=50S ribosomal protein L20
 gi|13701475|dbj|BAB42769.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247450|dbj|BAB57840.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21204791|dbj|BAB95487.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MW2]
 gi|49242050|emb|CAG40749.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49244948|emb|CAG43409.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57284736|gb|AAW36830.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus COL]
 gi|82656798|emb|CAI81227.1| 50S ribosomal protein L20 [Staphylococcus aureus RF122]
 gi|87128373|gb|ABD22887.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87203043|gb|ABD30853.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|147741228|gb|ABQ49526.1| LSU ribosomal protein L20P [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149946678|gb|ABR52614.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus JH1]
 gi|150374584|dbj|BAF67844.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|156722131|dbj|BAF78548.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus Mu3]
 gi|253723930|gb|EES92659.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253727478|gb|EES96207.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257271488|gb|EEV03634.1| LSU ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275301|gb|EEV06788.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278042|gb|EEV08690.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 68-397]
 gi|257281870|gb|EEV12007.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus E1410]
 gi|257284044|gb|EEV14167.1| LSU ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           M876]
 gi|257788036|gb|EEV26376.1| 50S ribosomal protein L20 [Staphylococcus aureus A9781]
 gi|257839361|gb|EEV63834.1| 50S ribosomal protein L20 [Staphylococcus aureus A9763]
 gi|257842039|gb|EEV66468.1| LSU ribosomal protein L20 [Staphylococcus aureus A9719]
 gi|257845716|gb|EEV69748.1| LSU ribosomal protein L20 [Staphylococcus aureus A9635]
 gi|257848291|gb|EEV72282.1| 50S ribosomal protein L20 [Staphylococcus aureus A9299]
 gi|257851111|gb|EEV75054.1| LSU ribosomal protein L20P [Staphylococcus aureus A8115]
 gi|257855158|gb|EEV78097.1| LSU ribosomal protein L20P [Staphylococcus aureus A6300]
 gi|257858371|gb|EEV81256.1| 50S ribosomal protein L20 [Staphylococcus aureus A6224]
 gi|257860519|gb|EEV83345.1| ribosomal protein L20 [Staphylococcus aureus A5948]
 gi|257863525|gb|EEV86284.1| ribosomal protein L20 [Staphylococcus aureus A5937]
 gi|259159851|gb|EEW44890.1| 50S ribosomal protein L20 [Staphylococcus aureus 930918-3]
 gi|259163300|gb|EEW47859.1| 50S ribosomal protein L20 [Staphylococcus aureus D30]
 gi|262075587|gb|ACY11560.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269941159|emb|CBI49546.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282313187|gb|EFB43583.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317254|gb|EFB47628.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282319425|gb|EFB49777.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282321656|gb|EFB51981.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus M899]
 gi|282325001|gb|EFB55311.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327254|gb|EFB57549.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331367|gb|EFB60881.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282594567|gb|EFB99552.1| 50S ribosomal protein L20 [Staphylococcus aureus A9765]
 gi|282595868|gb|EFC00832.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus C160]
 gi|282764492|gb|EFC04618.1| 50S ribosomal protein L20 [Staphylococcus aureus A8117]
 gi|283460890|gb|EFC07980.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus H19]
 gi|283470946|emb|CAQ50157.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus ST398]
 gi|283790579|gb|EFC29396.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|285817362|gb|ADC37849.1| 50S ribosomal protein L20 [Staphylococcus aureus 04-02981]
 gi|290919955|gb|EFD97023.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus M1015]
 gi|291095219|gb|EFE25484.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466459|gb|EFF08980.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           M809]
 gi|294824726|gb|EFG41149.1| 50S ribosomal protein L20 [Staphylococcus aureus A9754]
 gi|294968986|gb|EFG45007.1| 50S ribosomal protein L20 [Staphylococcus aureus A8819]
 gi|295127650|gb|EFG57287.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296887625|gb|EFH26523.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297178165|gb|EFH37413.1| 50S ribosomal protein L20 [Staphylococcus aureus A8796]
 gi|297575673|gb|EFH94389.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus MN8]
 gi|298694949|gb|ADI98171.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300887111|gb|EFK82312.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302333344|gb|ADL23537.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302751505|gb|ADL65682.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus str.
           JKD6008]
 gi|304340729|gb|EFM06660.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312437863|gb|ADQ76934.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|312830057|emb|CBX34899.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus ECT-R 2]
 gi|315130688|gb|EFT86674.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315195583|gb|EFU25970.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198625|gb|EFU28953.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320140443|gb|EFW32297.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus MRSA131]
 gi|320143981|gb|EFW35750.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus MRSA177]
 gi|323440777|gb|EGA98486.1| 50S ribosomal protein L20 [Staphylococcus aureus O11]
 gi|323442932|gb|EGB00555.1| 50S ribosomal protein L20 [Staphylococcus aureus O46]
 gi|329314351|gb|AEB88764.1| 50S ribosomal protein L20 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727404|gb|EGG63860.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 21172]
 gi|329728363|gb|EGG64800.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 21189]
 gi|329733269|gb|EGG69606.1| ribosomal protein L20 [Staphylococcus aureus subsp. aureus 21193]
          Length = 118

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R ++++YS+ +NGL KAGI ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDAL 117


>gi|182439700|ref|YP_001827419.1| 50S ribosomal protein L20 [Streptomyces griseus subsp. griseus NBRC
           13350]
 gi|239940055|ref|ZP_04691992.1| 50S ribosomal protein L20 [Streptomyces roseosporus NRRL 15998]
 gi|239986544|ref|ZP_04707208.1| 50S ribosomal protein L20 [Streptomyces roseosporus NRRL 11379]
 gi|291443484|ref|ZP_06582874.1| ribosomal protein L20 [Streptomyces roseosporus NRRL 15998]
 gi|326780364|ref|ZP_08239629.1| 50S ribosomal protein L20 [Streptomyces cf. griseus XylebKG-1]
 gi|226730457|sp|B1W354|RL20_STRGG RecName: Full=50S ribosomal protein L20
 gi|62896306|emb|CAH94292.1| ribosomal protein L20 [Streptomyces griseus subsp. griseus]
 gi|178468216|dbj|BAG22736.1| putative ribosomal protein L20 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|291346431|gb|EFE73335.1| ribosomal protein L20 [Streptomyces roseosporus NRRL 15998]
 gi|320011787|gb|ADW06637.1| ribosomal protein L20 [Streptomyces flavogriseus ATCC 33331]
 gi|326660697|gb|EGE45543.1| 50S ribosomal protein L20 [Streptomyces cf. griseus XylebKG-1]
          Length = 127

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEAASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DRK+L++LA+   ++F  +VE+++  L  D
Sbjct: 61  WIQRINAAARQNGMTYNRLIQGLKAANIEVDRKILAELAVNDANAFAALVEVAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|332670158|ref|YP_004453166.1| 50S ribosomal protein L20 [Cellulomonas fimi ATCC 484]
 gi|332339196|gb|AEE45779.1| ribosomal protein L20 [Cellulomonas fimi ATCC 484]
          Length = 127

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  YAYRDR+V+K+DFR L
Sbjct: 1   MARVKRAVNAQKKRRATLERASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKVRKQDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL  AG+ +DR+VL+DLA+    +F  +V++++  L  D
Sbjct: 61  WIQRINAASREQGLTYNRLIQGLKLAGVEVDRRVLADLAVNDAPAFAALVQVAKDALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|160900045|ref|YP_001565627.1| 50S ribosomal protein L20 [Delftia acidovorans SPH-1]
 gi|226730386|sp|A9C3D1|RL20_DELAS RecName: Full=50S ribosomal protein L20
 gi|160365629|gb|ABX37242.1| ribosomal protein L20 [Delftia acidovorans SPH-1]
          Length = 119

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  +KGF GRR N  R AK AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALSKGFRGRRGNVFRIAKQAVMKAGQYAYRDRRAKKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YSQF NGL KA I +DRK+L+D+A+    +F  IV+  +++L  
Sbjct: 61  WIARINAAARELGLTYSQFANGLKKAAIEIDRKMLADIAVHDKAAFSSIVDQVKAKLAA 119


>gi|306843539|ref|ZP_07476140.1| ribosomal protein L20 [Brucella sp. BO1]
 gi|306276230|gb|EFM57930.1| ribosomal protein L20 [Brucella sp. BO1]
          Length = 134

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 92/118 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL  A GF GRRKNTIR AKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLDQAAGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVREQGLTYGRFIDGLAKAGIEIDRKVLSDIAIHEPEAFTALVASAKKALE 118


>gi|24379170|ref|NP_721125.1| 50S ribosomal protein L20 [Streptococcus mutans UA159]
 gi|290580826|ref|YP_003485218.1| 50S ribosomal protein L20 [Streptococcus mutans NN2025]
 gi|31563128|sp|Q8DV20|RL20_STRMU RecName: Full=50S ribosomal protein L20
 gi|24377078|gb|AAN58431.1|AE014913_8 50S ribosomal protein L20 [Streptococcus mutans UA159]
 gi|254997725|dbj|BAH88326.1| 50S ribosomal protein L20 [Streptococcus mutans NN2025]
          Length = 119

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR +KRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ ++GL  A + ++RK+L+DLA+    +F  + + ++ +L
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEVEVNRKMLADLAVNDAAAFTVLADAAKEKL 117


>gi|33593558|ref|NP_881202.1| 50S ribosomal protein L20 [Bordetella pertussis Tohama I]
 gi|33597178|ref|NP_884821.1| 50S ribosomal protein L20 [Bordetella parapertussis 12822]
 gi|33601022|ref|NP_888582.1| 50S ribosomal protein L20 [Bordetella bronchiseptica RB50]
 gi|39931822|sp|Q7VVR3|RL20_BORPE RecName: Full=50S ribosomal protein L20
 gi|39931837|sp|Q7W7C8|RL20_BORPA RecName: Full=50S ribosomal protein L20
 gi|39931856|sp|Q7WKR6|RL20_BORBR RecName: Full=50S ribosomal protein L20
 gi|33572914|emb|CAE42850.1| 50s ribosomal protein [Bordetella pertussis Tohama I]
 gi|33573605|emb|CAE37889.1| 50s ribosomal protein [Bordetella parapertussis]
 gi|33575457|emb|CAE32535.1| 50s ribosomal protein [Bordetella bronchiseptica RB50]
 gi|332382965|gb|AEE67812.1| 50S ribosomal protein L20 [Bordetella pertussis CS]
          Length = 119

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+ +AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAAAKGYRGRRGNVFRIAKQAVMRAGQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAAVR   ++YS FI GL KA I LDRKVL+DLA+     F  IV+ +++ L  
Sbjct: 61  WITRINAAVREQGMSYSVFIAGLKKAAIELDRKVLADLAVRDKAGFAAIVQQAKAALAA 119


>gi|229916376|ref|YP_002885022.1| 50S ribosomal protein L20 [Exiguobacterium sp. AT1b]
 gi|229467805|gb|ACQ69577.1| ribosomal protein L20 [Exiguobacterium sp. AT1b]
          Length = 119

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 56/119 (47%), Positives = 79/119 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KK +K AKG++G +    + AK  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGYTTRQRRKKQIKLAKGYFGSKHILFKVAKQQVMKSLMYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+ ++GL  AGI ++RK+L++LA+T   +F  + E ++S+L  
Sbjct: 61  WITRINAAARTNGLSYSRMMHGLKLAGIDINRKMLAELAVTDAQAFASLAETAKSKLNA 119


>gi|92113925|ref|YP_573853.1| 50S ribosomal protein L20 [Chromohalobacter salexigens DSM 3043]
 gi|122419926|sp|Q1QWK4|RL20_CHRSD RecName: Full=50S ribosomal protein L20
 gi|91797015|gb|ABE59154.1| LSU ribosomal protein L20P [Chromohalobacter salexigens DSM 3043]
          Length = 117

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 67/116 (57%), Positives = 87/116 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MTRVKRGVVARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   L+YS+FI GL K+GI +DRKVL+DLA+ +  +F  IV+ +++ 
Sbjct: 61  WITRINAASRANGLSYSRFIAGLKKSGIEIDRKVLADLAVHEKAAFAAIVDKAKAA 116


>gi|251772031|gb|EES52603.1| ribosomal protein L20 [Leptospirillum ferrodiazotrophum]
          Length = 117

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 77/116 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  + A+ KK+L  AKG++G R    R+A+  V++   YAYRDR+  KR FR L
Sbjct: 1   MPRVKGGPQTRARRKKILDLAKGYWGGRSRLYRSARHTVEKGLTYAYRDRKANKRQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WIQRINAA R   ++YS+ I+GL K GI LDRK+L+DLA+ Q   F  ++E  ++ 
Sbjct: 61  WIQRINAACRPQGISYSRLISGLKKLGIGLDRKILADLALNQPAVFSDLLEKVKAA 116


>gi|26989191|ref|NP_744616.1| 50S ribosomal protein L20 [Pseudomonas putida KT2440]
 gi|104781109|ref|YP_607607.1| 50S ribosomal protein L20 [Pseudomonas entomophila L48]
 gi|148548430|ref|YP_001268532.1| 50S ribosomal protein L20 [Pseudomonas putida F1]
 gi|167034474|ref|YP_001669705.1| 50S ribosomal protein L20 [Pseudomonas putida GB-1]
 gi|170721154|ref|YP_001748842.1| 50S ribosomal protein L20 [Pseudomonas putida W619]
 gi|325276809|ref|ZP_08142510.1| 50S ribosomal protein L20 [Pseudomonas sp. TJI-51]
 gi|31563090|sp|Q88K24|RL20_PSEPK RecName: Full=50S ribosomal protein L20
 gi|122403809|sp|Q1IC12|RL20_PSEE4 RecName: Full=50S ribosomal protein L20
 gi|166220729|sp|A5W5D8|RL20_PSEP1 RecName: Full=50S ribosomal protein L20
 gi|189041877|sp|B0KKR5|RL20_PSEPG RecName: Full=50S ribosomal protein L20
 gi|226730439|sp|B1J6U7|RL20_PSEPW RecName: Full=50S ribosomal protein L20
 gi|24984030|gb|AAN68080.1|AE016439_15 ribosomal protein L20 [Pseudomonas putida KT2440]
 gi|95110096|emb|CAK14801.1| 50S ribosomal protein L20, also posttranslational autoregulator
           [Pseudomonas entomophila L48]
 gi|148512488|gb|ABQ79348.1| LSU ribosomal protein L20P [Pseudomonas putida F1]
 gi|166860962|gb|ABY99369.1| ribosomal protein L20 [Pseudomonas putida GB-1]
 gi|169759157|gb|ACA72473.1| ribosomal protein L20 [Pseudomonas putida W619]
 gi|313499443|gb|ADR60809.1| RplT [Pseudomonas putida BIRD-1]
 gi|324098047|gb|EGB96192.1| 50S ribosomal protein L20 [Pseudomonas sp. TJI-51]
          Length = 118

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARTNGLSYSRLIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKAVLA 118


>gi|114568683|ref|YP_755363.1| 50S ribosomal protein L20P [Maricaulis maris MCS10]
 gi|122316992|sp|Q0ATG2|RL20_MARMM RecName: Full=50S ribosomal protein L20
 gi|114339145|gb|ABI64425.1| LSU ribosomal protein L20P [Maricaulis maris MCS10]
          Length = 118

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RV  G  ++ +HK V+K AKG+YGRRKNT R A  AV+++ QYAYRDRR KKR+FR+L
Sbjct: 1   MSRVTSGPATAKRHKSVIKKAKGYYGRRKNTFRVAVQAVEKAGQYAYRDRRAKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA  R ++++YS F+NGL KAGI +DRKVL+D+A+ + D+FK +V+ +R+ L
Sbjct: 61  WIQRINAGARQHEMSYSVFMNGLTKAGIEVDRKVLADIAMHEPDAFKALVDQARAAL 117


>gi|88859307|ref|ZP_01133947.1| 50S ribosomal protein L20 [Pseudoalteromonas tunicata D2]
 gi|88818324|gb|EAR28139.1| 50S ribosomal protein L20 [Pseudoalteromonas tunicata D2]
          Length = 119

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRAKKRTFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+FINGL K  + +DRK+L+D+A+    +F  +V  ++  +  
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKTSVEIDRKILADIAVYDQVAFAALVAKAKEGIAA 119


>gi|159042787|ref|YP_001531581.1| 50S ribosomal protein L20 [Dinoroseobacter shibae DFL 12]
 gi|189041861|sp|A8LLH0|RL20_DINSH RecName: Full=50S ribosomal protein L20
 gi|157910547|gb|ABV91980.1| 50S ribosomal protein L20 [Dinoroseobacter shibae DFL 12]
          Length = 121

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 93/121 (76%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K G V+ A+HKKV  +AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR FR+L
Sbjct: 1   MSRTKGGTVTHARHKKVTDAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRQFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ +++ L 
Sbjct: 61  WIQRINAAVRAHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPEAFSAIVDQAKAALP 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|308049560|ref|YP_003913126.1| 50S ribosomal protein L20P [Ferrimonas balearica DSM 9799]
 gi|307631750|gb|ADN76052.1| LSU ribosomal protein L20P [Ferrimonas balearica DSM 9799]
          Length = 119

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVTARARHKKVLKQAKGYYGARSRIYRVAFQAVTKAGQYAYRDRRAKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+     F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASVEIDRKILADIAVFDKVVFAALVEKAKEALA 118


>gi|257069325|ref|YP_003155580.1| 50S ribosomal protein L20P [Brachybacterium faecium DSM 4810]
 gi|256560143|gb|ACU85990.1| LSU ribosomal protein L20P [Brachybacterium faecium DSM 4810]
          Length = 126

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++L+ A G+ G+R    R AK  V  SQ Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRREILEQASGYRGQRSRLYRKAKEQVLHSQTYNFRDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  AG+ +DR++L++LA+    +F  +VE++++ L  D
Sbjct: 61  WIQRINAAARANGMTYNRFIQGLGLAGVEVDRRMLAELAVNDAPAFAALVEVAKNALPKD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|153955808|ref|YP_001396573.1| 50S ribosomal protein L20 [Clostridium kluyveri DSM 555]
 gi|219856175|ref|YP_002473297.1| hypothetical protein CKR_2832 [Clostridium kluyveri NBRC 12016]
 gi|189041856|sp|A5N256|RL20_CLOK5 RecName: Full=50S ribosomal protein L20
 gi|254800313|sp|B9E5V8|RL20_CLOK1 RecName: Full=50S ribosomal protein L20
 gi|146348666|gb|EDK35202.1| RplT [Clostridium kluyveri DSM 555]
 gi|219569899|dbj|BAH07883.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 119

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   H+K+LK AKG+YG +    + A  +V R+ + AY  R++KKRDFR L
Sbjct: 1   MARVKRAVNARKHHRKILKLAKGYYGGKSKLFKTANESVIRALRNAYVGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NG+  AGI ++RK+LS++AI    +F ++V++++++L
Sbjct: 61  WIVRINAAARINGLSYSKFMNGIKTAGININRKMLSEIAINDPKTFTELVQVAKAQL 117


>gi|33301639|sp|Q84BL4|RL20_VIBAN RecName: Full=50S ribosomal protein L20
 gi|28866933|gb|AAM95156.1| large subunit ribosomal protein L20 [Listonella anguillarum]
          Length = 117

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYR RR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRARRTKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFAVLVEKAKTAL 117


>gi|227497643|ref|ZP_03927861.1| 50S ribosomal protein L20 [Actinomyces urogenitalis DSM 15434]
 gi|226832914|gb|EEH65297.1| 50S ribosomal protein L20 [Actinomyces urogenitalis DSM 15434]
          Length = 126

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YA+RDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEKASGYRGQRSRLYRKAKEQVTHSGVYAFRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +   FK +VE+++  L  D
Sbjct: 61  WIQRINAAARAEGLTYNRFIQGLGLAGVEIDRRMLAELAVNEPAGFKALVEVAKKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|162447699|ref|YP_001620831.1| 50S ribosomal protein L20 [Acholeplasma laidlawii PG-8A]
 gi|189041847|sp|A9NGH5|RL20_ACHLI RecName: Full=50S ribosomal protein L20
 gi|161985806|gb|ABX81455.1| large subunit ribosomal protein L20 [Acholeplasma laidlawii PG-8A]
          Length = 126

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 73/118 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK   V+  + KK+LK AKG++G +    R A   V R+ QYAYRDR+  KR+FR L
Sbjct: 1   MARVKNTPVTRRRRKKILKLAKGYFGSKSTLYRTAHEQVMRALQYAYRDRKQNKRNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA        YS+ I+GL  A + L+RKVL+DLAI++   F   VEL++  + 
Sbjct: 61  WISRINAGAVQNGFKYSKLIHGLSLANVQLNRKVLADLAISEPTVFASYVELAKDAIA 118


>gi|125973738|ref|YP_001037648.1| 50S ribosomal protein L20P [Clostridium thermocellum ATCC 27405]
 gi|256005540|ref|ZP_05430501.1| ribosomal protein L20 [Clostridium thermocellum DSM 2360]
 gi|281417894|ref|ZP_06248914.1| ribosomal protein L20 [Clostridium thermocellum JW20]
 gi|166219636|sp|A3DES6|RL20_CLOTH RecName: Full=50S ribosomal protein L20
 gi|125713963|gb|ABN52455.1| LSU ribosomal protein L20P [Clostridium thermocellum ATCC 27405]
 gi|255990520|gb|EEU00641.1| ribosomal protein L20 [Clostridium thermocellum DSM 2360]
 gi|281409296|gb|EFB39554.1| ribosomal protein L20 [Clostridium thermocellum JW20]
 gi|316940068|gb|ADU74102.1| ribosomal protein L20 [Clostridium thermocellum DSM 1313]
          Length = 117

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 86/115 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GV + A+HKK+LK AKG++G +    R A  AV +S  YAYRDRR +KRDFR L
Sbjct: 1   MSRVKGGVRTRARHKKILKLAKGYFGAKSKNFRIANQAVMKSLVYAYRDRRARKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+  L+YS+F+NGL K+GI L+RK+L+++A+   ++F ++VE  ++
Sbjct: 61  WITRINAAARMNGLSYSKFMNGLKKSGIALNRKMLAEMAVNDAEAFAQLVEKVKA 115


>gi|16800961|ref|NP_471229.1| 50S ribosomal protein L20 [Listeria innocua Clip11262]
 gi|16803823|ref|NP_465308.1| 50S ribosomal protein L20 [Listeria monocytogenes EGD-e]
 gi|46908013|ref|YP_014402.1| 50S ribosomal protein L20 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47094152|ref|ZP_00231872.1| ribosomal protein L20 [Listeria monocytogenes str. 4b H7858]
 gi|47097523|ref|ZP_00235062.1| ribosomal protein L20 [Listeria monocytogenes str. 1/2a F6854]
 gi|116873220|ref|YP_850001.1| 50S ribosomal protein L20 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217964069|ref|YP_002349747.1| ribosomal protein L20 [Listeria monocytogenes HCC23]
 gi|224500777|ref|ZP_03669126.1| 50S ribosomal protein L20 [Listeria monocytogenes Finland 1988]
 gi|224503786|ref|ZP_03672093.1| 50S ribosomal protein L20 [Listeria monocytogenes FSL R2-561]
 gi|226224386|ref|YP_002758493.1| ribosomal protein L20 [Listeria monocytogenes Clip81459]
 gi|254826391|ref|ZP_05231392.1| rplT [Listeria monocytogenes FSL J1-194]
 gi|254829587|ref|ZP_05234274.1| rplT [Listeria monocytogenes FSL N3-165]
 gi|254832538|ref|ZP_05237193.1| 50S ribosomal protein L20 [Listeria monocytogenes 10403S]
 gi|254854528|ref|ZP_05243876.1| rplT [Listeria monocytogenes FSL R2-503]
 gi|254901190|ref|ZP_05261114.1| 50S ribosomal protein L20 [Listeria monocytogenes J0161]
 gi|254914077|ref|ZP_05264089.1| 50S ribosomal protein L20 [Listeria monocytogenes J2818]
 gi|254933632|ref|ZP_05266991.1| ribosomal protein L20 [Listeria monocytogenes HPB2262]
 gi|254938391|ref|ZP_05270088.1| 50S ribosomal protein L20 [Listeria monocytogenes F6900]
 gi|255026969|ref|ZP_05298955.1| 50S ribosomal protein L20 [Listeria monocytogenes FSL J2-003]
 gi|255028317|ref|ZP_05300268.1| 50S ribosomal protein L20 [Listeria monocytogenes LO28]
 gi|255521085|ref|ZP_05388322.1| 50S ribosomal protein L20 [Listeria monocytogenes FSL J1-175]
 gi|284802227|ref|YP_003414092.1| 50S ribosomal protein L20 [Listeria monocytogenes 08-5578]
 gi|284995369|ref|YP_003417137.1| 50S ribosomal protein L20 [Listeria monocytogenes 08-5923]
 gi|289435123|ref|YP_003464995.1| 50S ribosomal protein L20 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290893089|ref|ZP_06556078.1| ribosomal protein L20 [Listeria monocytogenes FSL J2-071]
 gi|300766429|ref|ZP_07076384.1| ribosomal protein L20 [Listeria monocytogenes FSL N1-017]
 gi|315282773|ref|ZP_07871103.1| ribosomal protein L20 [Listeria marthii FSL S4-120]
 gi|315303672|ref|ZP_07874197.1| ribosomal protein L20 [Listeria ivanovii FSL F6-596]
 gi|54039125|sp|P66104|RL20_LISIN RecName: Full=50S ribosomal protein L20
 gi|54041829|sp|P66103|RL20_LISMO RecName: Full=50S ribosomal protein L20
 gi|60390487|sp|Q71YN5|RL20_LISMF RecName: Full=50S ribosomal protein L20
 gi|16411237|emb|CAC99861.1| ribosomal protein L20 [Listeria monocytogenes EGD-e]
 gi|16414396|emb|CAC97125.1| ribosomal protein L20 [Listeria innocua Clip11262]
 gi|46881283|gb|AAT04579.1| ribosomal protein L20 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47014106|gb|EAL05100.1| ribosomal protein L20 [Listeria monocytogenes str. 1/2a F6854]
 gi|47017477|gb|EAL08290.1| ribosomal protein L20 [Listeria monocytogenes str. 4b H7858]
 gi|116742098|emb|CAK21222.1| 50S ribosomal protein L20 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217333339|gb|ACK39133.1| ribosomal protein L20 [Listeria monocytogenes HCC23]
 gi|225876848|emb|CAS05557.1| ribosomal protein L20 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258602004|gb|EEW15329.1| rplT [Listeria monocytogenes FSL N3-165]
 gi|258607928|gb|EEW20536.1| rplT [Listeria monocytogenes FSL R2-503]
 gi|258611003|gb|EEW23611.1| 50S ribosomal protein L20 [Listeria monocytogenes F6900]
 gi|284057789|gb|ADB68730.1| 50S ribosomal protein L20 [Listeria monocytogenes 08-5578]
 gi|284060836|gb|ADB71775.1| 50S ribosomal protein L20 [Listeria monocytogenes 08-5923]
 gi|289171367|emb|CBH27909.1| 50S ribosomal protein L20 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290557449|gb|EFD90974.1| ribosomal protein L20 [Listeria monocytogenes FSL J2-071]
 gi|293585195|gb|EFF97227.1| ribosomal protein L20 [Listeria monocytogenes HPB2262]
 gi|293592097|gb|EFG00432.1| 50S ribosomal protein L20 [Listeria monocytogenes J2818]
 gi|293595631|gb|EFG03392.1| rplT [Listeria monocytogenes FSL J1-194]
 gi|300512853|gb|EFK39945.1| ribosomal protein L20 [Listeria monocytogenes FSL N1-017]
 gi|307571363|emb|CAR84542.1| rplT [Listeria monocytogenes L99]
 gi|313608205|gb|EFR84230.1| ribosomal protein L20 [Listeria monocytogenes FSL F2-208]
 gi|313613577|gb|EFR87391.1| ribosomal protein L20 [Listeria marthii FSL S4-120]
 gi|313618351|gb|EFR90387.1| ribosomal protein L20 [Listeria innocua FSL S4-378]
 gi|313623314|gb|EFR93546.1| ribosomal protein L20 [Listeria innocua FSL J1-023]
 gi|313627962|gb|EFR96570.1| ribosomal protein L20 [Listeria ivanovii FSL F6-596]
 gi|313632795|gb|EFR99751.1| ribosomal protein L20 [Listeria seeligeri FSL N1-067]
 gi|313637376|gb|EFS02854.1| ribosomal protein L20 [Listeria seeligeri FSL S4-171]
 gi|328466426|gb|EGF37574.1| 50S ribosomal protein L20 [Listeria monocytogenes 1816]
 gi|328473850|gb|EGF44680.1| 50S ribosomal protein L20 [Listeria monocytogenes 220]
 gi|332312223|gb|EGJ25318.1| 50S ribosomal protein L20 [Listeria monocytogenes str. Scott A]
          Length = 119

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK++K AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKIVKLAKGYYGSKHLLFKVANQAVMKSYQYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ DL+YS+ ++GL  AGI ++RK+L+DLA+  + SF  + + ++  L 
Sbjct: 61  WIARINAAARMQDLSYSKLMHGLKLAGIDINRKMLADLAVNDIASFNTLADSAKKALA 118


>gi|205374570|ref|ZP_03227366.1| 50S ribosomal protein L20 [Bacillus coahuilensis m4-4]
          Length = 119

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 82/116 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG++G +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVIKLAKGYFGSKHTLYKVANQAVMKSGQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L++LAI    +F ++ E ++++
Sbjct: 61  WIARINAAARMNGLSYSRLMHGLKLAGIEVNRKMLAELAIADEKAFAQLAETAKAQ 116


>gi|83594851|ref|YP_428603.1| 50S ribosomal protein L20 [Rhodospirillum rubrum ATCC 11170]
 gi|109893146|sp|Q2RNH9|RL20_RHORT RecName: Full=50S ribosomal protein L20
 gi|83577765|gb|ABC24316.1| LSU ribosomal protein L20P [Rhodospirillum rubrum ATCC 11170]
          Length = 125

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 63/121 (52%), Positives = 80/121 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R      + A+HKKVL  AKG+ GR     R A   V++  QYAYRDRR KKR+FRSL
Sbjct: 1   MSRATNAKTNHARHKKVLDLAKGYRGRNSTNFRIAIEKVEKGLQYAYRDRRAKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINA  R   L YSQFINGL +AGI LDRK+L+DLA+T+  +F  +V  +++ L   
Sbjct: 61  WIQRINAGAREQGLTYSQFINGLIRAGIELDRKILADLAVTEPAAFASLVAQAKAALDTT 120

Query: 121 V 121
            
Sbjct: 121 A 121


>gi|16125297|ref|NP_419861.1| 50S ribosomal protein L20 [Caulobacter crescentus CB15]
 gi|221234034|ref|YP_002516470.1| 50S ribosomal protein L20 [Caulobacter crescentus NA1000]
 gi|20978654|sp|Q9A9E3|RL20_CAUCR RecName: Full=50S ribosomal protein L20
 gi|254800308|sp|B8H308|RL20_CAUCN RecName: Full=50S ribosomal protein L20
 gi|13422341|gb|AAK23029.1| ribosomal protein L20 [Caulobacter crescentus CB15]
 gi|220963206|gb|ACL94562.1| LSU ribosomal protein L20P [Caulobacter crescentus NA1000]
          Length = 118

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 79/118 (66%), Positives = 93/118 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVL+ AKGFYGRRKNTIR AKAAVD++ QYAYRDR+V+KR FRSL
Sbjct: 1   MARVKRGVVAHAKHKKVLEQAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRKVRKRAFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINA  R+    YSQFI+GL  AGIV+DRKVL+D+A     +FK I +  R+ L 
Sbjct: 61  WIQRINAGARLEGFTYSQFIHGLDVAGIVMDRKVLADIAGNDPAAFKAIADKVRAALA 118


>gi|73666767|ref|YP_302783.1| 50S ribosomal protein L20 [Ehrlichia canis str. Jake]
 gi|109893113|sp|Q3YSX0|RL20_EHRCJ RecName: Full=50S ribosomal protein L20
 gi|72393908|gb|AAZ68185.1| LSU ribosomal protein L20P [Ehrlichia canis str. Jake]
          Length = 124

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 67/117 (57%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K AKG+ GR KN  R A   V+++ QYAYRDRR +KR FRSL
Sbjct: 1   MARVKRGVTTRARHKKVIKLAKGYRGRSKNCYRIALQRVEKALQYAYRDRRNRKRFFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L YS FI+GL  A I L+RKVL+D+A+   D+FK+IV++++  L
Sbjct: 61  WIMRINAAARQHGLLYSDFIHGLSLANITLNRKVLADMAVNNQDNFKQIVDITKEAL 117


>gi|319407949|emb|CBI81603.1| 50S ribosomal protein L20 [Bartonella schoenbuchensis R1]
          Length = 133

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 81/118 (68%), Positives = 95/118 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK A+GF GRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FRSL
Sbjct: 1   MARVKRGVTAHAKHKKVLKEAEGFRGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVRV  L Y +FI+GL KAGI +DRKVLSD+AI +  +F  +V  ++  L 
Sbjct: 61  WIQRINAAVRVEGLTYGRFIDGLSKAGIEIDRKVLSDIAIYEPTAFAALVVSAKKALE 118


>gi|325291692|ref|YP_004277556.1| 50S ribosomal protein L20 [Agrobacterium sp. H13-3]
 gi|325059545|gb|ADY63236.1| 50S ribosomal protein L20 [Agrobacterium sp. H13-3]
          Length = 134

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 98/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKH K LK+AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSRAKHTKTLKAAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE ++  L 
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGVLVETAKKALE 118


>gi|307325424|ref|ZP_07604626.1| ribosomal protein L20 [Streptomyces violaceusniger Tu 4113]
 gi|306888893|gb|EFN19877.1| ribosomal protein L20 [Streptomyces violaceusniger Tu 4113]
          Length = 127

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 75/123 (60%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEQASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A I +DRK+L+DLA+    +F  +VE ++  L  D
Sbjct: 61  WIQRINAAARANGMTYNRFIQGLKAANIEVDRKILADLAVNDAGAFAALVEAAQKALPSD 120

Query: 121 VAS 123
           + +
Sbjct: 121 INA 123


>gi|227548137|ref|ZP_03978186.1| 50S ribosomal protein L20 [Corynebacterium lipophiloflavum DSM
           44291]
 gi|227079799|gb|EEI17762.1| 50S ribosomal protein L20 [Corynebacterium lipophiloflavum DSM
           44291]
          Length = 128

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     SQ YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSQTYAYRDRRKRKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++ I+GL  A + +DRK+L+DLA+    +F  I E+++  L  D
Sbjct: 61  WIQRINAAARMNGITYNRLIHGLKLAEVEVDRKILADLAVNDFATFSAICEVAKKALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|254780318|ref|YP_003064731.1| ribosomal protein L20 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039995|gb|ACT56791.1| ribosomal protein L20 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 123

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 123/123 (100%), Positives = 123/123 (100%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL
Sbjct: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD
Sbjct: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120

Query: 121 VAS 123
           VAS
Sbjct: 121 VAS 123


>gi|17988290|ref|NP_540924.1| 50S ribosomal protein L20 [Brucella melitensis bv. 1 str. 16M]
 gi|23502968|ref|NP_699095.1| 50S ribosomal protein L20 [Brucella suis 1330]
 gi|62290960|ref|YP_222753.1| 50S ribosomal protein L20 [Brucella abortus bv. 1 str. 9-941]
 gi|82700871|ref|YP_415445.1| 50S ribosomal protein L20 [Brucella melitensis biovar Abortus 2308]
 gi|148559518|ref|YP_001259919.1| 50S ribosomal protein L20 [Brucella ovis ATCC 25840]
 gi|161620031|ref|YP_001593918.1| 50S ribosomal protein L20 [Brucella canis ATCC 23365]
 gi|163844136|ref|YP_001628540.1| 50S ribosomal protein L20 [Brucella suis ATCC 23445]
 gi|189025174|ref|YP_001935942.1| 50S ribosomal protein L20 [Brucella abortus S19]
 gi|225626493|ref|ZP_03784532.1| ribosomal protein L20 [Brucella ceti str. Cudo]
 gi|225853547|ref|YP_002733780.1| 50S ribosomal protein L20 [Brucella melitensis ATCC 23457]
 gi|237816465|ref|ZP_04595458.1| ribosomal protein L20 [Brucella abortus str. 2308 A]
 gi|254690255|ref|ZP_05153509.1| 50S ribosomal protein L20 [Brucella abortus bv. 6 str. 870]
 gi|254694742|ref|ZP_05156570.1| 50S ribosomal protein L20 [Brucella abortus bv. 3 str. Tulya]
 gi|254696371|ref|ZP_05158199.1| 50S ribosomal protein L20 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700752|ref|ZP_05162580.1| 50S ribosomal protein L20 [Brucella suis bv. 5 str. 513]
 gi|254705124|ref|ZP_05166952.1| 50S ribosomal protein L20 [Brucella suis bv. 3 str. 686]
 gi|254707360|ref|ZP_05169188.1| 50S ribosomal protein L20 [Brucella pinnipedialis M163/99/10]
 gi|254709097|ref|ZP_05170908.1| 50S ribosomal protein L20 [Brucella pinnipedialis B2/94]
 gi|254713477|ref|ZP_05175288.1| 50S ribosomal protein L20 [Brucella ceti M644/93/1]
 gi|254716167|ref|ZP_05177978.1| 50S ribosomal protein L20 [Brucella ceti M13/05/1]
 gi|254718163|ref|ZP_05179974.1| 50S ribosomal protein L20 [Brucella sp. 83/13]
 gi|254731285|ref|ZP_05189863.1| 50S ribosomal protein L20 [Brucella abortus bv. 4 str. 292]
 gi|256030622|ref|ZP_05444236.1| 50S ribosomal protein L20 [Brucella pinnipedialis M292/94/1]
 gi|256045725|ref|ZP_05448603.1| 50S ribosomal protein L20 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112446|ref|ZP_05453367.1| 50S ribosomal protein L20 [Brucella melitensis bv. 3 str. Ether]
 gi|256158621|ref|ZP_05456508.1| 50S ribosomal protein L20 [Brucella ceti M490/95/1]
 gi|256254029|ref|ZP_05459565.1| 50S ribosomal protein L20 [Brucella ceti B1/94]
 gi|256258508|ref|ZP_05464044.1| 50S ribosomal protein L20 [Brucella abortus bv. 9 str. C68]
 gi|256262968|ref|ZP_05465500.1| 50S ribosomal protein L20 [Brucella melitensis bv. 2 str. 63/9]
 gi|256370518|ref|YP_003108029.1| 50S ribosomal protein L20 [Brucella microti CCM 4915]
 gi|260169527|ref|ZP_05756338.1| 50S ribosomal protein L20 [Brucella sp. F5/99]
 gi|260546224|ref|ZP_05821964.1| ribosomal protein L20 [Brucella abortus NCTC 8038]
 gi|260563024|ref|ZP_05833510.1| ribosomal protein L20 [Brucella melitensis bv. 1 str. 16M]
 gi|260567409|ref|ZP_05837879.1| ribosomal protein L20 [Brucella suis bv. 4 str. 40]
 gi|260755794|ref|ZP_05868142.1| 50S ribosomal protein L20 [Brucella abortus bv. 6 str. 870]
 gi|260759017|ref|ZP_05871365.1| 50S ribosomal protein L20 [Brucella abortus bv. 4 str. 292]
 gi|260760742|ref|ZP_05873085.1| 50S ribosomal protein L20 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884818|ref|ZP_05896432.1| 50S ribosomal protein L20 [Brucella abortus bv. 9 str. C68]
 gi|261215069|ref|ZP_05929350.1| 50S ribosomal protein L20 [Brucella abortus bv. 3 str. Tulya]
 gi|261217939|ref|ZP_05932220.1| 50S ribosomal protein L20 [Brucella ceti M13/05/1]
 gi|261221168|ref|ZP_05935449.1| 50S ribosomal protein L20 [Brucella ceti B1/94]
 gi|261314845|ref|ZP_05954042.1| 50S ribosomal protein L20 [Brucella pinnipedialis M163/99/10]
 gi|261316596|ref|ZP_05955793.1| 50S ribosomal protein L20 [Brucella pinnipedialis B2/94]
 gi|261321211|ref|ZP_05960408.1| 50S ribosomal protein L20 [Brucella ceti M644/93/1]
 gi|261751261|ref|ZP_05994970.1| 50S ribosomal protein L20 [Brucella suis bv. 5 str. 513]
 gi|261755826|ref|ZP_05999535.1| 50S ribosomal protein L20 [Brucella suis bv. 3 str. 686]
 gi|261759054|ref|ZP_06002763.1| ribosomal protein L20 [Brucella sp. F5/99]
 gi|265983117|ref|ZP_06095852.1| 50S ribosomal protein L20 [Brucella sp. 83/13]
 gi|265987668|ref|ZP_06100225.1| 50S ribosomal protein L20 [Brucella pinnipedialis M292/94/1]
 gi|265992143|ref|ZP_06104700.1| 50S ribosomal protein L20 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993881|ref|ZP_06106438.1| 50S ribosomal protein L20 [Brucella melitensis bv. 3 str. Ether]
 gi|265997128|ref|ZP_06109685.1| 50S ribosomal protein L20 [Brucella ceti M490/95/1]
 gi|294851346|ref|ZP_06792019.1| 50S ribosomal protein L20 [Brucella sp. NVSL 07-0026]
 gi|297247346|ref|ZP_06931064.1| 50S ribosomal protein L20 [Brucella abortus bv. 5 str. B3196]
 gi|306837677|ref|ZP_07470546.1| ribosomal protein L20 [Brucella sp. NF 2653]
 gi|306842767|ref|ZP_07475409.1| ribosomal protein L20 [Brucella sp. BO2]
 gi|54039124|sp|P66102|RL20_BRUSU RecName: Full=50S ribosomal protein L20
 gi|54041828|sp|P66101|RL20_BRUME RecName: Full=50S ribosomal protein L20
 gi|81309345|sp|Q57AE2|RL20_BRUAB RecName: Full=50S ribosomal protein L20
 gi|109893099|sp|Q2YQV7|RL20_BRUA2 RecName: Full=50S ribosomal protein L20
 gi|166219614|sp|A5VT72|RL20_BRUO2 RecName: Full=50S ribosomal protein L20
 gi|189041850|sp|A9M9V2|RL20_BRUC2 RecName: Full=50S ribosomal protein L20
 gi|189041851|sp|B0CJL8|RL20_BRUSI RecName: Full=50S ribosomal protein L20
 gi|226730363|sp|B2S9B6|RL20_BRUA1 RecName: Full=50S ribosomal protein L20
 gi|254800304|sp|C0RG04|RL20_BRUMB RecName: Full=50S ribosomal protein L20
 gi|17984061|gb|AAL53188.1| lsu ribosomal protein l20p [Brucella melitensis bv. 1 str. 16M]
 gi|23349005|gb|AAN31010.1| ribosomal protein L20 [Brucella suis 1330]
 gi|62197092|gb|AAX75392.1| RplT, ribosomal protein L20 [Brucella abortus bv. 1 str. 9-941]
 gi|82616972|emb|CAJ12080.1| Ribosomal protein L20, bacterial and organelle form:Ribosomal
           protein L20 [Brucella melitensis biovar Abortus 2308]
 gi|148370775|gb|ABQ60754.1| ribosomal protein L20 [Brucella ovis ATCC 25840]
 gi|161336842|gb|ABX63147.1| ribosomal protein L20 [Brucella canis ATCC 23365]
 gi|163674859|gb|ABY38970.1| ribosomal protein L20 [Brucella suis ATCC 23445]
 gi|189020746|gb|ACD73468.1| Ribosomal protein L20 [Brucella abortus S19]
 gi|225618150|gb|EEH15193.1| ribosomal protein L20 [Brucella ceti str. Cudo]
 gi|225641912|gb|ACO01826.1| ribosomal protein L20 [Brucella melitensis ATCC 23457]
 gi|237788532|gb|EEP62747.1| ribosomal protein L20 [Brucella abortus str. 2308 A]
 gi|256000681|gb|ACU49080.1| 50S ribosomal protein L20 [Brucella microti CCM 4915]
 gi|260096331|gb|EEW80207.1| ribosomal protein L20 [Brucella abortus NCTC 8038]
 gi|260153040|gb|EEW88132.1| ribosomal protein L20 [Brucella melitensis bv. 1 str. 16M]
 gi|260156927|gb|EEW92007.1| ribosomal protein L20 [Brucella suis bv. 4 str. 40]
 gi|260669335|gb|EEX56275.1| 50S ribosomal protein L20 [Brucella abortus bv. 4 str. 292]
 gi|260671174|gb|EEX57995.1| 50S ribosomal protein L20 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675902|gb|EEX62723.1| 50S ribosomal protein L20 [Brucella abortus bv. 6 str. 870]
 gi|260874346|gb|EEX81415.1| 50S ribosomal protein L20 [Brucella abortus bv. 9 str. C68]
 gi|260916676|gb|EEX83537.1| 50S ribosomal protein L20 [Brucella abortus bv. 3 str. Tulya]
 gi|260919752|gb|EEX86405.1| 50S ribosomal protein L20 [Brucella ceti B1/94]
 gi|260923028|gb|EEX89596.1| 50S ribosomal protein L20 [Brucella ceti M13/05/1]
 gi|261293901|gb|EEX97397.1| 50S ribosomal protein L20 [Brucella ceti M644/93/1]
 gi|261295819|gb|EEX99315.1| 50S ribosomal protein L20 [Brucella pinnipedialis B2/94]
 gi|261303871|gb|EEY07368.1| 50S ribosomal protein L20 [Brucella pinnipedialis M163/99/10]
 gi|261739038|gb|EEY27034.1| ribosomal protein L20 [Brucella sp. F5/99]
 gi|261741014|gb|EEY28940.1| 50S ribosomal protein L20 [Brucella suis bv. 5 str. 513]
 gi|261745579|gb|EEY33505.1| 50S ribosomal protein L20 [Brucella suis bv. 3 str. 686]
 gi|262551596|gb|EEZ07586.1| 50S ribosomal protein L20 [Brucella ceti M490/95/1]
 gi|262764862|gb|EEZ10783.1| 50S ribosomal protein L20 [Brucella melitensis bv. 3 str. Ether]
 gi|263003209|gb|EEZ15502.1| 50S ribosomal protein L20 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092842|gb|EEZ17017.1| 50S ribosomal protein L20 [Brucella melitensis bv. 2 str. 63/9]
 gi|264659865|gb|EEZ30126.1| 50S ribosomal protein L20 [Brucella pinnipedialis M292/94/1]
 gi|264661709|gb|EEZ31970.1| 50S ribosomal protein L20 [Brucella sp. 83/13]
 gi|294819935|gb|EFG36934.1| 50S ribosomal protein L20 [Brucella sp. NVSL 07-0026]
 gi|297174515|gb|EFH33862.1| 50S ribosomal protein L20 [Brucella abortus bv. 5 str. B3196]
 gi|306287111|gb|EFM58616.1| ribosomal protein L20 [Brucella sp. BO2]
 gi|306407235|gb|EFM63445.1| ribosomal protein L20 [Brucella sp. NF 2653]
 gi|326410119|gb|ADZ67184.1| Ribosomal protein L20 [Brucella melitensis M28]
 gi|326539837|gb|ADZ88052.1| ribosomal protein L20 [Brucella melitensis M5-90]
          Length = 134

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 92/118 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL  A GF GRRKNTIR AKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLDQAAGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVREQGLTYGRFIDGLAKAGIEIDRKVLSDIAIHEPEAFAALVASAKKALE 118


>gi|320335391|ref|YP_004172102.1| 50S ribosomal protein L20 [Deinococcus maricopensis DSM 21211]
 gi|319756680|gb|ADV68437.1| 50S ribosomal protein L20 [Deinococcus maricopensis DSM 21211]
          Length = 119

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 61/119 (51%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKKVLK AKGF+G R    + A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MPRVKTGIVRRRRHKKVLKRAKGFWGSRSKQYKNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINA  R++ +NYS FI+GL KAG+ LDRK+L+DLA  + ++F  +VE ++     
Sbjct: 61  WIQRINAGARLHGMNYSTFISGLKKAGVGLDRKILADLAAREPETFATLVETAKGAHAA 119


>gi|241894787|ref|ZP_04782083.1| 50S ribosomal protein L20P [Weissella paramesenteroides ATCC 33313]
 gi|241871999|gb|EER75750.1| 50S ribosomal protein L20P [Weissella paramesenteroides ATCC 33313]
          Length = 185

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 80/118 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ ++ KK++K AKG+ G+R    + AK  V +S  YA+RDR+  KR+FR LWI
Sbjct: 2   RVKGGNVTRSRRKKMIKLAKGYRGQRHINYKVAKQQVWKSWFYAFRDRKQTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINA  R+  L+YS+F+NGL   G  L+RK+L++LA++  ++F  +VE ++  L  +
Sbjct: 62  ARINAGARMNGLSYSRFMNGLSLMGSTLNRKMLAELAVSDFEAFSALVESAKKALADN 119


>gi|302389959|ref|YP_003825780.1| LSU ribosomal protein L20P [Thermosediminibacter oceani DSM 16646]
 gi|302200587|gb|ADL08157.1| LSU ribosomal protein L20P [Thermosediminibacter oceani DSM 16646]
          Length = 118

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+GV +  +HKK+LK AKG+YG +    + A  AV +S  YAY  R++KKRDFR L
Sbjct: 1   MARVKKGVTARRRHKKILKLAKGYYGAKSKRFKIANQAVLKSLMYAYVGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KAG+ ++RK+L+++AI     F ++VE++++ +
Sbjct: 61  WITRINAAARANGLSYSKFINGLKKAGVQINRKMLAEMAIHDQGGFTQLVEIAKANI 117


>gi|89094706|ref|ZP_01167642.1| Ribosomal protein L20 [Oceanospirillum sp. MED92]
 gi|89081052|gb|EAR60288.1| Ribosomal protein L20 [Oceanospirillum sp. MED92]
          Length = 118

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKKVLK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKVLKKAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R+  L+YS+FI GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARLNGLSYSRFIAGLKKANIEIDRKVLADLAVHEAGAFAAIVEKAKASLA 118


>gi|15597937|ref|NP_251431.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa PAO1]
 gi|116050731|ref|YP_790448.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152989236|ref|YP_001347873.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa PA7]
 gi|218891079|ref|YP_002439945.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa LESB58]
 gi|254235719|ref|ZP_04929042.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa C3719]
 gi|254241194|ref|ZP_04934516.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa 2192]
 gi|296388796|ref|ZP_06878271.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa PAb1]
 gi|14195127|sp|Q9I0A2|RL20_PSEAE RecName: Full=50S ribosomal protein L20
 gi|122259856|sp|Q02NN8|RL20_PSEAB RecName: Full=50S ribosomal protein L20
 gi|166219681|sp|A6V488|RL20_PSEA7 RecName: Full=50S ribosomal protein L20
 gi|226730438|sp|B7V309|RL20_PSEA8 RecName: Full=50S ribosomal protein L20
 gi|9948819|gb|AAG06129.1|AE004702_6 50S ribosomal protein L20 [Pseudomonas aeruginosa PAO1]
 gi|115585952|gb|ABJ11967.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126167650|gb|EAZ53161.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa C3719]
 gi|126194572|gb|EAZ58635.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa 2192]
 gi|150964394|gb|ABR86419.1| ribosomal protein L20 [Pseudomonas aeruginosa PA7]
 gi|218771304|emb|CAW27069.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa LESB58]
          Length = 118

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARQNGLSYSRLIAGLKKAAIEIDRKVLADLAVNEKAAFTAIVEKAKASLA 118


>gi|328881241|emb|CCA54480.1| LSU ribosomal protein L20p [Streptomyces venezuelae ATCC 10712]
          Length = 128

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEAASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++ I GL  A I +DRK+L++LA+   ++F  +VE+++  L  D
Sbjct: 61  WIQRINAAARLNGMTYNRLIQGLKAANIEVDRKILAELAVNDANAFAALVEVAQKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|325067169|ref|ZP_08125842.1| 50S ribosomal protein L20 [Actinomyces oris K20]
 gi|326771654|ref|ZP_08230939.1| ribosomal protein L20 [Actinomyces viscosus C505]
 gi|326637787|gb|EGE38688.1| ribosomal protein L20 [Actinomyces viscosus C505]
          Length = 126

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YA+RDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEKASGYRGQRSRLYRKAKEQVTHSGVYAFRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ +   FK +VE++R  L  D
Sbjct: 61  WIQRINAAARAEGLTYNRFIQGLGLAGVEIDRRMLAELAVNEPAGFKALVEVARKALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|254474236|ref|ZP_05087626.1| ribosomal protein L20 [Pseudovibrio sp. JE062]
 gi|211956610|gb|EEA91820.1| ribosomal protein L20 [Pseudovibrio sp. JE062]
          Length = 118

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 75/118 (63%), Positives = 100/118 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKV+K+AKG+YGRRKNTIR AK AV+++ QYAYRDR+ +KR+FR+L
Sbjct: 1   MSRVKRGVTAHARHKKVIKAAKGYYGRRKNTIRVAKQAVEKAAQYAYRDRKARKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R + + Y +FI+GL+KAGI +DRKVLSDLAI Q D+FK +VE +++ + 
Sbjct: 61  WIQRINAATREHGMTYGRFIDGLNKAGIEVDRKVLSDLAINQPDAFKALVEKAQAAVA 118


>gi|119716687|ref|YP_923652.1| 50S ribosomal protein L20 [Nocardioides sp. JS614]
 gi|166219669|sp|A1SJI0|RL20_NOCSJ RecName: Full=50S ribosomal protein L20
 gi|119537348|gb|ABL81965.1| LSU ribosomal protein L20P [Nocardioides sp. JS614]
          Length = 130

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y+Y DRR  K +FR L
Sbjct: 1   MARVKRAVNAQKKRRVVLERASGYRGQRSRLYRKAKEQVTHSLVYSYNDRRKNKGNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL+ AG+ +DRK+L+DLA+  + +F  +VE +++ L  D
Sbjct: 61  WIQRINAAARAQGMTYNRFIQGLNLAGVEVDRKILADLAVNDVTAFNALVETAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|197284915|ref|YP_002150787.1| 50S ribosomal protein L20 [Proteus mirabilis HI4320]
 gi|227355318|ref|ZP_03839719.1| 50S ribosomal protein L20 [Proteus mirabilis ATCC 29906]
 gi|226730437|sp|B4ETK9|RL20_PROMH RecName: Full=50S ribosomal protein L20
 gi|194682402|emb|CAR42260.1| 50S ribosomal protein L20 [Proteus mirabilis HI4320]
 gi|227164542|gb|EEI49413.1| 50S ribosomal protein L20 [Proteus mirabilis ATCC 29906]
          Length = 118

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R KRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARAKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGMSYSRFINGLRKASIEIDRKILADIAVFDKAAFAALVEKAKGALA 118


>gi|226944150|ref|YP_002799223.1| 50S ribosomal protein L20 [Azotobacter vinelandii DJ]
 gi|259646174|sp|C1DF45|RL20_AZOVD RecName: Full=50S ribosomal protein L20
 gi|226719077|gb|ACO78248.1| 50S ribosomal protein L20 [Azotobacter vinelandii DJ]
          Length = 118

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+ I GL KA I +DRKVLSDLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARQNGLSYSRLIAGLKKATIEIDRKVLSDLAVNEKAAFAAIVEKAKAVLA 118


>gi|330503836|ref|YP_004380705.1| 50S ribosomal protein L20 [Pseudomonas mendocina NK-01]
 gi|328918122|gb|AEB58953.1| 50S ribosomal protein L20 [Pseudomonas mendocina NK-01]
          Length = 118

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARARHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R+  L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARINGLSYSRLIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKAVLA 118


>gi|313107810|ref|ZP_07793984.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa 39016]
 gi|310880486|gb|EFQ39080.1| 50S ribosomal protein L20 [Pseudomonas aeruginosa 39016]
          Length = 118

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+ I GL KA I +DRKVL+DLA+ +  +F  +VE +++ L 
Sbjct: 61  WIARINAGARQNGLSYSRLIAGLKKAAIEIDRKVLADLAVNEKAAFTALVEKAKASLA 118


>gi|56475895|ref|YP_157484.1| 50S ribosomal protein L20 [Aromatoleum aromaticum EbN1]
 gi|81821210|sp|Q5P7X8|RL20_AZOSE RecName: Full=50S ribosomal protein L20
 gi|56311938|emb|CAI06583.1| 50S ribosomal protein L20 [Aromatoleum aromaticum EbN1]
          Length = 119

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 86/119 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MSRVKRGVTARARHKKVLDQAKGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L YS F+NGL KA I +DRKVL+DLA+    +F  + + +R++L  
Sbjct: 61  WIARINAAAREVGLTYSTFMNGLKKAAIEVDRKVLADLAVFDKPAFAALADQARAKLAA 119


>gi|329944513|ref|ZP_08292678.1| ribosomal protein L20 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328530278|gb|EGF57157.1| ribosomal protein L20 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 126

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YA+RDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSVLEKASGYRGQRSRLYRKAKEQVTHSGVYAFRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  AG+ +DR++L++LA+ + + FK +VE++R  L  D
Sbjct: 61  WIQRINAAARAEGLTYNRFIQGLGLAGVEIDRRMLAELAVNEPEGFKALVEVARKALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|311031380|ref|ZP_07709470.1| 50S ribosomal protein L20 [Bacillus sp. m3-13]
          Length = 119

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K AKG+YG +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRQRRKKVIKLAKGYYGSKHTLYKVANQQVMKSLMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L++LA++   +F ++   +++ L
Sbjct: 61  WIARINAAARMNGLSYSRLMHGLKVAGIEVNRKMLAELAVSDEKAFAELATAAKNSL 117


>gi|239637524|ref|ZP_04678496.1| ribosomal protein L20 [Staphylococcus warneri L37603]
 gi|239596742|gb|EEQ79267.1| ribosomal protein L20 [Staphylococcus warneri L37603]
          Length = 118

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARKHDISYSRLMNGLKKADIDINRKMLSEIAISDDKAFGELVSKAKDAL 117


>gi|149926880|ref|ZP_01915139.1| ribosomal protein L20 [Limnobacter sp. MED105]
 gi|149824432|gb|EDM83650.1| ribosomal protein L20 [Limnobacter sp. MED105]
          Length = 118

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 73/116 (62%), Positives = 84/116 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKGF GRR N  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVIAQAKGFRGRRNNVFRVAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAAVR + + YS FINGL KA I LDRKVL+DLA+T   +F  IV   R+ 
Sbjct: 61  WITRINAAVREHGMTYSVFINGLKKAAIGLDRKVLADLAVTDKAAFAAIVGQVRAA 116


>gi|121535637|ref|ZP_01667443.1| ribosomal protein L20 [Thermosinus carboxydivorans Nor1]
 gi|121305807|gb|EAX46743.1| ribosomal protein L20 [Thermosinus carboxydivorans Nor1]
          Length = 117

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+GV +  +HKK+LK AKG+ G R    + A   V ++  YA RDRR KK +FR L
Sbjct: 1   MPRVKKGVTAHRRHKKILKLAKGYRGARSKQFKKANELVMKALYYARRDRRAKKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YSQ INGL KAG+ ++RK+L+DLA+  + +F K+VE ++++L
Sbjct: 61  WITRINAAARINGLSYSQLINGLKKAGVEVNRKMLADLAVNDMAAFSKLVETAKAQL 117


>gi|152996607|ref|YP_001341442.1| 50S ribosomal protein L20 [Marinomonas sp. MWYL1]
 gi|189041869|sp|A6VYH8|RL20_MARMS RecName: Full=50S ribosomal protein L20
 gi|150837531|gb|ABR71507.1| ribosomal protein L20 [Marinomonas sp. MWYL1]
          Length = 118

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R AK AV ++ QY YRDRR +KR FR+L
Sbjct: 1   MPRVKRGVQARRRHKKILKQAKGYYGARSRVFRVAKQAVIKAGQYQYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+FI GL +A I +DRKVL+DLA+ + + F  IVE ++  L 
Sbjct: 61  WIARINAAARINGLSYSRFIAGLKQAAIEIDRKVLADLAVYEKEVFAAIVEKAKVSLA 118


>gi|71892133|ref|YP_277865.1| 50S ribosomal protein L20 [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|109893097|sp|Q492V2|RL20_BLOPB RecName: Full=50S ribosomal protein L20
 gi|71796239|gb|AAZ40990.1| 50S ribosomal subunit protein L20 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 120

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 81/114 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVK  VV+ A+HKK+LK A G+YG R  T R A  +V +S QY+YRDRR KKR FR L
Sbjct: 1   MTRVKNSVVARARHKKILKQAAGYYGARSRTYRVAYQSVIKSGQYSYRDRRQKKRLFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R Y ++Y+  INGL K  + ++RK+L+D+AI   ++F  +++ ++
Sbjct: 61  WINRINAASRKYGMSYNHLINGLQKCNVCINRKMLADIAIFDRETFSALIDKAK 114


>gi|183982464|ref|YP_001850755.1| 50S ribosomal protein L20 RplT [Mycobacterium marinum M]
 gi|226730425|sp|B2HR14|RL20_MYCMM RecName: Full=50S ribosomal protein L20
 gi|183175790|gb|ACC40900.1| 50S ribosomal protein L20 RplT [Mycobacterium marinum M]
          Length = 129

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSVLKASKGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+AIT   +F  +V+++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAITDPAAFTALVDVARAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|78222626|ref|YP_384373.1| 50S ribosomal protein L20 [Geobacter metallireducens GS-15]
 gi|109893116|sp|Q39VS6|RL20_GEOMG RecName: Full=50S ribosomal protein L20
 gi|78193881|gb|ABB31648.1| LSU ribosomal protein L20P [Geobacter metallireducens GS-15]
          Length = 117

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDR+VKKRDFR+L
Sbjct: 1   MPRVKRGFKARRRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRKVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ I+GL KA + +DRKVL+DLA++    F +I  ++++++
Sbjct: 61  WITRINAASRLNGLSYSKLIHGLKKASVEIDRKVLADLAVSDPQGFSEIASVAKTQI 117


>gi|70726248|ref|YP_253162.1| 50S ribosomal protein L20 [Staphylococcus haemolyticus JCSC1435]
 gi|82581578|sp|Q4L719|RL20_STAHJ RecName: Full=50S ribosomal protein L20
 gi|68446972|dbj|BAE04556.1| 50S ribosomal protein L20 [Staphylococcus haemolyticus JCSC1435]
          Length = 118

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGAKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDMSYSRLMNGLKKADININRKMLSEVAISDEKAFAELVSKAKEAL 117


>gi|48474878|sp|Q8RPZ9|RL20_AZOVI RecName: Full=50S ribosomal protein L20
 gi|19386911|gb|AAL87033.1|AF332624_4 ribosomal protein L20 [Azotobacter vinelandii]
          Length = 118

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+ I GL KA I +DRKVLSDLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGDRQNGLSYSRLIAGLKKATIEIDRKVLSDLAVNEKAAFAAIVEKAKAVLA 118


>gi|256060084|ref|ZP_05450266.1| 50S ribosomal protein L20 [Brucella neotomae 5K33]
 gi|261324059|ref|ZP_05963256.1| 50S ribosomal protein L20 [Brucella neotomae 5K33]
 gi|261300039|gb|EEY03536.1| 50S ribosomal protein L20 [Brucella neotomae 5K33]
          Length = 134

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 77/118 (65%), Positives = 92/118 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVL  A GF GRRKNTIR AKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLDQAAGFRGRRKNTIRTAKAAVDRSKQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVREQGLTYGRFIDGLAKAGIEIDRKVLSDIAIHEPEAFAVLVASAKKALE 118


>gi|85375591|ref|YP_459653.1| 50S ribosomal protein L20 [Erythrobacter litoralis HTCC2594]
 gi|122543232|sp|Q2N635|RL20_ERYLH RecName: Full=50S ribosomal protein L20
 gi|84788674|gb|ABC64856.1| ribosomal protein L20 [Erythrobacter litoralis HTCC2594]
          Length = 119

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 93/119 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGV +  KHK++L  AKG+ GRRKNTIR A+ AV+++ QYAYRDR+VKKR FR+L
Sbjct: 1   MPRIKRGVTTRQKHKRLLDQAKGYRGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAAVR   L YSQF++G+  AGI LDRKV++DLA+ +  +FK +++ +++ L  
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGVKLAGIELDRKVMADLAMNEEAAFKSVIDQAKAALPA 119


>gi|302533484|ref|ZP_07285826.1| ribosomal protein L20 [Streptomyces sp. C]
 gi|302442379|gb|EFL14195.1| ribosomal protein L20 [Streptomyces sp. C]
          Length = 128

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S  Y + DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEAASGYRGQRSRLYRKAKEQVTHSLVYNFNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DRK+L++LA+   ++F  +VE+++  L  D
Sbjct: 61  WIQRINAAARQNGMTYNRLIQGLKAANIEVDRKILAELAVNDANAFAALVEVAQKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|317129888|ref|YP_004096170.1| ribosomal protein L20 [Bacillus cellulosilyticus DSM 2522]
 gi|315474836|gb|ADU31439.1| ribosomal protein L20 [Bacillus cellulosilyticus DSM 2522]
          Length = 119

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+ G +    ++A+  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGYVARRRRKKVLKLAKGYVGSKHRLFKSAQVQVMKSLLYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+Y++F++GL ++GI ++RK+L+D+AI    +F ++ E ++S L
Sbjct: 61  WITRINAAARINGLSYNRFMHGLKQSGIEMNRKMLADIAIHDEKAFAELAEKAKSGL 117


>gi|146307007|ref|YP_001187472.1| 50S ribosomal protein L20 [Pseudomonas mendocina ymp]
 gi|166220728|sp|A4XTS4|RL20_PSEMY RecName: Full=50S ribosomal protein L20
 gi|145575208|gb|ABP84740.1| LSU ribosomal protein L20P [Pseudomonas mendocina ymp]
          Length = 118

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARARHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  RV  L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARVNGLSYSRLIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKAVLA 118


>gi|304439757|ref|ZP_07399655.1| 50S ribosomal protein L20 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371744|gb|EFM25352.1| 50S ribosomal protein L20 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 114

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/113 (47%), Positives = 77/113 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRGV +  +HKK+LK AKG++G +    R A  AV +S  Y +  R+ +KRDFR LWI
Sbjct: 2   RVKRGVNAKKRHKKILKQAKGYFGAKSKLFRPANQAVMKSLNYQFFGRKQRKRDFRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
            RINAA R   ++YS+FI GL K  + ++RK+LS++AI     F K+VEL+++
Sbjct: 62  ARINAACRQNGMSYSKFIAGLKKHEVEINRKMLSEIAINDPQGFAKLVELAKN 114


>gi|71083147|ref|YP_265866.1| 50S ribosomal protein L20 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91762422|ref|ZP_01264387.1| 50S ribosomal protein L20 [Candidatus Pelagibacter ubique HTCC1002]
 gi|109893133|sp|Q4FNH6|RL20_PELUB RecName: Full=50S ribosomal protein L20
 gi|71062260|gb|AAZ21263.1| 50S ribosomal protein L20 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91718224|gb|EAS84874.1| 50S ribosomal protein L20 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 118

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+ KG +GRRK+TIR AK A++++ QYAYRDRR KKR+F+SL
Sbjct: 1   MARVKRGVTSHAKHKKVLKAVKGQWGRRKSTIRVAKQAMEKAMQYAYRDRRTKKREFKSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   + YS+FINGL K GI LDRK+L+++A    ++FK IV+ ++S L
Sbjct: 61  WIQRINAGVRSEGITYSKFINGLTKCGIKLDRKILAEIAYDSPEAFKTIVQKAQSAL 117


>gi|240168028|ref|ZP_04746687.1| 50S ribosomal protein L20 [Mycobacterium kansasii ATCC 12478]
          Length = 129

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSVLKASKGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+A+T   +F  +VE++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAVTDPAAFTALVEVARAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|56552411|ref|YP_163250.1| 50S ribosomal protein L20 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761546|ref|ZP_04759633.1| ribosomal protein L20 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260753911|ref|YP_003226804.1| 50S ribosomal protein L20 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|81820863|sp|Q5NMC1|RL20_ZYMMO RecName: Full=50S ribosomal protein L20
 gi|56543985|gb|AAV90139.1| ribosomal protein L20 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373854|gb|EER63387.1| ribosomal protein L20 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258553274|gb|ACV76220.1| ribosomal protein L20 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 125

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 87/121 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKH ++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR+L
Sbjct: 1   MARVKRGTTTRAKHNRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   L Y  F+ GL  AG+ LDRKVL+DLA+ +  +F  I+   +S L   
Sbjct: 61  WIQRINAAVRAEGLTYGVFMYGLKLAGLDLDRKVLADLAMNESAAFGAIIAQVKSALPEG 120

Query: 121 V 121
            
Sbjct: 121 A 121


>gi|57238868|ref|YP_180004.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
 gi|58578797|ref|YP_197009.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
 gi|58616856|ref|YP_196055.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Gardel]
 gi|81311348|sp|Q5FH69|RL20_EHRRG RecName: Full=50S ribosomal protein L20
 gi|81819283|sp|Q5HC39|RL20_EHRRW RecName: Full=50S ribosomal protein L20
 gi|57160947|emb|CAH57853.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
 gi|58416468|emb|CAI27581.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Gardel]
 gi|58417423|emb|CAI26627.1| 50S ribosomal protein L20 [Ehrlichia ruminantium str. Welgevonden]
          Length = 123

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 69/117 (58%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K AKG+ GR KN  R A   V+++ QYAYRDRR +KR FRSL
Sbjct: 1   MARVKRGVTTRARHKKVIKLAKGYRGRSKNCYRVALQRVEKALQYAYRDRRNRKRFFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR Y L YS FI GL  A I L+RK+L+D+A+   D+FK+IV+L++  L
Sbjct: 61  WIMRINAAVRQYGLLYSDFIYGLSLANITLNRKILADMAVHNKDNFKQIVDLTKEAL 117


>gi|330977712|gb|EGH77615.1| 50S ribosomal protein L20 [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 118

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  + KK+LK AKG+YG R    R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVIARKRQKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  RV  L+YS+FI GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARVNGLSYSRFIAGLKKASIEIDRKVLADLAVNEKAAFAAIVEKAKATLA 118


>gi|295397491|ref|ZP_06807574.1| 50S ribosomal protein L20 [Aerococcus viridans ATCC 11563]
 gi|294974291|gb|EFG50035.1| 50S ribosomal protein L20 [Aerococcus viridans ATCC 11563]
          Length = 119

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/117 (49%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK LK +KG++G +    + AK AV +S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRRRRKKYLKLSKGYFGAKSKLYKTAKQAVMKSYTYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  INGL  A I ++RK+L++LA+   D+F  I E +++ L
Sbjct: 61  WITRINAAARMNGMSYSTLINGLKVANIDMNRKMLAELAVNDADAFAAICEQAKAAL 117


>gi|254488959|ref|ZP_05102164.1| ribosomal protein L20 [Roseobacter sp. GAI101]
 gi|214045828|gb|EEB86466.1| ribosomal protein L20 [Roseobacter sp. GAI101]
          Length = 121

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 96/121 (79%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K GVV+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRTKGGVVTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + +SF  IV+ ++  L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLADLAVNEPESFGAIVKQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|39996618|ref|NP_952569.1| 50S ribosomal protein L20 [Geobacter sulfurreducens PCA]
 gi|60390514|sp|Q74D01|RL20_GEOSL RecName: Full=50S ribosomal protein L20
 gi|39983499|gb|AAR34892.1| ribosomal protein L20 [Geobacter sulfurreducens PCA]
 gi|307634867|gb|ADI84354.2| ribosomal protein L20 [Geobacter sulfurreducens KN400]
          Length = 117

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 61/116 (52%), Positives = 83/116 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKGF G R    R+A  AVDR+  YA+RDR+VKKRDFR+L
Sbjct: 1   MPRVKRGFKARRRRNKVLKLAKGFRGARSKLFRSATEAVDRALNYAFRDRKVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  L+YS+ I+GL +A + +DRKVL+DLA++    F +I  L++++
Sbjct: 61  WITRINAASRLNGLSYSKLIHGLKQAQVEIDRKVLADLAVSDPKGFSEIATLAKAQ 116


>gi|291457668|ref|ZP_06597058.1| ribosomal protein L20 [Bifidobacterium breve DSM 20213]
 gi|291380721|gb|EFE88239.1| ribosomal protein L20 [Bifidobacterium breve DSM 20213]
          Length = 127

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L++LA++  D+FK IV+ +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAELAVSDSDTFKTIVDAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|255526050|ref|ZP_05392973.1| ribosomal protein L20 [Clostridium carboxidivorans P7]
 gi|296187097|ref|ZP_06855495.1| ribosomal protein L20 [Clostridium carboxidivorans P7]
 gi|255510236|gb|EET86553.1| ribosomal protein L20 [Clostridium carboxidivorans P7]
 gi|296048291|gb|EFG87727.1| ribosomal protein L20 [Clostridium carboxidivorans P7]
          Length = 119

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/119 (47%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   HKK+LK AKG+YG +    + A   V R+ + AY  R++KKRDFR L
Sbjct: 1   MARVKRAVNARKYHKKILKLAKGYYGGKSKLFKTANETVIRALRNAYVGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+  AGI ++RK+LS++AI    SF ++VE+++ ++  
Sbjct: 61  WIARINAATRISGLSYSRFMNGMKLAGININRKMLSEIAINDPKSFAELVEIAKKQINA 119


>gi|269795535|ref|YP_003314990.1| 50S ribosomal protein L20P [Sanguibacter keddieii DSM 10542]
 gi|269097720|gb|ACZ22156.1| LSU ribosomal protein L20P [Sanguibacter keddieii DSM 10542]
          Length = 128

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y+YRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTILEQASGYRGQRSRLYRKAKEQVTHSLTYSYRDRKKRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A I++DR+VL++LA++ + +F  +V+L+++ L  D
Sbjct: 61  WIQRINAAARAEGITYNRFIQGLKAAEILVDRRVLAELAVSDVAAFNALVKLAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|83944291|ref|ZP_00956746.1| 50S ribosomal protein L20 [Sulfitobacter sp. EE-36]
 gi|83953332|ref|ZP_00962054.1| 50S ribosomal protein L20 [Sulfitobacter sp. NAS-14.1]
 gi|83842300|gb|EAP81468.1| 50S ribosomal protein L20 [Sulfitobacter sp. NAS-14.1]
 gi|83844835|gb|EAP82717.1| 50S ribosomal protein L20 [Sulfitobacter sp. EE-36]
          Length = 121

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 73/121 (60%), Positives = 96/121 (79%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K GVV+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRTKGGVVTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVLSDLAI + ++F  IV+ ++  L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLSDLAINEPEAFGAIVKQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|309811064|ref|ZP_07704862.1| ribosomal protein L20 [Dermacoccus sp. Ellin185]
 gi|308435028|gb|EFP58862.1| ribosomal protein L20 [Dermacoccus sp. Ellin185]
          Length = 124

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDRR KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRTVLEQASGYRGQRSRLYRKAKEQVTHSLGYAYRDRRAKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++FI GL  AGI +DR++L++LA+    +F K+VE++++ +   
Sbjct: 61  WIQRINAAARLNGMTYNRFIQGLKVAGIEVDRRMLAELAVNDAPAFAKLVEIAKANVPAQ 120

Query: 121 VAS 123
             +
Sbjct: 121 TPA 123


>gi|294501486|ref|YP_003565186.1| 50S ribosomal protein L20 [Bacillus megaterium QM B1551]
 gi|295706834|ref|YP_003599909.1| 50S ribosomal protein L20 [Bacillus megaterium DSM 319]
 gi|294351423|gb|ADE71752.1| 50S ribosomal protein L20 [Bacillus megaterium QM B1551]
 gi|294804493|gb|ADF41559.1| 50S ribosomal protein L20 [Bacillus megaterium DSM 319]
          Length = 119

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKGF+G +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGFFGSKHRLYKVANQQVMKSHMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F ++   ++  L
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKLAGIEVNRKMLADLAVADEKAFAELATAAKKGL 117


>gi|317057705|ref|YP_004106172.1| 50S ribosomal protein L20 [Ruminococcus albus 7]
 gi|315449974|gb|ADU23538.1| ribosomal protein L20 [Ruminococcus albus 7]
          Length = 117

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  +  K LK AKG++G +    + AK AV +S QYAY  R+ KKRDFR L
Sbjct: 1   MARVKGAMMTRKRRNKTLKLAKGYFGAKSKHFKMAKQAVMKSGQYAYIGRKQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NG++KAGI L+RK+LS++AI+    F  IVE +++ L
Sbjct: 61  WITRISAACKMNGINYSTFMNGVNKAGINLNRKMLSEIAISDPAGFTAIVEQAKAAL 117


>gi|163738458|ref|ZP_02145873.1| ribosomal protein L20 [Phaeobacter gallaeciensis BS107]
 gi|163742132|ref|ZP_02149520.1| 50S ribosomal protein L20 [Phaeobacter gallaeciensis 2.10]
 gi|161384462|gb|EDQ08843.1| 50S ribosomal protein L20 [Phaeobacter gallaeciensis 2.10]
 gi|161388379|gb|EDQ12733.1| ribosomal protein L20 [Phaeobacter gallaeciensis BS107]
          Length = 121

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 71/121 (58%), Positives = 96/121 (79%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTTTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ ++S L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLTLAGIEVDRKVLADLAVHEPEAFGAIVKQAQSALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|15887606|ref|NP_353287.1| 50S ribosomal protein L20 [Agrobacterium tumefaciens str. C58]
 gi|22096073|sp|Q8UIN7|RL20_AGRT5 RecName: Full=50S ribosomal protein L20
 gi|15155149|gb|AAK86072.1| 50S ribosomal protein L20 [Agrobacterium tumefaciens str. C58]
          Length = 134

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 97/118 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKH K LK+AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSRAKHTKTLKAAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE ++  L 
Sbjct: 61  WIQRINAAVRESGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEAAKKALE 118


>gi|300311297|ref|YP_003775389.1| 50S ribosomal protein L20 [Herbaspirillum seropedicae SmR1]
 gi|300074082|gb|ADJ63481.1| 50S ribosomal subunit L20 protein [Herbaspirillum seropedicae SmR1]
          Length = 120

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV R+ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGYRGRRKNVYRIAKQAVMRAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R + + YS F+NGL KA I LDRKVL+D+A+T   +F  IV   ++ +  
Sbjct: 61  WIARINAAARSHGVTYSVFMNGLKKAAIELDRKVLADMAVTDKAAFAAIVNQVKANIAA 119


>gi|15837342|ref|NP_298030.1| 50S ribosomal protein L20 [Xylella fastidiosa 9a5c]
 gi|14195143|sp|Q9PFD8|RL20_XYLFA RecName: Full=50S ribosomal protein L20
 gi|9105630|gb|AAF83550.1|AE003916_4 50S ribosomal protein L20 [Xylella fastidiosa 9a5c]
          Length = 119

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILSLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NGL K GI LDRKVL+D+A+     F  + E ++S L  
Sbjct: 61  WIVRINAAARINGLSYSRFMNGLLKCGITLDRKVLADIAVHDPAGFTALAEKAKSILAA 119


>gi|29833281|ref|NP_827915.1| 50S ribosomal protein L20 [Streptomyces avermitilis MA-4680]
 gi|39931878|sp|Q828D0|RL20_STRAW RecName: Full=50S ribosomal protein L20
 gi|29610403|dbj|BAC74450.1| putative ribosomal protein L20 [Streptomyces avermitilis MA-4680]
          Length = 127

 Score =  151 bits (383), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 76/123 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L++A G+ G+R    R AK  V  S  Y Y DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRAILEAASGYRGQRSRLYRKAKEQVTHSLVYNYNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DRK+L++LA+    +F  +VE+++  L  D
Sbjct: 61  WIQRINAAARANGMTYNRLIQGLKAANIEVDRKILAELAVNDAGAFAALVEVAQKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|190571067|ref|YP_001975425.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019588|ref|ZP_03335394.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|226730473|sp|B3CLK2|RL20_WOLPP RecName: Full=50S ribosomal protein L20
 gi|190357339|emb|CAQ54770.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995010|gb|EEB55652.1| ribosomal protein L20 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 121

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/120 (50%), Positives = 84/120 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRG  + A+HKKVLK AKG+ GR KN  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MARIKRGTATHARHKKVLKLAKGYRGRAKNCYRIALQRVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R + L Y +F++GL   G+ L+RK+L+++A+   D F K++E   S+L  +
Sbjct: 61  WIIRINAAAREHGLTYGRFMHGLKLVGVDLNRKILAEMAVNHKDDFAKLIETVSSKLAEN 120


>gi|256825067|ref|YP_003149027.1| 50S ribosomal protein L20P [Kytococcus sedentarius DSM 20547]
 gi|256688460|gb|ACV06262.1| LSU ribosomal protein L20P [Kytococcus sedentarius DSM 20547]
          Length = 163

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 52/119 (43%), Positives = 75/119 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y++  RR +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQVTHSLVYSFDHRRDRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAA R   + Y++FI GL  A I +DR++L++LA+   ++F  +VE+SR+ +  
Sbjct: 61  WIQRINAAARANGMTYNRFIQGLKVAEIEVDRRMLAELAVNDPEAFTALVEISRANVPA 119


>gi|260186591|ref|ZP_05764065.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis CPHL_A]
 gi|289447253|ref|ZP_06436997.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis CPHL_A]
 gi|289420211|gb|EFD17412.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis CPHL_A]
          Length = 129

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK+++G+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  AG+ +DRK L+D+AI+   +F  +V+++R+ L  D
Sbjct: 61  WIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|237745473|ref|ZP_04575953.1| large subunit ribosomal protein L20 [Oxalobacter formigenes HOxBLS]
 gi|229376824|gb|EEO26915.1| large subunit ribosomal protein L20 [Oxalobacter formigenes HOxBLS]
          Length = 119

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 65/119 (54%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKK+L  AKG+ GRR +  R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MSRVKRGVTARARHKKLLAEAKGYRGRRSSVYRVAKEAVMKAGQYAYRDRRNKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   ++YS F+NGL KA I LDRKVL+D+A+    +F  IV   ++ +  
Sbjct: 61  WITRINAATRELGMSYSVFMNGLKKAAIELDRKVLADMAVADKPAFAAIVNQVKAAIAA 119


>gi|307275333|ref|ZP_07556476.1| ribosomal protein L20 [Enterococcus faecalis TX2134]
 gi|306507967|gb|EFM77094.1| ribosomal protein L20 [Enterococcus faecalis TX2134]
          Length = 119

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    ++AK  V  S  YA+RDRR KKRDFR L
Sbjct: 1   MARVKGGTVTRKRRKKVLKLAKGYYGSKHTLFKSAKEQVMNSYYYAFRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L++LA+    +F  + E ++  L 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAEIDINRKMLANLAVNDAAAFTALAEQAKDALS 118


>gi|254993710|ref|ZP_05275900.1| 50S ribosomal protein L20 [Listeria monocytogenes FSL J2-064]
          Length = 118

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK++K AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKIVKLAKGYYGSKHLLFKVANQAVMKSYQYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ DL+YS+ ++GL  AGI ++RK+L+DLA+  + SF  + + ++  + 
Sbjct: 61  WIARINAAARMQDLSYSKLMHGLKLAGIDINRKMLADLAVNDIASFNTLADSAKKXIS 118


>gi|146282709|ref|YP_001172862.1| 50S ribosomal protein L20 [Pseudomonas stutzeri A1501]
 gi|166220730|sp|A4VM19|RL20_PSEU5 RecName: Full=50S ribosomal protein L20
 gi|145570914|gb|ABP80020.1| 50S ribosomal protein L20 [Pseudomonas stutzeri A1501]
 gi|327481048|gb|AEA84358.1| 50S ribosomal protein L20 [Pseudomonas stutzeri DSM 4166]
          Length = 118

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKILKLAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  RV  L+YS+ I GL KA I +DRKVL+DLA+ +  +F  IVE +++ L 
Sbjct: 61  WIARINAGARVNGLSYSRLIAGLKKAAIEIDRKVLADLAVNEKAAFAAIVEKAKASLA 118


>gi|296446654|ref|ZP_06888595.1| ribosomal protein L20 [Methylosinus trichosporium OB3b]
 gi|296255882|gb|EFH02968.1| ribosomal protein L20 [Methylosinus trichosporium OB3b]
          Length = 121

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 81/121 (66%), Positives = 99/121 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK L +AKGFYGRRKNTIRAAKAAVDRS QYA RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLDAAKGFYGRRKNTIRAAKAAVDRSMQYATRDRKAKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQR+N AVR + + YS+FI+GL KAG+++DRKVLS+LAI+Q ++FK +VE ++S L   
Sbjct: 61  WIQRLNGAVREFGITYSRFIDGLTKAGVIIDRKVLSELAISQPEAFKALVEKAKSALPQS 120

Query: 121 V 121
            
Sbjct: 121 A 121


>gi|83647269|ref|YP_435704.1| 50S ribosomal protein L20 [Hahella chejuensis KCTC 2396]
 gi|109893117|sp|Q2SDJ5|RL20_HAHCH RecName: Full=50S ribosomal protein L20
 gi|83635312|gb|ABC31279.1| ribosomal protein L20 [Hahella chejuensis KCTC 2396]
          Length = 118

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 81/118 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKKVL  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTARRRHKKVLNQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+ I GL +A + +DRKVL+DLA+ +  +F  +V+ ++  L 
Sbjct: 61  WIARINAGARDNGLSYSRLIAGLKRANVEIDRKVLADLAMNEKAAFAAVVQKAKEALA 118


>gi|53805114|ref|YP_113206.1| 50S ribosomal protein L20 [Methylococcus capsulatus str. Bath]
 gi|81823701|sp|Q60AZ1|RL20_METCA RecName: Full=50S ribosomal protein L20
 gi|53758875|gb|AAU93166.1| ribosomal protein L20 [Methylococcus capsulatus str. Bath]
          Length = 115

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 65/114 (57%), Positives = 86/114 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVIARARHKKVLKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R + L+YS+FI+GL KA I +DRKVL+DLA+   D+F ++  +++
Sbjct: 61  WITRINAGAREFGLSYSRFISGLKKASIEIDRKVLADLAVRDKDAFAELARIAQ 114


>gi|73662395|ref|YP_301176.1| 50S ribosomal protein L20 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82581579|sp|Q49YB0|RL20_STAS1 RecName: Full=50S ribosomal protein L20
 gi|72494910|dbj|BAE18231.1| 50S ribosomal protein L20 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 118

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G ++   + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKTIKLAKGYFGSKRTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R +D++YS+ +NGL KA I ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHDMSYSRLMNGLKKAEIDINRKMLSEIAISDEKAFGELVAKAKDAL 117


>gi|126652711|ref|ZP_01724872.1| 50S ribosomal protein L20 [Bacillus sp. B14905]
 gi|169829539|ref|YP_001699697.1| 50S ribosomal protein L20 [Lysinibacillus sphaericus C3-41]
 gi|299535485|ref|ZP_07048807.1| 50S ribosomal protein L20 [Lysinibacillus fusiformis ZC1]
 gi|226730416|sp|B1HWC8|RL20_LYSSC RecName: Full=50S ribosomal protein L20
 gi|126590560|gb|EAZ84678.1| 50S ribosomal protein L20 [Bacillus sp. B14905]
 gi|168994027|gb|ACA41567.1| 50S ribosomal protein L20 [Lysinibacillus sphaericus C3-41]
 gi|298729246|gb|EFI69799.1| 50S ribosomal protein L20 [Lysinibacillus fusiformis ZC1]
          Length = 119

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 59/109 (54%), Positives = 78/109 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+YG +    + A  AV +S QYAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYYGSKHTLYKVANQAVMKSGQYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKI 109
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+T   +F ++
Sbjct: 61  WITRINAAARMNGLSYSRLMHGLKVAGIEVNRKMLADLAVTDAAAFTQL 109


>gi|19552597|ref|NP_600599.1| 50S ribosomal protein L20 [Corynebacterium glutamicum ATCC 13032]
 gi|62390265|ref|YP_225667.1| 50S ribosomal protein L20 [Corynebacterium glutamicum ATCC 13032]
 gi|145295516|ref|YP_001138337.1| 50S ribosomal protein L20 [Corynebacterium glutamicum R]
 gi|23822038|sp|Q8NQP6|RL20_CORGL RecName: Full=50S ribosomal protein L20
 gi|166219637|sp|A4QDY3|RL20_CORGB RecName: Full=50S ribosomal protein L20
 gi|21324148|dbj|BAB98773.1| Ribosomal protein L20 [Corynebacterium glutamicum ATCC 13032]
 gi|41325602|emb|CAF21391.1| 50S RIBOSOMAL PROTEIN L20 [Corynebacterium glutamicum ATCC 13032]
 gi|140845436|dbj|BAF54435.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 127

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++LKSAKG+ G+R    R AK     S  Y+YRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREILKSAKGYRGQRSRLYRKAKEQWLHSMTYSYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++ I GL  A I +DRK+L+DLA+    +F  I E +++ L  D
Sbjct: 61  WIQRINAAARMNGITYNRLIQGLRLAEIEVDRKILADLAVNDFATFSAICEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|90417314|ref|ZP_01225240.1| 50S ribosomal protein L20 [marine gamma proteobacterium HTCC2207]
 gi|90330899|gb|EAS46162.1| 50S ribosomal protein L20 [marine gamma proteobacterium HTCC2207]
          Length = 118

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVEAGRRHKKILKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRAKKRTFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  RV  L YS+ INGL KAGI LDR+VL+DLA+    +F  +V L+++ L 
Sbjct: 61  WIARINAQSRVEGLAYSRLINGLSKAGIALDRRVLADLAVHDKAAFGAVVNLAKAALA 118


>gi|154245876|ref|YP_001416834.1| ribosomal protein L20 [Xanthobacter autotrophicus Py2]
 gi|226730476|sp|A7IGN4|RL20_XANP2 RecName: Full=50S ribosomal protein L20
 gi|154159961|gb|ABS67177.1| ribosomal protein L20 [Xanthobacter autotrophicus Py2]
          Length = 120

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 2/120 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKV ++AKGFYGRRKNTIRAAK+AV+RS QYAYRDR+VKKR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVFEAAKGFYGRRKNTIRAAKSAVERSMQYAYRDRKVKKRNFRAL 60

Query: 61  WIQRINAAVRV--YDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINA VR    DL YS+FI+GL KAGI +DRKVLSD+AI + D+FK +VE +++ L 
Sbjct: 61  WIQRINAGVRALDLDLTYSRFIDGLGKAGIEVDRKVLSDIAIHEPDAFKALVEKAKAALA 120


>gi|85706245|ref|ZP_01037340.1| 50S ribosomal protein L20 [Roseovarius sp. 217]
 gi|85669409|gb|EAQ24275.1| 50S ribosomal protein L20 [Roseovarius sp. 217]
          Length = 121

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 71/121 (58%), Positives = 95/121 (78%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GVV+ A+HKKV+K+AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGVVTHARHKKVIKAAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AG+ +DRKVL+DLA+ +  +F  IV+ ++  L 
Sbjct: 61  WIQRINAAVRAHDESLTYSRFINGLALAGVEVDRKVLADLAVHEPAAFGAIVDQAKGALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|149201232|ref|ZP_01878207.1| 50S ribosomal protein L20 [Roseovarius sp. TM1035]
 gi|149145565|gb|EDM33591.1| 50S ribosomal protein L20 [Roseovarius sp. TM1035]
          Length = 121

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 95/121 (78%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK GVV+ A+HKKV+K+AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGVVTHARHKKVIKAAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AG+ +DRKVL+DLA+ +  +F  IVE ++  L 
Sbjct: 61  WIQRINAAVRAHDESLTYSRFINGLALAGVEVDRKVLADLAVHEPAAFGAIVEQAKGALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|167749027|ref|ZP_02421154.1| hypothetical protein ANACAC_03808 [Anaerostipes caccae DSM 14662]
 gi|317472574|ref|ZP_07931893.1| ribosomal protein L20 [Anaerostipes sp. 3_2_56FAA]
 gi|167651649|gb|EDR95778.1| hypothetical protein ANACAC_03808 [Anaerostipes caccae DSM 14662]
 gi|316899983|gb|EFV21978.1| ribosomal protein L20 [Anaerostipes sp. 3_2_56FAA]
          Length = 118

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 80/118 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH KVLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGMNARKKHNKVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F++GL  A + ++RK+LS++AI+  ++F  +V++++ +L 
Sbjct: 61  WIARINAAARMNGLSYSKFMHGLKLAEVDINRKMLSEMAISNPEAFTALVDVAKGKLA 118


>gi|254475284|ref|ZP_05088670.1| ribosomal protein L20 [Ruegeria sp. R11]
 gi|214029527|gb|EEB70362.1| ribosomal protein L20 [Ruegeria sp. R11]
          Length = 121

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/121 (57%), Positives = 96/121 (79%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTTTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV+ ++  L 
Sbjct: 61  WIQRINAAVRAHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVKQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|254455319|ref|ZP_05068748.1| ribosomal protein L20 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082321|gb|EDZ59747.1| ribosomal protein L20 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 118

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 73/117 (62%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+ KG +GRRKNTIR AK A++++ QYAYRDRR KKRDF++L
Sbjct: 1   MARVKRGVTSKAKHKKVLKAVKGQWGRRKNTIRVAKQAMEKAMQYAYRDRRNKKRDFKAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   L YS+FINGL K G+ +DRK+L+++A    ++FK IV+ ++S L
Sbjct: 61  WIQRINAGVRAEGLTYSKFINGLSKCGVTIDRKILAEIAYDSPEAFKTIVQKAQSAL 117


>gi|319404994|emb|CBI78603.1| 50S ribosomal protein L20 [Bartonella sp. AR 15-3]
          Length = 133

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 79/118 (66%), Positives = 95/118 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVIAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR+  L Y +FI+GL KAGI +DRK+LSD+AI     F  +V  ++  L 
Sbjct: 61  WIQRINAAVRIEGLTYGRFIDGLSKAGIKIDRKILSDIAIYDPAVFTALVASAKKALE 118


>gi|218296411|ref|ZP_03497154.1| ribosomal protein L20 [Thermus aquaticus Y51MC23]
 gi|218243205|gb|EED09736.1| ribosomal protein L20 [Thermus aquaticus Y51MC23]
          Length = 118

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K GVV   +HKK+LK AKG++G R  + R A+  +  +  YAYRDR+ +KR+FR L
Sbjct: 1   MPRAKTGVVRRRRHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYRDRKARKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R + LNYS F+NGL KAGI LDRKVL+DLA+ +  +F ++V+ +++   
Sbjct: 61  WIVRINAACRQHGLNYSSFMNGLKKAGIELDRKVLADLAVREPQAFAELVQKAKAARA 118


>gi|119505270|ref|ZP_01627345.1| 50S ribosomal protein L20 [marine gamma proteobacterium HTCC2080]
 gi|119458961|gb|EAW40061.1| 50S ribosomal protein L20 [marine gamma proteobacterium HTCC2080]
          Length = 119

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVTARRRHKKILSKAKGYYGARSRVFRVAKQAVTKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L YS+ INGL KA IVLDR+VL+DLA+    +F  +VE +RS L  
Sbjct: 61  WITRINAQSRANGLTYSRLINGLKKADIVLDRRVLADLAVHDKAAFAAVVEQARSALAA 119


>gi|296164542|ref|ZP_06847113.1| inorganic diphosphatase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295900142|gb|EFG79577.1| inorganic diphosphatase [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 131

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAQKKRRSILKASKGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+D+AIT   +F  +V+++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLADIAITDPAAFTALVDVARAALPDD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|25028067|ref|NP_738121.1| 50S ribosomal protein L20 [Corynebacterium efficiens YS-314]
 gi|259505619|ref|ZP_05748521.1| inorganic diphosphatase [Corynebacterium efficiens YS-314]
 gi|31563164|sp|Q8FTQ0|RL20_COREF RecName: Full=50S ribosomal protein L20
 gi|23493351|dbj|BAC18321.1| putative 50S ribosomal protein L20 [Corynebacterium efficiens
           YS-314]
 gi|259166784|gb|EEW51338.1| inorganic diphosphatase [Corynebacterium efficiens YS-314]
          Length = 128

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+  + Y++ I GL  A I +DRK+L+DLA+    +F  I E +++ L  D
Sbjct: 61  WIQRINAAARMNGITYNRLIQGLRLAEIEVDRKILADLAVNDFAAFSAICEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|307822737|ref|ZP_07652968.1| ribosomal protein L20 [Methylobacter tundripaludum SV96]
 gi|307736341|gb|EFO07187.1| ribosomal protein L20 [Methylobacter tundripaludum SV96]
          Length = 120

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/115 (55%), Positives = 87/115 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R AK AV ++ QYAYRDR+ KKR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+  ++YS+FINGL KA + +DRKVL+D+A+  + +F +I ++++ 
Sbjct: 61  WIVRINAAARLSGMSYSRFINGLTKANVKIDRKVLADIAVRDIAAFAEIAKIAKE 115


>gi|311742380|ref|ZP_07716189.1| 50S ribosomal protein L20 [Aeromicrobium marinum DSM 15272]
 gi|311314008|gb|EFQ83916.1| 50S ribosomal protein L20 [Aeromicrobium marinum DSM 15272]
          Length = 130

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++ L+ AKG+ G+R    R AK  V  S  Y YRDR+ KK DFR L
Sbjct: 1   MARVKRSVNAQKKRRETLERAKGYRGQRSRLYRKAKEQVIHSHVYNYRDRKAKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI G+  AG+ +DRK L++LA+ +  +F  +V+L++  L  D
Sbjct: 61  WIQRINAAVRAEGMTYNRFIQGIKAAGVEVDRKNLAELAVHEPAAFSALVQLAKDNLPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|167767666|ref|ZP_02439719.1| hypothetical protein CLOSS21_02199 [Clostridium sp. SS2/1]
 gi|317499153|ref|ZP_07957430.1| ribosomal protein L20 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167710683|gb|EDS21262.1| hypothetical protein CLOSS21_02199 [Clostridium sp. SS2/1]
 gi|291560800|emb|CBL39600.1| LSU ribosomal protein L20P [butyrate-producing bacterium SSC/2]
 gi|316893566|gb|EFV15771.1| ribosomal protein L20 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 118

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGMNAKKKHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F++GL  AG+ ++RK+LS++AI++ ++FK +V++++ +L 
Sbjct: 61  WIARINAATRMNGLSYSKFMHGLKLAGVDINRKMLSEMAISEPEAFKALVDVAKEKLA 118


>gi|160934428|ref|ZP_02081815.1| hypothetical protein CLOLEP_03301 [Clostridium leptum DSM 753]
 gi|156867101|gb|EDO60473.1| hypothetical protein CLOLEP_03301 [Clostridium leptum DSM 753]
          Length = 117

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  + +  + KK+LK AKG++G +    + AK AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKGALATRKRRKKILKLAKGYWGSKSRHFKMAKQAVMKSGNYAYIGRKQRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA +   +NYS F+NGL KA I L+RK+LS++AI    +F  +VE +++ L
Sbjct: 61  WITRISAACKANGVNYSTFMNGLKKANIELNRKMLSEIAIADPAAFTSLVEKAKAAL 117


>gi|297571532|ref|YP_003697306.1| ribosomal protein L20 [Arcanobacterium haemolyticum DSM 20595]
 gi|296931879|gb|ADH92687.1| ribosomal protein L20 [Arcanobacterium haemolyticum DSM 20595]
          Length = 126

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 75/123 (60%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V S  K + VL+ A G+ G+R    R AK  V  S  Y YRDR+V+K +FR L
Sbjct: 1   MARVKNAVNSKKKRRTVLERASGYRGQRSRLYRKAKEQVTHSFVYNYRDRKVRKNEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINA  R   + Y++F+ GL  AGI LDR++L+++A+    +F  +VE +R  L  D
Sbjct: 61  WIARINAGARANGMTYNRFMQGLKLAGIELDRRMLAEMAVNDPAAFTSVVEAARKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|282927809|ref|ZP_06335420.1| 50S ribosomal protein L20 [Staphylococcus aureus A10102]
 gi|282590319|gb|EFB95398.1| 50S ribosomal protein L20 [Staphylococcus aureus A10102]
          Length = 118

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK  V +S QYA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRARRKKKIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R ++++YS+ +NGL KAGI ++RK+LS++AI+   +F ++V  ++  L
Sbjct: 61  WITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAISDEKAFAQLVTKAKDAL 117


>gi|68171433|ref|ZP_00544823.1| Ribosomal protein L20, bacterial and organelle form [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88658511|ref|YP_507021.1| 50S ribosomal protein L20 [Ehrlichia chaffeensis str. Arkansas]
 gi|109893114|sp|Q2GHR2|RL20_EHRCR RecName: Full=50S ribosomal protein L20
 gi|67999153|gb|EAM85813.1| Ribosomal protein L20, bacterial and organelle form [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599968|gb|ABD45437.1| ribosomal protein L20 [Ehrlichia chaffeensis str. Arkansas]
          Length = 124

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K AKG+ GR KN  R A   V+++ QYAYRDRR +KR FRSL
Sbjct: 1   MARVKRGVTTRARHKKVIKLAKGYRGRSKNCYRIALQRVEKALQYAYRDRRNRKRFFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR + L YS FI+GL  A + L+RKVL+D+A+   D FK+IV+L +  L
Sbjct: 61  WIMRINAAVRQHGLLYSDFIHGLSLANVTLNRKVLADMAVNHKDHFKQIVDLIKEAL 117


>gi|323339583|ref|ZP_08079857.1| 50S ribosomal protein L20 [Lactobacillus ruminis ATCC 25644]
 gi|323092978|gb|EFZ35576.1| 50S ribosomal protein L20 [Lactobacillus ruminis ATCC 25644]
          Length = 119

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+ G +    + AK  V +S QYA+RDRR  K +FR L
Sbjct: 1   MPRVKGGTVTRQRRKKVLKLAKGYRGSKHTQFKVAKQQVMKSYQYAFRDRRKNKSNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  ++YSQ ++GL  A I ++RK+L+DLAIT   +F  +VE ++  L 
Sbjct: 61  WIARINAAARMNGISYSQLMHGLKLANIEVNRKMLADLAITDAAAFTAVVEEAKKALA 118


>gi|319780186|ref|YP_004139662.1| ribosomal protein L20 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166074|gb|ADV09612.1| ribosomal protein L20 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 133

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 72/106 (67%), Positives = 88/106 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKGFYGRRKNTIR AK AV++S QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAA   + L Y +FI+GL+K+GI +DRK+LSD+AI +  +F
Sbjct: 61  WIQRINAATHEHGLTYGRFIDGLNKSGIEIDRKILSDMAIHEPQAF 106


>gi|227824127|ref|YP_002828100.1| 50S ribosomal protein L20 [Sinorhizobium fredii NGR234]
 gi|254800334|sp|C3MCP9|RL20_RHISN RecName: Full=50S ribosomal protein L20
 gi|227343129|gb|ACP27347.1| 50S ribosomal protein L20 [Sinorhizobium fredii NGR234]
          Length = 134

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 99/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKK LK+AKGFYGRRKNTIRAAKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKTLKAAKGFYGRRKNTIRAAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE S+  L 
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEASKKALA 118


>gi|218283434|ref|ZP_03489442.1| hypothetical protein EUBIFOR_02031 [Eubacterium biforme DSM 3989]
 gi|218215863|gb|EEC89401.1| hypothetical protein EUBIFOR_02031 [Eubacterium biforme DSM 3989]
          Length = 119

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 77/119 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G VS A+ KKVLK AKG++G +    + A   V  S +YAY DRR  K + R +
Sbjct: 1   MARVKGGTVSRARRKKVLKLAKGYFGSKHTLYKTANEQVMHSFRYAYNDRRKLKGNMRKI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+ DL+YS+ ++GL  A I ++RK+LS++AI   + F K+ E +++ L  
Sbjct: 61  WITRINAAARMNDLSYSRLMHGLKLANIAINRKMLSEMAIHDAEGFTKLCEEAKAALNA 119


>gi|27262224|gb|AAN87393.1| LSU ribosomal protein L20P [Heliobacillus mobilis]
          Length = 118

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G +S  +HKK+LK A+G+        R A  +V ++ QYAY  RR KK DFR L
Sbjct: 1   MARVKTGPMSRKRHKKILKLARGYRNAHSKLFRTAHQSVMKALQYAYAHRRKKKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  +NGL KAG+V++RK+L+DLA+  L +F K+V++++ +L
Sbjct: 61  WITRINAAARMNGISYSNMMNGLKKAGVVVNRKMLADLAVNDLPAFAKLVDVAKGQL 117


>gi|13474219|ref|NP_105787.1| 50S ribosomal protein L20 [Mesorhizobium loti MAFF303099]
 gi|260463245|ref|ZP_05811447.1| ribosomal protein L20 [Mesorhizobium opportunistum WSM2075]
 gi|20978642|sp|Q98CP8|RL20_RHILO RecName: Full=50S ribosomal protein L20
 gi|14024971|dbj|BAB51573.1| ribosomal protein L20 [Mesorhizobium loti MAFF303099]
 gi|259031095|gb|EEW32369.1| ribosomal protein L20 [Mesorhizobium opportunistum WSM2075]
          Length = 133

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 73/106 (68%), Positives = 88/106 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKGFYGRRKNTIR AK AV++S QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGFYGRRKNTIRIAKQAVEKSLQYAYRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAA   + L Y +FI+GL+KAGI +DRK+LSD+AI +  +F
Sbjct: 61  WIQRINAATHEHGLTYGRFIDGLNKAGIEIDRKILSDMAIHEPQAF 106


>gi|312143806|ref|YP_003995252.1| ribosomal protein L20 [Halanaerobium sp. 'sapolanicus']
 gi|311904457|gb|ADQ14898.1| ribosomal protein L20 [Halanaerobium sp. 'sapolanicus']
          Length = 119

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  + KKVLK AKG++G R    R A  AV +S  YAY DR+ KKR+FR L
Sbjct: 1   MPRVKRGNKARKRRKKVLKMAKGYFGSRSKLFRPANQAVMKSLHYAYVDRKKKKRNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL +A + +DRK+L+DLA+   D+F  +V L++ +L
Sbjct: 61  WITRINAAARQEGLSYSRFINGLRQAEVEIDRKMLADLAVNDSDAFSDLVGLAKEQL 117


>gi|227501818|ref|ZP_03931867.1| 50S ribosomal protein L20 [Corynebacterium accolens ATCC 49725]
 gi|306835996|ref|ZP_07468988.1| 50S ribosomal protein L20 [Corynebacterium accolens ATCC 49726]
 gi|227077843|gb|EEI15806.1| 50S ribosomal protein L20 [Corynebacterium accolens ATCC 49725]
 gi|304568162|gb|EFM43735.1| 50S ribosomal protein L20 [Corynebacterium accolens ATCC 49726]
          Length = 127

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A + +DRK+L++LA+   ++F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLRLAEVEVDRKILAELAVNDFEAFSALCETAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|288959441|ref|YP_003449782.1| large subunit ribosomal protein L20 [Azospirillum sp. B510]
 gi|288911749|dbj|BAI73238.1| large subunit ribosomal protein L20 [Azospirillum sp. B510]
          Length = 123

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 66/112 (58%), Positives = 83/112 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+LK AKG+ GR     R A   V+++ +YAYRDRR KKRDFR L
Sbjct: 1   MARVKRGVTTHARHRKILKLAKGYRGRNSKNFRIAIEKVEKALRYAYRDRRNKKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVEL 112
           WIQRINA VR Y L YS+FING+  AGI +DRKVLSDLA  + ++FK +V+ 
Sbjct: 61  WIQRINAGVRQYGLTYSRFINGIKLAGIEIDRKVLSDLAAREPEAFKTLVDK 112


>gi|331701567|ref|YP_004398526.1| 50S ribosomal protein L20 [Lactobacillus buchneri NRRL B-30929]
 gi|329128910|gb|AEB73463.1| 50S ribosomal protein L20 [Lactobacillus buchneri NRRL B-30929]
          Length = 118

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ K+VLK AKG+ G +    + AK  V +SQ YA+RDRR  K +FR L
Sbjct: 1   MPRVKGGTVTHARRKRVLKLAKGYRGGKSRLFKTAKDQVMKSQVYAFRDRRNNKGNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ DL+YSQF++GL  A I ++RK+L+DLA++  ++FK + + ++  L
Sbjct: 61  WIARINAAARLNDLSYSQFMHGLKLANIDMNRKMLADLAVSDTEAFKALTDEAKKAL 117


>gi|311894941|dbj|BAJ27349.1| putative ribosomal protein L20 [Kitasatospora setae KM-6054]
          Length = 128

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y + DR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVILERASGYRGQRSRLYRKAKEQVTHSLVYNFNDRKKRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++F+ GL  AG+ +DRK+L++LA+    +F+ +VE+++  L  D
Sbjct: 61  WIQRINAAARANGITYNRFVQGLKAAGVEIDRKMLAELAVNDSVAFRALVEVAQKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|77919022|ref|YP_356837.1| 50S ribosomal protein L20 [Pelobacter carbinolicus DSM 2380]
 gi|109893131|sp|Q3A4P0|RL20_PELCD RecName: Full=50S ribosomal protein L20
 gi|77545105|gb|ABA88667.1| LSU ribosomal protein L20P [Pelobacter carbinolicus DSM 2380]
          Length = 118

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARRRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA+ R   L+YS+ ++GL KA I LDRK+L++LA+T    F  I + ++++L
Sbjct: 61  WIARINASARENGLSYSRLVHGLKKAEIALDRKILAELAVTDPAGFTAIADKAKAQL 117


>gi|302670150|ref|YP_003830110.1| ribosomal protein L20 RplT [Butyrivibrio proteoclasticus B316]
 gi|302394623|gb|ADL33528.1| ribosomal protein L20 RplT [Butyrivibrio proteoclasticus B316]
          Length = 118

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  + +  KH +VLK AKG+ G R    R AK +V R+   A+  R+ KKRD RSL
Sbjct: 1   MARVKGALNAKKKHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSAFAGRKQKKRDMRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS  ++GL  AG+ ++RK+L++LA+   D FK + EL++ ++ 
Sbjct: 61  WITRINAAARINGLSYSNMMHGLKLAGVDINRKMLAELAVNDPDGFKTLAELAKEKIA 118


>gi|116670040|ref|YP_830973.1| 50S ribosomal protein L20 [Arthrobacter sp. FB24]
 gi|215274795|sp|A0JV03|RL20_ARTS2 RecName: Full=50S ribosomal protein L20
 gi|116610149|gb|ABK02873.1| LSU ribosomal protein L20P [Arthrobacter sp. FB24]
          Length = 157

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ AKG+ G+R    R AK  +  S  Y+Y DR+ KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAKGYRGQRSRLYRKAKEQLLHSFVYSYGDRKKKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL  A + +DR++L++LA++  ++F  +V++++  L  D
Sbjct: 61  WIQRINAASRANGLTYNRLIQGLKAAEVEVDRRMLAELAVSDANAFAALVQVAKDSLPAD 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|15827731|ref|NP_301994.1| 50S ribosomal protein L20 [Mycobacterium leprae TN]
 gi|221230208|ref|YP_002503624.1| 50S ribosomal protein L20 [Mycobacterium leprae Br4923]
 gi|13633838|sp|Q9CC20|RL20_MYCLE RecName: Full=50S ribosomal protein L20
 gi|254800332|sp|B8ZRJ7|RL20_MYCLB RecName: Full=50S ribosomal protein L20
 gi|13093282|emb|CAC31777.1| 50S ribosomal protein L20 [Mycobacterium leprae]
 gi|219933315|emb|CAR71491.1| 50S ribosomal protein L20 [Mycobacterium leprae Br4923]
          Length = 129

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 78/122 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLGYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  A + +DRK L+D+AI+   +F  +VE++RS L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAADVDVDRKNLADIAISDPAAFTALVEVARSGLPED 120

Query: 121 VA 122
           V 
Sbjct: 121 VN 122


>gi|295690593|ref|YP_003594286.1| 50S 50S ribosomal protein L20 [Caulobacter segnis ATCC 21756]
 gi|295432496|gb|ADG11668.1| ribosomal protein L20 [Caulobacter segnis ATCC 21756]
          Length = 118

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 79/118 (66%), Positives = 93/118 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVL+ AKGFYGRRKNTIR AKAAVD++ QYAYRDR+V+KR FRSL
Sbjct: 1   MARVKRGVVAHAKHKKVLEQAKGFYGRRKNTIRTAKAAVDKAGQYAYRDRKVRKRAFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINA  R+    YSQFI+GL  AGIV+DRKVL+D+A     +FK I +  R+ L 
Sbjct: 61  WIQRINAGARLEGFTYSQFIHGLDVAGIVMDRKVLADIAGADPVAFKAIADKVRAALA 118


>gi|83944915|ref|ZP_00957281.1| 50S ribosomal protein L20 [Oceanicaulis alexandrii HTCC2633]
 gi|83851697|gb|EAP89552.1| 50S ribosomal protein L20 [Oceanicaulis alexandrii HTCC2633]
          Length = 119

 Score =  150 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV  G    A+ KK++  AKG+YGRRKNT R A  AV+++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVSSGPARHARKKKIISQAKGYYGRRKNTFRTANQAVEKAGQYAYRDRRAKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R+ D  Y++F++GL+KAGI LDRKVL+D+A+ + ++F  +V  ++  L
Sbjct: 61  WIQRINAAARLNDFTYARFMDGLNKAGIELDRKVLADIAVHEPEAFASLVAQAKQAL 117


>gi|319898275|ref|YP_004158368.1| 50S ribosomal protein L20 [Bartonella clarridgeiae 73]
 gi|319402239|emb|CBI75772.1| 50S ribosomal protein L20 [Bartonella clarridgeiae 73]
          Length = 133

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 78/118 (66%), Positives = 94/118 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKK+LK A+GFYGRRKNTIRAAK AVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKILKQAEGFYGRRKNTIRAAKTAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVRV  L Y +FI+GL KAGI +DRK+LSD+AI +   F  +V  ++  L 
Sbjct: 61  WIQRINAAVRVEGLTYGRFIDGLSKAGIKIDRKILSDIAINEPTIFNALVASAKKALE 118


>gi|88810668|ref|ZP_01125925.1| ribosomal protein L20 [Nitrococcus mobilis Nb-231]
 gi|88792298|gb|EAR23408.1| ribosomal protein L20 [Nitrococcus mobilis Nb-231]
          Length = 118

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 69/117 (58%), Positives = 93/117 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ ++HKK+L  AKG+YG R+ T RAAK AV R+ QYAYRDRR +KR+FRSL
Sbjct: 1   MARVKRGVIAHSRHKKILGKAKGYYGARRKTFRAAKQAVIRAGQYAYRDRRQRKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAA R++ L+YS+ I+GLHKAGI +DRKVL+DLA+  +  F  + + +++ L
Sbjct: 61  WIQRINAAARLHGLSYSRLIDGLHKAGIEIDRKVLADLAVHDMAGFAGLADRAKAGL 117


>gi|262091709|gb|ACY25299.1| LSU ribosomal protein L20P [uncultured actinobacterium]
          Length = 118

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  KHK +L+ AKG+YG R  T R+A   V  S QYA+RDRR KK +FRSL
Sbjct: 1   MARVKRAVHARKKHKAILEKAKGYYGDRSRTFRSANEQVLHSGQYAFRDRRAKKGEFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINA  R  D +YS+ I GL KAG+ +DRK+L+DLA+    +F KIVE ++  L+
Sbjct: 61  WIQRINAGCRQNDFSYSRLIAGLTKAGVTVDRKILADLAVHDAAAFAKIVETAKGALV 118


>gi|120404300|ref|YP_954129.1| 50S ribosomal protein L20 [Mycobacterium vanbaalenii PYR-1]
 gi|166219667|sp|A1TAC3|RL20_MYCVP RecName: Full=50S ribosomal protein L20
 gi|119957118|gb|ABM14123.1| LSU ribosomal protein L20P [Mycobacterium vanbaalenii PYR-1]
          Length = 129

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRALNAQKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+++A++   +F  +VE++++ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLAEIAVSDPAAFTALVEVAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|27904625|ref|NP_777751.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|31076929|sp|Q89AV8|RL20_BUCBP RecName: Full=50S ribosomal protein L20
 gi|27904022|gb|AAO26856.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 126

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M  VKRGV++ A+HKKVLK AKG+YG R  T R A+ A+ ++ QY+YRDRR +KR FR L
Sbjct: 1   MAHVKRGVIARARHKKVLKQAKGYYGARSRTYRTARQAIIKAGQYSYRDRRQRKRYFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   ++YS+F+ GL KA I +DRK+LS+LAI    SF  +++ S+  L
Sbjct: 61  WITRINAAVRENQISYSKFMYGLKKASIAVDRKMLSELAIFDNVSFCSLIKSSKDAL 117


>gi|94984681|ref|YP_604045.1| 50S ribosomal protein L20 [Deinococcus geothermalis DSM 11300]
 gi|166219638|sp|Q1J0V8|RL20_DEIGD RecName: Full=50S ribosomal protein L20
 gi|94554962|gb|ABF44876.1| ribosomal protein L20 [Deinococcus geothermalis DSM 11300]
          Length = 119

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 79/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKKVLK AKGF+G R    R A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MPRVKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WIQRINA  R++ +NYS FINGL  AG+ L+RKVL+D+A  + ++F+ +V  ++  
Sbjct: 61  WIQRINAGARLHGMNYSTFINGLKVAGVDLNRKVLADIAAREPEAFQVLVNTAKGA 116


>gi|315122258|ref|YP_004062747.1| ribosomal protein L20 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495660|gb|ADR52259.1| ribosomal protein L20 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 118

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 97/117 (82%), Positives = 108/117 (92%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRGVVS+AKHKKVLK AKGFYGRRKNTIR AKAAVDRS+QYAYRDRRVKKRDFRSL
Sbjct: 1   MTRVKRGVVSNAKHKKVLKLAKGFYGRRKNTIRTAKAAVDRSRQYAYRDRRVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR+YDLNYSQFINGL KAGI LDR+ LS+LAI +  SF+KIV++S++ L
Sbjct: 61  WIQRINAAVRLYDLNYSQFINGLQKAGITLDRRTLSELAIEKPGSFEKIVDVSKANL 117


>gi|15608781|ref|NP_216159.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis H37Rv]
 gi|15841099|ref|NP_336136.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis CDC1551]
 gi|31792830|ref|NP_855323.1| 50S ribosomal protein L20 [Mycobacterium bovis AF2122/97]
 gi|121637551|ref|YP_977774.1| 50S ribosomal protein L20 [Mycobacterium bovis BCG str. Pasteur
           1173P2]
 gi|148661439|ref|YP_001282962.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis H37Ra]
 gi|148822851|ref|YP_001287605.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis F11]
 gi|167968403|ref|ZP_02550680.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis H37Ra]
 gi|215404055|ref|ZP_03416236.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis 02_1987]
 gi|215411289|ref|ZP_03420097.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis 94_M4241A]
 gi|215426962|ref|ZP_03424881.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T92]
 gi|215430535|ref|ZP_03428454.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis EAS054]
 gi|215445824|ref|ZP_03432576.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T85]
 gi|218753349|ref|ZP_03532145.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis GM 1503]
 gi|219557562|ref|ZP_03536638.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T17]
 gi|224990026|ref|YP_002644713.1| 50S ribosomal protein L20 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253799317|ref|YP_003032318.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN
           1435]
 gi|254231844|ref|ZP_04925171.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis C]
 gi|254364492|ref|ZP_04980538.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254550649|ref|ZP_05141096.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis '98-R604
           INH-RIF-EM']
 gi|260200706|ref|ZP_05768197.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T46]
 gi|260204912|ref|ZP_05772403.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis K85]
 gi|289443097|ref|ZP_06432841.1| LSU ribosomal protein L20 [Mycobacterium tuberculosis T46]
 gi|289554582|ref|ZP_06443792.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN 605]
 gi|289569690|ref|ZP_06449917.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis T17]
 gi|289574312|ref|ZP_06454539.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis K85]
 gi|289745919|ref|ZP_06505297.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis 02_1987]
 gi|289750191|ref|ZP_06509569.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis T92]
 gi|289753731|ref|ZP_06513109.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis EAS054]
 gi|289757747|ref|ZP_06517125.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T85]
 gi|289761794|ref|ZP_06521172.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis GM 1503]
 gi|294996593|ref|ZP_06802284.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis 210]
 gi|297634196|ref|ZP_06951976.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis KZN 4207]
 gi|297731183|ref|ZP_06960301.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis KZN R506]
 gi|298525141|ref|ZP_07012550.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis
           94_M4241A]
 gi|306775830|ref|ZP_07414167.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu001]
 gi|306779643|ref|ZP_07417980.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu002]
 gi|306784374|ref|ZP_07422696.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu003]
 gi|306788743|ref|ZP_07427065.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu004]
 gi|306793079|ref|ZP_07431381.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu005]
 gi|306797460|ref|ZP_07435762.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu006]
 gi|306803339|ref|ZP_07440007.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu008]
 gi|306807921|ref|ZP_07444589.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu007]
 gi|306971936|ref|ZP_07484597.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu010]
 gi|307079652|ref|ZP_07488822.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu011]
 gi|307084224|ref|ZP_07493337.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu012]
 gi|313658515|ref|ZP_07815395.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis KZN V2475]
 gi|54039126|sp|P66106|RL20_MYCBO RecName: Full=50S ribosomal protein L20
 gi|54041830|sp|P66105|RL20_MYCTU RecName: Full=50S ribosomal protein L20
 gi|166219661|sp|A1KJ60|RL20_MYCBP RecName: Full=50S ribosomal protein L20
 gi|166219665|sp|A5U300|RL20_MYCTA RecName: Full=50S ribosomal protein L20
 gi|254800331|sp|C1ANR6|RL20_MYCBT RecName: Full=50S ribosomal protein L20
 gi|1838994|emb|CAB06637.1| Probable 50S ribosomal protein L20 RplT [Mycobacterium tuberculosis
           H37Rv]
 gi|13881314|gb|AAK45950.1| ribosomal protein L20 [Mycobacterium tuberculosis CDC1551]
 gi|31618420|emb|CAD96338.1| 50S ribosomal protein L20 rplT [Mycobacterium bovis AF2122/97]
 gi|121493198|emb|CAL71669.1| 50S ribosomal protein L20 rplT [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|124600903|gb|EAY59913.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis C]
 gi|134150006|gb|EBA42051.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148505591|gb|ABQ73400.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis H37Ra]
 gi|148721378|gb|ABR06003.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis F11]
 gi|224773139|dbj|BAH25945.1| 50S ribosomal protein L20 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253320820|gb|ACT25423.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN
           1435]
 gi|289416016|gb|EFD13256.1| LSU ribosomal protein L20 [Mycobacterium tuberculosis T46]
 gi|289439214|gb|EFD21707.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN 605]
 gi|289538743|gb|EFD43321.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis K85]
 gi|289543444|gb|EFD47092.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis T17]
 gi|289686447|gb|EFD53935.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis 02_1987]
 gi|289690778|gb|EFD58207.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis T92]
 gi|289694318|gb|EFD61747.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis EAS054]
 gi|289709300|gb|EFD73316.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis GM 1503]
 gi|289713311|gb|EFD77323.1| 50S ribosomal protein L20 [Mycobacterium tuberculosis T85]
 gi|298494935|gb|EFI30229.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis
           94_M4241A]
 gi|308215745|gb|EFO75144.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu001]
 gi|308327412|gb|EFP16263.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu002]
 gi|308330922|gb|EFP19773.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu003]
 gi|308334692|gb|EFP23543.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu004]
 gi|308338534|gb|EFP27385.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu005]
 gi|308342204|gb|EFP31055.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu006]
 gi|308345730|gb|EFP34581.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu007]
 gi|308350030|gb|EFP38881.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu008]
 gi|308358623|gb|EFP47474.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu010]
 gi|308362549|gb|EFP51400.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu011]
 gi|308366169|gb|EFP55020.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu012]
 gi|323719904|gb|EGB29017.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis
           CDC1551A]
 gi|326903258|gb|EGE50191.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis W-148]
 gi|328459068|gb|AEB04491.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis KZN
           4207]
          Length = 129

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK+++G+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  AG+ +DRK L+D+AI+   +F  +V+++R+ L  D
Sbjct: 61  WIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|58584914|ref|YP_198487.1| 50S ribosomal protein L20 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|81311613|sp|Q5GRX9|RL20_WOLTR RecName: Full=50S ribosomal protein L20
 gi|58419230|gb|AAW71245.1| Ribosomal protein L20 [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 121

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 62/120 (51%), Positives = 85/120 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+ GR K+  R A   V+++ QYAYRDRR +KRDFRSL
Sbjct: 1   MARVKRGVTTHARHKKILNLAKGYRGRAKSCYRIALQRVEKALQYAYRDRRNRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R + L Y +F++GL  AG+ L+RK+L+++A+   D F K+ E   S+L  +
Sbjct: 61  WIIRINAAAREHGLTYGRFMHGLALAGVDLNRKILAEMAVNYKDDFTKLAETVSSKLAEN 120


>gi|52842918|ref|YP_096717.1| 50S ribosomal protein L20 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54295553|ref|YP_127968.1| 50S ribosomal protein L20 [Legionella pneumophila str. Lens]
 gi|54298703|ref|YP_125072.1| 50S ribosomal protein L20 [Legionella pneumophila str. Paris]
 gi|148358551|ref|YP_001249758.1| 50S ribosomal protein L20 [Legionella pneumophila str. Corby]
 gi|296108360|ref|YP_003620061.1| large subunit ribosomal protein L20 [Legionella pneumophila 2300/99
           Alcoy]
 gi|81822306|sp|Q5WT85|RL20_LEGPL RecName: Full=50S ribosomal protein L20
 gi|81822499|sp|Q5X1H6|RL20_LEGPA RecName: Full=50S ribosomal protein L20
 gi|81823336|sp|Q5ZS07|RL20_LEGPH RecName: Full=50S ribosomal protein L20
 gi|166219657|sp|A5IAL2|RL20_LEGPC RecName: Full=50S ribosomal protein L20
 gi|52630029|gb|AAU28770.1| 50S ribosomal protein L20 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53752488|emb|CAH13920.1| 50S ribosomal protein L20 [Legionella pneumophila str. Paris]
 gi|53755385|emb|CAH16881.1| 50S ribosomal protein L20 [Legionella pneumophila str. Lens]
 gi|148280324|gb|ABQ54412.1| 50S ribosomal protein L20 [Legionella pneumophila str. Corby]
 gi|295650262|gb|ADG26109.1| large subunit ribosomal protein L20 [Legionella pneumophila 2300/99
           Alcoy]
 gi|307611589|emb|CBX01271.1| 50S ribosomal protein L20 [Legionella pneumophila 130b]
          Length = 119

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 62/106 (58%), Positives = 77/106 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L  AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVTAKARHKKILDQAKGYYGARSRTYRVAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINA  R   L+YS+ I+GL KA I LDRK+L+D+A+    +F
Sbjct: 61  WITRINAQARECGLSYSRLIDGLKKASIELDRKILADMAVHDKVAF 106


>gi|319949972|ref|ZP_08023961.1| 50S ribosomal protein L20 [Dietzia cinnamea P4]
 gi|319436368|gb|EFV91499.1| 50S ribosomal protein L20 [Dietzia cinnamea P4]
          Length = 126

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+S KG+ G+R    R AK  +  S  Y+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTVLESTKGYRGQRSRLYRKAKEQMLHSMTYSYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++F+ GL  AG+ +DRKVL+DLA+T   +F  +VE++R  L  D
Sbjct: 61  WISRINAAARANDMTYNRFVQGLKLAGVEVDRKVLADLAVTDPAAFTALVEVARKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|88855452|ref|ZP_01130116.1| 50S ribosomal protein L20 [marine actinobacterium PHSC20C1]
 gi|88815359|gb|EAR25217.1| 50S ribosomal protein L20 [marine actinobacterium PHSC20C1]
          Length = 128

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ AKG+ G+R    R AK  V  S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAKGYRGQRSRLYRKAKEQVTHSLVYAYRDRRARKGEFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL+ AG+ +DR++L+DLA+T+  +F  +V  +++ L  D
Sbjct: 61  WIQRINAASRANGLTYNRLIQGLNLAGVQVDRRILADLAVTEPATFASLVATAKAALPAD 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|240849766|ref|YP_002971154.1| 50S ribosomal protein L20 [Bartonella grahamii as4aup]
 gi|240266889|gb|ACS50477.1| 50S ribosomal protein L20 [Bartonella grahamii as4aup]
          Length = 133

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 80/118 (67%), Positives = 96/118 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVRAEGLTYGRFIDGLSKAGIEVDRKVLSDIAIHEAEAFSALVASAKKALE 118


>gi|149187101|ref|ZP_01865406.1| 50S ribosomal protein L20 [Erythrobacter sp. SD-21]
 gi|148829253|gb|EDL47699.1| 50S ribosomal protein L20 [Erythrobacter sp. SD-21]
          Length = 119

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 69/119 (57%), Positives = 92/119 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGV +  KHK++L  AKG+ GRRKNTIR A+ AV+++ QYAYRDR+VKKR+FR+L
Sbjct: 1   MPRIKRGVTTRQKHKRLLDQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAAVR   L YSQF++G   AGI LDRKV++DLA+ +  +FK I++ ++  L  
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGTKLAGIELDRKVMADLAMNEGAAFKAIIDQAKKALPA 119


>gi|37522353|ref|NP_925730.1| 50S ribosomal protein L20 [Gloeobacter violaceus PCC 7421]
 gi|39931741|sp|Q7NGV3|RL20_GLOVI RecName: Full=50S ribosomal protein L20
 gi|35213353|dbj|BAC90725.1| 50S ribosomal protein L20 [Gloeobacter violaceus PCC 7421]
          Length = 119

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 79/119 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+  + KK+LK AKGF G       AA   V ++ + AYR RR KKRDFRSL
Sbjct: 1   MVRVKRGNVARKRRKKILKLAKGFRGSHSKLFTAANQQVMKALRNAYRHRRTKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+ I+GLHKA + L+RK+L+ LA+T  ++F ++  +++S   V
Sbjct: 61  WIVRINAQARTEGLSYSRLIDGLHKADVALNRKMLAQLAVTDPEAFAEVARVAKSARPV 119


>gi|95930293|ref|ZP_01313031.1| ribosomal protein L20 [Desulfuromonas acetoxidans DSM 684]
 gi|95133756|gb|EAT15417.1| ribosomal protein L20 [Desulfuromonas acetoxidans DSM 684]
          Length = 118

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YAYRDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARRRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAYRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   LNYS+ ++GL +A + LDRKVL+++A+T   +F  +VE +++++
Sbjct: 61  WIARINAAARQNGLNYSRLVHGLKQAEVGLDRKVLAEIAVTDPAAFTAVVEKAKAQI 117


>gi|304373305|ref|YP_003856514.1| 50S ribosomal protein L20 [Mycoplasma hyorhinis HUB-1]
 gi|304309496|gb|ADM21976.1| 50S ribosomal protein L20 [Mycoplasma hyorhinis HUB-1]
 gi|330723821|gb|AEC46191.1| 50S ribosomal protein L20 [Mycoplasma hyorhinis MCLD]
          Length = 119

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ ++ KK LK AKG++G +    + AK AV +S  YA+RDR+  KRDFR LWI
Sbjct: 2   RVKGGTVTRSRRKKWLKLAKGYWGHKSVGYKVAKQAVVKSWTYAFRDRKQVKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R   L+YSQ +NGL K+ I ++RK+LS+LAI + ++F KIV   +  L
Sbjct: 62  SRINAASRSLGLSYSQLVNGLKKSNIEINRKMLSELAINEPETFAKIVSQVKGTL 116


>gi|258542127|ref|YP_003187560.1| 50S ribosomal protein L20 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114122|ref|ZP_08242884.1| 50S ribosomal protein L20 [Acetobacter pomorum DM001]
 gi|256633205|dbj|BAH99180.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636264|dbj|BAI02233.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639317|dbj|BAI05279.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642373|dbj|BAI08328.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645428|dbj|BAI11376.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648481|dbj|BAI14422.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651534|dbj|BAI17468.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654525|dbj|BAI20452.1| LSU ribosomal protein L20P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696198|gb|EGE47877.1| 50S ribosomal protein L20 [Acetobacter pomorum DM001]
          Length = 119

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL+ AKG+ GR     R A   V+++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTTLARHKKVLELAKGYRGRSSTNYRIALERVEKALRYAYRDRRNKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAAVR + L YS+FINGL KAGI +DRKVL+ +A     +F +IV+ +++ L  
Sbjct: 61  WIQRINAAVREHGLTYSRFINGLDKAGIEIDRKVLAAIAFDDAATFAEIVKKAQAALAA 119


>gi|184201211|ref|YP_001855418.1| 50S ribosomal protein L20 [Kocuria rhizophila DC2201]
 gi|226730411|sp|B2GKF3|RL20_KOCRD RecName: Full=50S ribosomal protein L20
 gi|183581441|dbj|BAG29912.1| 50S ribosomal protein L20 [Kocuria rhizophila DC2201]
          Length = 128

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL+ A G+ G+R    R AK  +  S  Y+Y DRR KK DFR L
Sbjct: 1   MARVKRAVNAHKKRREVLEKASGYRGQRSRLYRKAKEQMLHSYTYSYNDRRKKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++FI GL  A + +DR++L++LA++  ++F  +V++++  L  D
Sbjct: 61  WIQRINAASRANGLTYNRFIQGLKAAEVEVDRRMLAELAVSDENAFAALVQVAKDALPED 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|90961473|ref|YP_535389.1| 50S ribosomal protein L20 [Lactobacillus salivarius UCC118]
 gi|227890563|ref|ZP_04008368.1| 50S ribosomal protein L20 [Lactobacillus salivarius ATCC 11741]
 gi|301300335|ref|ZP_07206540.1| ribosomal protein L20 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|122449226|sp|Q1WUM9|RL20_LACS1 RecName: Full=50S ribosomal protein L20
 gi|90820667|gb|ABD99306.1| LSU ribosomal protein L20P [Lactobacillus salivarius UCC118]
 gi|227867501|gb|EEJ74922.1| 50S ribosomal protein L20 [Lactobacillus salivarius ATCC 11741]
 gi|300852071|gb|EFK79750.1| ribosomal protein L20 [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 120

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 53/120 (44%), Positives = 79/120 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK++K AKG+ G +    + AK  V +S QYA+RDRR  K +FR L
Sbjct: 1   MPRVKGGSVTRQRRKKIIKLAKGYRGAKHIQFKVAKQQVMKSYQYAFRDRRKTKSNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D++YS+ ++GL  A + ++RK+L+DLAIT   +F  +V+ ++  L  +
Sbjct: 61  WIARINAAARQNDISYSKLMHGLKLANVEVNRKMLADLAITDAAAFTALVDEAKKALAAE 120


>gi|261337540|ref|ZP_05965424.1| ribosomal protein L20 [Bifidobacterium gallicum DSM 20093]
 gi|270277946|gb|EFA23800.1| ribosomal protein L20 [Bifidobacterium gallicum DSM 20093]
          Length = 127

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ AKG+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRSVNAKKKRRVVLERAKGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L++LA++  D+FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAELAVSDADTFKAIVEQAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|224372470|ref|YP_002606842.1| 50S ribosomal protein L20 [Nautilia profundicola AmH]
 gi|254800333|sp|B9L884|RL20_NAUPA RecName: Full=50S ribosomal protein L20
 gi|223589353|gb|ACM93089.1| ribosomal protein L20 [Nautilia profundicola AmH]
          Length = 116

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 66/115 (57%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V   +HKK+LK AKGFY  R+   R AK  V+RS  YA+RDR+ KKRDFR LWI
Sbjct: 2   RVKTGTVRRKRHKKILKMAKGFYSGRRKHFRKAKEQVERSLVYAFRDRKQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D++YS+FINGL KA I LDRK+L+DLA+ + + F +IVE +++ L
Sbjct: 62  IRINAACRLNDISYSRFINGLKKANIDLDRKILADLAMNEPEVFAQIVEKAKAAL 116


>gi|163867392|ref|YP_001608586.1| 50S ribosomal protein L20 [Bartonella tribocorum CIP 105476]
 gi|189041849|sp|A9ILQ7|RL20_BART1 RecName: Full=50S ribosomal protein L20
 gi|161017033|emb|CAK00591.1| 50S ribosomal protein L20 [Bartonella tribocorum CIP 105476]
          Length = 133

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 80/118 (67%), Positives = 96/118 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  ++  L 
Sbjct: 61  WIQRINAAVRAEGLTYGRFIDGLSKAGIEVDRKVLSDIAIYEAEAFSALVASAKKALE 118


>gi|312795975|ref|YP_004028897.1| LSU ribosomal protein L20P [Burkholderia rhizoxinica HKI 454]
 gi|312167750|emb|CBW74753.1| LSU ribosomal protein L20P [Burkholderia rhizoxinica HKI 454]
          Length = 119

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK++  AKG+ GRR N  R AK AV R+ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVTARARHKKIINLAKGYRGRRNNVFRIAKQAVMRAGQYAYRDRRNKKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R +D+ YS F+NGL KA I LDRKVL+D+A+    +F  IV   ++ + 
Sbjct: 61  WIARINAAARQHDITYSVFMNGLKKASIELDRKVLADMAVFDKAAFAAIVAQVKAAVA 118


>gi|296270013|ref|YP_003652645.1| 50S ribosomal protein L20 [Thermobispora bispora DSM 43833]
 gi|296092800|gb|ADG88752.1| ribosomal protein L20 [Thermobispora bispora DSM 43833]
          Length = 129

 Score =  150 bits (380), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKR + +  K + +L+ A G+ G+R    R AK  V  S  YAYRDR+ +K  FR L
Sbjct: 1   MTRVKRALNAKKKRRVILEQASGYRGQRSRLYRKAKEQVLHSMTYAYRDRKDRKGAFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  AGI +DRK+L+DLA+    +F  +VE ++  L  D
Sbjct: 61  WIQRINAAARANGMTYNRFIQGLRLAGIEVDRKILADLAVNDAKTFATLVESAKKALPSD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|114319926|ref|YP_741609.1| 50S ribosomal protein L20P [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312211|sp|Q0AAL8|RL20_ALHEH RecName: Full=50S ribosomal protein L20
 gi|114226320|gb|ABI56119.1| LSU ribosomal protein L20P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 119

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 69/119 (57%), Positives = 88/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKH KVLK AKG+YG R+ + R A+ AV +S QYAYRDRR +KR FR+L
Sbjct: 1   MSRVKRGVTARAKHNKVLKKAKGYYGARRKSFRIARQAVIKSGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINA  R + L+YS+FINGL +AG+ LDRKVL+DLA+    +F  + E +R  L  
Sbjct: 61  WIQRINAGARQHGLSYSRFINGLQQAGVDLDRKVLADLAVNDKAAFGALAEKAREALAA 119


>gi|153872754|ref|ZP_02001553.1| Ribosomal protein L20 [Beggiatoa sp. PS]
 gi|152070780|gb|EDN68447.1| Ribosomal protein L20 [Beggiatoa sp. PS]
          Length = 137

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG+ G R    R AK AV ++ QYAYRDRR +KRDFR L
Sbjct: 18  MPRVKRGVTAHARHKKILKQAKGYRGARSRVFRVAKQAVIKAGQYAYRDRRQRKRDFRRL 77

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L YS+ INGL KAGI +DRK+L++LA+   D+F  I   ++  L 
Sbjct: 78  WIARINAAARECGLTYSRMINGLQKAGIEVDRKMLAELAVFNKDAFAAIANKAKLELE 135


>gi|71275164|ref|ZP_00651451.1| Ribosomal protein L20, bacterial and organelle form [Xylella
           fastidiosa Dixon]
 gi|71898245|ref|ZP_00680419.1| Ribosomal protein L20, bacterial and organelle form [Xylella
           fastidiosa Ann-1]
 gi|170731155|ref|YP_001776588.1| 50S ribosomal protein L20 [Xylella fastidiosa M12]
 gi|226730478|sp|B0U5E0|RL20_XYLFM RecName: Full=50S ribosomal protein L20
 gi|71163973|gb|EAO13688.1| Ribosomal protein L20, bacterial and organelle form [Xylella
           fastidiosa Dixon]
 gi|71731984|gb|EAO34041.1| Ribosomal protein L20, bacterial and organelle form [Xylella
           fastidiosa Ann-1]
 gi|167965948|gb|ACA12958.1| 50S ribosomal protein L20 [Xylella fastidiosa M12]
          Length = 119

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 62/119 (52%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILSLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+ K GI LDRK+L+D+A+     F  + E ++S L  
Sbjct: 61  WIVRINAAARINGLSYSRFMNGILKCGITLDRKMLADIAVHDPAGFTALAEKAKSMLAA 119


>gi|99082353|ref|YP_614507.1| 50S ribosomal protein L20 [Ruegeria sp. TM1040]
 gi|122397588|sp|Q1GDM1|RL20_SILST RecName: Full=50S ribosomal protein L20
 gi|99038633|gb|ABF65245.1| LSU ribosomal protein L20P [Ruegeria sp. TM1040]
          Length = 121

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 71/121 (58%), Positives = 96/121 (79%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV  ++  L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVRQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|296284910|ref|ZP_06862908.1| 50S ribosomal protein L20 [Citromicrobium bathyomarinum JL354]
          Length = 119

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 69/119 (57%), Positives = 92/119 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGV +  KHK++L  AKG+ GRRKNTIR A+ AV+++ QYAYRDR+VKKR+FR+L
Sbjct: 1   MPRIKRGVTTRQKHKRLLDQAKGYRGRRKNTIRVARQAVEKAGQYAYRDRKVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAAVR   L YSQF++G   AGI LDRKV++DLA+ +  +FK I++ ++  L  
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGTKLAGIELDRKVMADLAMNEEAAFKAIIKQAKDALPA 119


>gi|217977996|ref|YP_002362143.1| 50S ribosomal protein L20 [Methylocella silvestris BL2]
 gi|254800330|sp|B8EM00|RL20_METSB RecName: Full=50S ribosomal protein L20
 gi|217503372|gb|ACK50781.1| ribosomal protein L20 [Methylocella silvestris BL2]
          Length = 119

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 86/119 (72%), Positives = 99/119 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK L++AKGFYGRRKNTIRAAKAAVDRS QYA RDRR KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLEAAKGFYGRRKNTIRAAKAAVDRSMQYATRDRRAKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQR+NAAVR   L YS+FI+GL KAG+ +DRKVLSDLAITQ ++FK IV+ ++S L  
Sbjct: 61  WIQRLNAAVRECGLTYSRFIDGLAKAGVAVDRKVLSDLAITQPEAFKAIVDKAKSALPA 119


>gi|148381084|ref|YP_001255625.1| ribosomal protein L20 [Clostridium botulinum A str. ATCC 3502]
 gi|153933539|ref|YP_001385457.1| 50S ribosomal protein L20 [Clostridium botulinum A str. ATCC 19397]
 gi|153937482|ref|YP_001388864.1| 50S ribosomal protein L20 [Clostridium botulinum A str. Hall]
 gi|153939362|ref|YP_001392412.1| 50S ribosomal protein L20 [Clostridium botulinum F str. Langeland]
 gi|170757574|ref|YP_001782769.1| 50S ribosomal protein L20 [Clostridium botulinum B1 str. Okra]
 gi|170761601|ref|YP_001788454.1| 50S ribosomal protein L20 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|187776943|ref|ZP_02993416.1| hypothetical protein CLOSPO_00487 [Clostridium sporogenes ATCC
           15579]
 gi|226950565|ref|YP_002805656.1| ribosomal protein L20 [Clostridium botulinum A2 str. Kyoto]
 gi|237796591|ref|YP_002864143.1| 50S ribosomal protein L20 [Clostridium botulinum Ba4 str. 657]
 gi|166219632|sp|A7FY84|RL20_CLOB1 RecName: Full=50S ribosomal protein L20
 gi|166219633|sp|A5I6L5|RL20_CLOBH RecName: Full=50S ribosomal protein L20
 gi|166219634|sp|A7GI02|RL20_CLOBL RecName: Full=50S ribosomal protein L20
 gi|226730378|sp|B1IMV0|RL20_CLOBK RecName: Full=50S ribosomal protein L20
 gi|226730379|sp|B1L0T4|RL20_CLOBM RecName: Full=50S ribosomal protein L20
 gi|254800311|sp|C1FKM7|RL20_CLOBJ RecName: Full=50S ribosomal protein L20
 gi|259646177|sp|C3KTJ7|RL20_CLOB6 RecName: Full=50S ribosomal protein L20
 gi|148290568|emb|CAL84697.1| 50S ribosomal protein L20 [Clostridium botulinum A str. ATCC 3502]
 gi|152929583|gb|ABS35083.1| 50S ribosomal protein L20 [Clostridium botulinum A str. ATCC 19397]
 gi|152933396|gb|ABS38895.1| 50S ribosomal protein L20 [Clostridium botulinum A str. Hall]
 gi|152935258|gb|ABS40756.1| 50S ribosomal protein L20 [Clostridium botulinum F str. Langeland]
 gi|169122786|gb|ACA46622.1| 50S ribosomal protein L20 [Clostridium botulinum B1 str. Okra]
 gi|169408590|gb|ACA57001.1| 50S ribosomal protein L20 [Clostridium botulinum A3 str. Loch
           Maree]
 gi|187775602|gb|EDU39404.1| hypothetical protein CLOSPO_00487 [Clostridium sporogenes ATCC
           15579]
 gi|226841255|gb|ACO83921.1| ribosomal protein L20 [Clostridium botulinum A2 str. Kyoto]
 gi|229263696|gb|ACQ54729.1| 50S ribosomal protein L20 [Clostridium botulinum Ba4 str. 657]
 gi|295320402|gb|ADG00780.1| 50S ribosomal protein L20 [Clostridium botulinum F str. 230613]
 gi|322807445|emb|CBZ05019.1| LSU ribosomal protein L20p [Clostridium botulinum H04402 065]
          Length = 119

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  +HKKVLK AKG+YG +    + A  +V R+ + AY  R++KKRD+R L
Sbjct: 1   MARVKRAMNARKRHKKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRKLKKRDYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+  AGI ++RK+LS++AI    +F ++V++++ +L  
Sbjct: 61  WIARINAATRMNGLSYSKFMNGIKNAGIDINRKMLSEIAINDPKAFAELVDVAKKQLNA 119


>gi|197106437|ref|YP_002131814.1| 50S ribosomal protein L20 [Phenylobacterium zucineum HLK1]
 gi|226730433|sp|B4R9C5|RL20_PHEZH RecName: Full=50S ribosomal protein L20
 gi|196479857|gb|ACG79385.1| 50S ribosomal protein L20 [Phenylobacterium zucineum HLK1]
          Length = 118

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 80/118 (67%), Positives = 94/118 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVL+ AKGFYGRRKNTIRAAKAAVD++ QYAYRDR+V+KR+FRSL
Sbjct: 1   MARVKRGVVAHAKHKKVLEQAKGFYGRRKNTIRAAKAAVDKAGQYAYRDRKVRKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R+    YS+FI GL KAGI +DRKVL+D+A      FK I +  R+ L 
Sbjct: 61  WIQRINAAARLEGFTYSRFIFGLEKAGIEMDRKVLADIAGNDPAGFKAIADKVRAALA 118


>gi|126667903|ref|ZP_01738868.1| 50S ribosomal protein L20 [Marinobacter sp. ELB17]
 gi|126627563|gb|EAZ98195.1| 50S ribosomal protein L20 [Marinobacter sp. ELB17]
          Length = 117

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKILKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRRNRKRAFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA + +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARANGLSYSRLIAGLKKANVEIDRKVLADLAMNEQQTFAAVVEKAKASL 117


>gi|126738876|ref|ZP_01754572.1| 50S ribosomal protein L20 [Roseobacter sp. SK209-2-6]
 gi|126720057|gb|EBA16764.1| 50S ribosomal protein L20 [Roseobacter sp. SK209-2-6]
          Length = 121

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 70/121 (57%), Positives = 95/121 (78%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTTTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV  ++  L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVRQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|227833182|ref|YP_002834889.1| 50S ribosomal protein L20 [Corynebacterium aurimucosum ATCC 700975]
 gi|255324639|ref|ZP_05365756.1| ribosomal protein L20 [Corynebacterium tuberculostearicum SK141]
 gi|262184168|ref|ZP_06043589.1| 50S ribosomal protein L20 [Corynebacterium aurimucosum ATCC 700975]
 gi|311740494|ref|ZP_07714321.1| 50S ribosomal protein L20 [Corynebacterium pseudogenitalium ATCC
           33035]
 gi|254800314|sp|C3PGJ7|RL20_CORA7 RecName: Full=50S ribosomal protein L20
 gi|227454198|gb|ACP32951.1| 50S ribosomal protein L20 [Corynebacterium aurimucosum ATCC 700975]
 gi|255298545|gb|EET77845.1| ribosomal protein L20 [Corynebacterium tuberculostearicum SK141]
 gi|311304014|gb|EFQ80090.1| 50S ribosomal protein L20 [Corynebacterium pseudogenitalium ATCC
           33035]
          Length = 127

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A I +DRK+L++LA+   ++F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLRLAEIEVDRKILAELAVNDFEAFSALCEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|311115048|ref|YP_003986269.1| 50S ribosomal protein L20 [Gardnerella vaginalis ATCC 14019]
 gi|310946542|gb|ADP39246.1| 50S ribosomal protein L20 [Gardnerella vaginalis ATCC 14019]
          Length = 127

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLDRASGYRGQRSRLYRKAKEQLLHSFTYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR   + Y++FI GL  AGI LDR+ L++LA++ +++FK IVE +++ L  D
Sbjct: 61  WIQRINAAVRAEGITYNRFIQGLRLAGIELDRRALAELAVSDVETFKAIVEAAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|223984493|ref|ZP_03634626.1| hypothetical protein HOLDEFILI_01920 [Holdemania filiformis DSM
           12042]
 gi|223963564|gb|EEF67943.1| hypothetical protein HOLDEFILI_01920 [Holdemania filiformis DSM
           12042]
          Length = 119

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ K+ LK AKG++G +    R A   V RS +Y+Y  R+  KRD R L
Sbjct: 1   MPRVKGGTVTRARRKRTLKLAKGYFGSKHLLYRTAHEQVMRSLRYSYIGRKQLKRDMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ D++YSQ ++GL  AG+ ++RK+LS++AI     FK IVE +++ L 
Sbjct: 61  WIARINAAARMNDMSYSQLMHGLKLAGVTINRKMLSEIAIHDEKGFKAIVETAKTVLA 118


>gi|328955211|ref|YP_004372544.1| LSU ribosomal protein L20P [Coriobacterium glomerans PW2]
 gi|328455535|gb|AEB06729.1| LSU ribosomal protein L20P [Coriobacterium glomerans PW2]
          Length = 119

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 62/119 (52%), Positives = 79/119 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + V+  AKG+YG    T + AK  V  S QY YRDRR KKRD RSL
Sbjct: 1   MARVKRAVSAKKKRRTVMSRAKGYYGAASRTYKHAKEQVQHSLQYQYRDRRTKKRDIRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+ DL+YSQF++GL  AGI LDRKVL+ +A    +SF ++  +++  L V
Sbjct: 61  WITRINAAARMDDLSYSQFMHGLKLAGIELDRKVLAQMAYEDPESFSELTGIAKKALEV 119


>gi|85057940|ref|YP_456856.1| 50S ribosomal protein L20P [Aster yellows witches'-broom
           phytoplasma AYWB]
 gi|123518019|sp|Q2NIG6|RL20_AYWBP RecName: Full=50S ribosomal protein L20
 gi|84790045|gb|ABC65777.1| LSU ribosomal protein L20P [Aster yellows witches'-broom
           phytoplasma AYWB]
          Length = 227

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 51/119 (42%), Positives = 75/119 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M ++        + KKVLK AKG++G +    + A   V RS QYAYRDR+ +KRDFR L
Sbjct: 1   MAKISFTPARHRRRKKVLKMAKGYFGSKSTLYKTAHEQVMRSLQYAYRDRKQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA   +  + YS+ ++GL  A + ++RKVLSDLA  Q ++F + V+L++  L+ 
Sbjct: 61  WISRINAGAMLCGMQYSRLMHGLALAKVDVNRKVLSDLAHLQPETFAQYVQLAKETLVQ 119


>gi|261408922|ref|YP_003245163.1| 50S ribosomal protein L20 [Paenibacillus sp. Y412MC10]
 gi|315649036|ref|ZP_07902130.1| ribosomal protein L20 [Paenibacillus vortex V453]
 gi|329922248|ref|ZP_08277950.1| ribosomal protein L20 [Paenibacillus sp. HGF5]
 gi|261285385|gb|ACX67356.1| ribosomal protein L20 [Paenibacillus sp. Y412MC10]
 gi|315275717|gb|EFU39071.1| ribosomal protein L20 [Paenibacillus vortex V453]
 gi|328942285|gb|EGG38555.1| ribosomal protein L20 [Paenibacillus sp. HGF5]
          Length = 119

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 79/119 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK AKG++G +    + A   V +S  YAYRDRR  KR+FR L
Sbjct: 1   MARVKGGFVVRRRHKKVLKLAKGYFGSKHRIFKTANEQVMKSLVYAYRDRRNTKRNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+ ++GL  AG+ ++RK+L+DLA+  L++F  +  +++ ++  
Sbjct: 61  WIVRINAAARQNGLSYSKLMHGLKLAGVDINRKMLADLAVNDLNAFNSLATVAKEKVNA 119


>gi|162149043|ref|YP_001603504.1| 50S ribosomal protein L20 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545208|ref|YP_002277437.1| 50S ribosomal protein L20 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189041866|sp|A9H170|RL20_GLUDA RecName: Full=50S ribosomal protein L20
 gi|161787620|emb|CAP57216.1| putative 50S ribosomal protein L20 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532885|gb|ACI52822.1| ribosomal protein L20 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 119

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 65/119 (54%), Positives = 86/119 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL+ +KGF GR     R A   ++++ +YAYRDRR KKRDFR+L
Sbjct: 1   MARVKRGVTTHARHKKVLEQSKGFRGRSSTNYRIALERLEKALRYAYRDRRNKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAAVR + L YS+FI GL KAGI +DRKVL+ +A     +F +IV+ +++ L  
Sbjct: 61  WIQRINAAVREHGLTYSKFIFGLDKAGIEIDRKVLAAIAFDDAATFAEIVKKAQAALAA 119


>gi|182679948|ref|YP_001834094.1| 50S ribosomal protein L20 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226730357|sp|B2IBH9|RL20_BEII9 RecName: Full=50S ribosomal protein L20
 gi|182635831|gb|ACB96605.1| ribosomal protein L20 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 121

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 85/119 (71%), Positives = 99/119 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK L++A GFYGRRKNTIRAAKAAVDRS QYA RDRRVKKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLEAATGFYGRRKNTIRAAKAAVDRSMQYATRDRRVKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQR+NAAVR   L YS+FI+GL KAG+ +DRKVLS+LAI+Q ++FK IVE ++S L  
Sbjct: 61  WIQRLNAAVRELGLTYSRFIDGLAKAGVEIDRKVLSELAISQPEAFKAIVEQAKSALAT 119


>gi|325479666|gb|EGC82758.1| ribosomal protein L20 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 114

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 77/114 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HKKVLK AKG+YG +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKKVLKQAKGYYGSKSLLFRTANQAVMKSLNYAYIGRKHRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R+    YS+ + GL KA I ++RK+L++LA+   + F K+VEL++
Sbjct: 61  WIARINAAARLNGTTYSKLMGGLKKANIDINRKMLAELAVNNPEEFAKLVELAK 114


>gi|260907209|ref|ZP_05915531.1| LSU ribosomal protein L20P [Brevibacterium linens BL2]
          Length = 129

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L  A G+ G+R    R AK  V  S  Y+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVILDRASGYRGQRSRLYRKAKEQVIHSLVYSYRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINA  R   + Y++FI GL  AG+ +DR++L++LA+    +F  ++++++  L  D
Sbjct: 61  WIQRINAGARANGMTYNRFIQGLKAAGVEVDRRMLAELAVNDSATFAHLIKVAKEALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|262276752|ref|ZP_06054545.1| ribosomal protein L20 [alpha proteobacterium HIMB114]
 gi|262223855|gb|EEY74314.1| ribosomal protein L20 [alpha proteobacterium HIMB114]
          Length = 118

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 76/117 (64%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  S AKHKKVLK+AKG++GRRKNTIR AK AV+++ QYAYRDRR  KR+FRSL
Sbjct: 1   MARVKRGKTSKAKHKKVLKAAKGYWGRRKNTIRVAKQAVEKAMQYAYRDRRRNKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   L YS+FINGL K+ I +DRKVL+D+A    ++FK IV+  +S L
Sbjct: 61  WIQRINAGVRAEGLTYSKFINGLTKSKINIDRKVLADIAYNNPETFKSIVKKVQSHL 117


>gi|254467286|ref|ZP_05080697.1| ribosomal protein L20 [Rhodobacterales bacterium Y4I]
 gi|206688194|gb|EDZ48676.1| ribosomal protein L20 [Rhodobacterales bacterium Y4I]
          Length = 121

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 70/121 (57%), Positives = 94/121 (77%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G  + A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTTTHARHKKVIKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV  ++  L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLTLAGIEVDRKVLADLAVHEPEAFGAIVRQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|306967738|ref|ZP_07480399.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu009]
 gi|308354667|gb|EFP43518.1| 50S ribosomal protein L20 rplT [Mycobacterium tuberculosis SUMu009]
          Length = 129

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK+++G+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRSILKASRGYGGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  AG+ +DRK L+D+AI+   +F  +V+++R+ L  D
Sbjct: 61  WIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|110834700|ref|YP_693559.1| 50S ribosomal protein L20 [Alcanivorax borkumensis SK2]
 gi|254429610|ref|ZP_05043317.1| ribosomal protein L20 [Alcanivorax sp. DG881]
 gi|123050398|sp|Q0VNG1|RL20_ALCBS RecName: Full=50S ribosomal protein L20
 gi|110647811|emb|CAL17287.1| 50S ribosomal protein L20 [Alcanivorax borkumensis SK2]
 gi|196195779|gb|EDX90738.1| ribosomal protein L20 [Alcanivorax sp. DG881]
          Length = 119

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 63/119 (52%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK AKG+YG R    R A  AV ++ QYAYRDR+V+KR FR L
Sbjct: 1   MARVKRGVQARRRHKKILKQAKGYYGARSRVFRVAVQAVTKAGQYAYRDRKVRKRQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+ INGL KA I +DRKVL+D+A+    +F  + E +++ L  
Sbjct: 61  WIVRINAAARLNGLSYSRLINGLKKASIDIDRKVLADIAVRDQATFSALAEKAKASLTA 119


>gi|49474905|ref|YP_032946.1| 50S ribosomal protein L20 [Bartonella henselae str. Houston-1]
 gi|81827762|sp|Q6G5E4|RL20_BARHE RecName: Full=50S ribosomal protein L20
 gi|49237710|emb|CAF26899.1| 50S ribosomal protein l20 [Bartonella henselae str. Houston-1]
          Length = 133

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 80/118 (67%), Positives = 95/118 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+AI +  +F  +V  ++  L 
Sbjct: 61  WIQRINAAVRAEGLTYGRFIDGLSKAGIEIDRKVLSDIAIHESAAFSALVASAKKALE 118


>gi|152989863|ref|YP_001355585.1| 50S ribosomal protein L20 [Nitratiruptor sp. SB155-2]
 gi|215274802|sp|A6Q169|RL20_NITSB RecName: Full=50S ribosomal protein L20
 gi|151421724|dbj|BAF69228.1| 50S ribosomal protein L20 [Nitratiruptor sp. SB155-2]
          Length = 116

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 64/115 (55%), Positives = 87/115 (75%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V   +HKK+LK AKGFY  R+   R AK  ++RS  YAYRDR+ KKR+FR LWI
Sbjct: 2   RVKTGTVRRRRHKKILKQAKGFYSGRRKHFRKAKEQLERSLVYAYRDRKQKKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D++YS+FI+GL KAGI LDRK+L+D+A+ + ++FK +VE +++ L
Sbjct: 62  TRINAACRLNDISYSRFIHGLSKAGIELDRKILADMAMNEPEAFKAVVEKAKAAL 116


>gi|296119684|ref|ZP_06838242.1| ribosomal protein L20 [Corynebacterium ammoniagenes DSM 20306]
 gi|295967567|gb|EFG80834.1| ribosomal protein L20 [Corynebacterium ammoniagenes DSM 20306]
          Length = 127

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LK+AKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKTAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A I +DRK+L++LA+   ++F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLRLAEIEVDRKILAELAVNDFEAFSALCEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|332637331|ref|ZP_08416194.1| 50S ribosomal protein L20P [Weissella cibaria KACC 11862]
          Length = 187

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 80/118 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ KK++K AKG+ G+R    + AK  V +S  YA+RDR+  KR+FR LWI
Sbjct: 2   RVKGGTVTRARRKKMIKLAKGYRGQRHINYKVAKQQVWKSWFYAFRDRKQTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+F+NGL   G  L+RK+L+DLA++  ++F  + E S+  L  +
Sbjct: 62  ARINAAARMNGLSYSRFMNGLSLMGSTLNRKMLADLAVSDFEAFSALAEASKKALADN 119


>gi|332653952|ref|ZP_08419696.1| ribosomal protein L20 [Ruminococcaceae bacterium D16]
 gi|332517038|gb|EGJ46643.1| ribosomal protein L20 [Ruminococcaceae bacterium D16]
          Length = 118

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 80/118 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  +  K+LK AKG++G +    + A  AV +S  YAY  R++KKRDFR L
Sbjct: 1   MARVKGAMMTRKRRNKILKMAKGYWGAKSKHFKMANQAVMKSGSYAYTGRKLKKRDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA ++  +NYS F+NGL KAGIV++RK+LS+LA+    +F ++ E ++  L 
Sbjct: 61  WITRINAACKMNGMNYSTFMNGLKKAGIVINRKMLSELAVNDKAAFAQLTETAKKALA 118


>gi|254785574|ref|YP_003073003.1| 50S ribosomal protein L20 [Teredinibacter turnerae T7901]
 gi|259646201|sp|C5BSQ5|RL20_TERTT RecName: Full=50S ribosomal protein L20
 gi|237684714|gb|ACR11978.1| ribosomal protein L20 [Teredinibacter turnerae T7901]
          Length = 119

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+   HKKVLK+AKG+YG R    R AK AV ++ QYAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVVARRSHKKVLKAAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   ++YS+ I GL KA I LDR+VL+DLAI    +F  IV  ++  L  
Sbjct: 61  WITRINAQSRAEGMSYSRLIAGLKKAEITLDRRVLADLAIHDKPAFAAIVAKAKDALAA 119


>gi|89069712|ref|ZP_01157048.1| 50S ribosomal protein L20 [Oceanicola granulosus HTCC2516]
 gi|89044658|gb|EAR50769.1| 50S ribosomal protein L20 [Oceanicola granulosus HTCC2516]
          Length = 119

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 72/118 (61%), Positives = 92/118 (77%), Gaps = 2/118 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVL+ AKG+YGRRKNT + A+ AVD++ QYA RDR  KKR+FRSLWI
Sbjct: 2   RVKGGTVTHRRHKKVLEQAKGYYGRRKNTFKVARQAVDKANQYATRDRHNKKRNFRSLWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           QRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ +R+ L 
Sbjct: 62  QRINAAVRAHDESLTYSKFINGLGLAGIEVDRKVLADLAVNEPEAFNGIVDKARAALA 119


>gi|300114471|ref|YP_003761046.1| 50S ribosomal protein L20 [Nitrosococcus watsonii C-113]
 gi|299540408|gb|ADJ28725.1| ribosomal protein L20 [Nitrosococcus watsonii C-113]
          Length = 119

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GRRKN  R A  AV R+ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKVIAQAKGYRGRRKNVYRVANQAVTRASQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+ I+GL +A I +DRKVL+DLA+    +F  I E +++ L 
Sbjct: 61  WIVRINAAARECGLSYSRLISGLKQAAIEIDRKVLADLAVRDKAAFTTIAEQAKAALA 118


>gi|325677952|ref|ZP_08157594.1| ribosomal protein L20 [Ruminococcus albus 8]
 gi|324110506|gb|EGC04680.1| ribosomal protein L20 [Ruminococcus albus 8]
          Length = 117

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  +  K LK AKG++G +    + AK AV +S QYAY  R+ KKRDFR L
Sbjct: 1   MARVKGAMMTRKRRNKTLKLAKGYFGAKSKHFKMAKQAVMKSGQYAYIGRKQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NG++KAGI L+RK+LS++AI+    F  IVE +++ L
Sbjct: 61  WITRISAACKMNGINYSSFMNGVNKAGINLNRKMLSEIAISDPAGFTAIVEKAKAAL 117


>gi|124267074|ref|YP_001021078.1| 50S ribosomal protein L20 [Methylibium petroleiphilum PM1]
 gi|166219660|sp|A2SH04|RL20_METPP RecName: Full=50S ribosomal protein L20
 gi|124259849|gb|ABM94843.1| LSU ribosomal protein L20P [Methylibium petroleiphilum PM1]
          Length = 118

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL+ AKGF GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLELAKGFRGRRKNVYRIAKQAVMKAGQYAYRDRRNRKRVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R + + YS+FI G+ KA I +DRK+L++LA+    +F  IVE  +++L 
Sbjct: 61  WIARINAASRSHGITYSRFIAGIKKAAIDIDRKMLAELAVNDPAAFGSIVEKVKAQLA 118


>gi|325283503|ref|YP_004256044.1| 50S ribosomal protein L20 [Deinococcus proteolyticus MRP]
 gi|324315312|gb|ADY26427.1| 50S ribosomal protein L20 [Deinococcus proteolyticus MRP]
          Length = 123

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G++   +HKKVLK AKGF+G R    R A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MARSKTGIIRRRRHKKVLKRAKGFWGTRSKLYRNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINA  R++ +NYS F+NGL  AG+ L+RKVL+D+A  + ++FK +V+ ++      
Sbjct: 61  WIQRINAGARLHGMNYSTFMNGLKVAGVDLNRKVLADIAAREPETFKALVDTAKQAREGQ 120

Query: 121 VAS 123
            A+
Sbjct: 121 KAA 123


>gi|319786724|ref|YP_004146199.1| ribosomal protein L20 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465236|gb|ADV26968.1| ribosomal protein L20 [Pseudoxanthomonas suwonensis 11-1]
          Length = 119

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++ QYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILDQAKGYYNARRKVYRVAKQAVIKAGQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   ++YS+FINGL KAGI LDRKVL+D+A+     F  + E ++S L  
Sbjct: 61  WITRINAAARANGISYSRFINGLLKAGITLDRKVLADIAVHDAAGFTALAEKAKSALAA 119


>gi|91205680|ref|YP_538035.1| 50S ribosomal protein L20 [Rickettsia bellii RML369-C]
 gi|157826862|ref|YP_001495926.1| 50S ribosomal protein L20 [Rickettsia bellii OSU 85-389]
 gi|109893148|sp|Q1RI68|RL20_RICBR RecName: Full=50S ribosomal protein L20
 gi|166220737|sp|A8GVL2|RL20_RICB8 RecName: Full=50S ribosomal protein L20
 gi|91069224|gb|ABE04946.1| 50S ribosomal protein L20 [Rickettsia bellii RML369-C]
 gi|157802166|gb|ABV78889.1| 50S ribosomal protein L20 [Rickettsia bellii OSU 85-389]
          Length = 117

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR     R A   V++  QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRASTCFRVAIEKVEKGLQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L KA I +DRKVL++LA+   + F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKAEIDIDRKVLAELAVNNNEEFASIVEQAKAHI 117


>gi|254518662|ref|ZP_05130718.1| ribosomal protein L20 [Clostridium sp. 7_2_43FAA]
 gi|226912411|gb|EEH97612.1| ribosomal protein L20 [Clostridium sp. 7_2_43FAA]
          Length = 119

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V S   HKKVLK AKG+YG +    + A  +V R+ + AY  RR+KKRDFR L
Sbjct: 1   MARVKRAVNSRKNHKKVLKLAKGYYGGKSRLFKTANESVIRALRNAYVGRRLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FING+  AGI ++RK+LS++AI    +F  +VE+++S+L
Sbjct: 61  WIARINAATRMNGLSYSKFINGIKLAGIDMNRKMLSEIAINDPKAFADLVEVAKSQL 117


>gi|271967364|ref|YP_003341560.1| 50S ribosomal protein L20 [Streptosporangium roseum DSM 43021]
 gi|270510539|gb|ACZ88817.1| 50S ribosomal protein L20 [Streptosporangium roseum DSM 43021]
          Length = 127

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 76/123 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K K VL+ AKG+ G+R    R AK  +  S  YAYRDR+ +K  FR L
Sbjct: 1   MARVKRAINAKKKRKVVLERAKGYRGQRSRLYRKAKEQMLHSMTYAYRDRKDRKGTFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DRK+L+DLA+    +F  +VE ++  L  D
Sbjct: 61  WIQRINAAARQNGITYNRLIQGLRLASIEVDRKILADLAVNDAATFATLVEAAKKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|89893015|ref|YP_516502.1| 50S ribosomal protein L20 [Desulfitobacterium hafniense Y51]
 gi|219666286|ref|YP_002456721.1| 50S ribosomal protein L20 [Desulfitobacterium hafniense DCB-2]
 gi|122484064|sp|Q251I4|RL20_DESHY RecName: Full=50S ribosomal protein L20
 gi|254800318|sp|B8FZK2|RL20_DESHD RecName: Full=50S ribosomal protein L20
 gi|89332463|dbj|BAE82058.1| 50S ribosomal protein L20 [Desulfitobacterium hafniense Y51]
 gi|219536546|gb|ACL18285.1| ribosomal protein L20 [Desulfitobacterium hafniense DCB-2]
          Length = 120

 Score =  150 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 58/120 (48%), Positives = 79/120 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV    +HKKVLK AKGF G +    R A   V +S  YAY  RR KK DFR L
Sbjct: 1   MARVKRGVTKHQRHKKVLKLAKGFRGAKSKLYRPANEQVMKSLAYAYAHRRDKKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+  L+YS+ +NGL  AG+ ++RK+L+DLAI    +F ++V ++++++   
Sbjct: 61  WIARINAAARLNGLSYSRMMNGLKIAGVSVNRKMLADLAINDAAAFTELVNVAKAQVSAK 120


>gi|227488135|ref|ZP_03918451.1| 50S ribosomal protein L20 [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227541532|ref|ZP_03971581.1| 50S ribosomal protein L20 [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227091997|gb|EEI27309.1| 50S ribosomal protein L20 [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227182688|gb|EEI63660.1| 50S ribosomal protein L20 [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 128

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++LKSAKG+ G+R    R AK     S  YAYRDRR +K  FR L
Sbjct: 1   MARVKRSVNAKKKRREILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRKRKSQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+  + Y++ I GL  A I +DRK+L++LA+    +F  I E +++ L  D
Sbjct: 61  WITRINAAARMNGITYNRLIQGLRLAEIEVDRKILAELAVNDFAAFSAICEAAKNALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|225022604|ref|ZP_03711796.1| hypothetical protein CORMATOL_02646 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305682065|ref|ZP_07404869.1| ribosomal protein L20 [Corynebacterium matruchotii ATCC 14266]
 gi|224944512|gb|EEG25721.1| hypothetical protein CORMATOL_02646 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305658538|gb|EFM48041.1| ribosomal protein L20 [Corynebacterium matruchotii ATCC 14266]
          Length = 127

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++LKSAKG+ G+R    R AK     S  Y+YRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREILKSAKGYRGQRSRLYRKAKEQWLHSMTYSYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+  + Y++ I GL  A I +DRK+L+DLA+    +F  I E +++ L  D
Sbjct: 61  WITRINAAARMNGITYNRLIQGLRLAEIEVDRKILADLAVNDFAAFSVICEAAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|254462592|ref|ZP_05076008.1| ribosomal protein L20 [Rhodobacterales bacterium HTCC2083]
 gi|206679181|gb|EDZ43668.1| ribosomal protein L20 [Rhodobacteraceae bacterium HTCC2083]
          Length = 121

 Score =  150 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 72/121 (59%), Positives = 95/121 (78%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+H+KV+K+AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR FR+L
Sbjct: 1   MSRVKGGTVTHARHRKVVKAAKGYYGRRKNTFKVAAQAVDKANQYATRDRKNRKRSFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVLSDLAI + D+F  +V+ +++ L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLMLAGIEVDRKVLSDLAINEPDAFGAVVDQAKAALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|222084530|ref|YP_002543059.1| ribosomal protein L20 [Agrobacterium radiobacter K84]
 gi|254800291|sp|B9J7G2|RL20_AGRRK RecName: Full=50S ribosomal protein L20
 gi|221721978|gb|ACM25134.1| ribosomal protein L20 [Agrobacterium radiobacter K84]
          Length = 134

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 97/118 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK A+GFYGRRKNTIR AKAAVDRS+QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKQARGFYGRRKNTIRTAKAAVDRSKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL KAGI +DRKVLSD+AI + ++F  +V  S+  L 
Sbjct: 61  WIQRINAAVREHGLTYGRFIDGLTKAGIEVDRKVLSDMAIHETEAFGALVAASKKALE 118


>gi|300173540|ref|YP_003772706.1| 50S ribosomal protein L20 [Leuconostoc gasicomitatum LMG 18811]
 gi|299887919|emb|CBL91887.1| 50S ribosomal protein L20 [Leuconostoc gasicomitatum LMG 18811]
          Length = 139

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 84/118 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G VS A+ KK++K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVSRARRKKIVKLAKGYRGQRRINFKVAKQQVWKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG+ L+RK+L+D+A+T  D+F K+ + ++S L  D
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGVELNRKMLADIAVTDFDTFSKLADQAKSALAAD 119


>gi|294787056|ref|ZP_06752310.1| ribosomal protein L20 [Parascardovia denticolens F0305]
 gi|315226705|ref|ZP_07868493.1| inorganic diphosphatase [Parascardovia denticolens DSM 10105]
 gi|294485889|gb|EFG33523.1| ribosomal protein L20 [Parascardovia denticolens F0305]
 gi|315120837|gb|EFT83969.1| inorganic diphosphatase [Parascardovia denticolens DSM 10105]
          Length = 126

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ AKG+ G+R    R AK  +  S  Y++RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERAKGYRGQRSRLYRKAKEQLLHSFTYSFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RIN AVR   + Y++FI GL  AGI LDR+ L+DLA+   D+F  IV+ ++  L  D
Sbjct: 61  WITRINVAVRAEGMTYNRFIQGLRLAGIELDRRALADLAVNDHDTFVSIVDAAKKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|326331231|ref|ZP_08197525.1| ribosomal protein L20 [Nocardioidaceae bacterium Broad-1]
 gi|325951001|gb|EGD43047.1| ribosomal protein L20 [Nocardioidaceae bacterium Broad-1]
          Length = 127

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V ++ K +  L+ A G+ G+R    R AK  V  S  Y+Y DRR  K +FR L
Sbjct: 1   MARVKRAVNAAKKRRTTLERASGYRGQRSRLYRKAKEQVTHSLVYSYNDRRKNKGNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL+ AGI +DRK+L+DLA+  + +F  +V  +++ L  D
Sbjct: 61  WIQRINAAARAEGMTYNRFIQGLNLAGIEVDRKILADLAVNDVAAFNALVAQAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|255019926|ref|ZP_05292000.1| LSU ribosomal protein L20p [Acidithiobacillus caldus ATCC 51756]
 gi|254970585|gb|EET28073.1| LSU ribosomal protein L20p [Acidithiobacillus caldus ATCC 51756]
          Length = 121

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 66/116 (56%), Positives = 88/116 (75%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKGF G+RK+  R A  AV ++  Y YRDRR KKRDFRSL
Sbjct: 1   MPRVKRGVTAHARHKKVLDRAKGFRGQRKSNYRIAHQAVMKALTYEYRDRRTKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   ++YS+F+NGL +AG+ LDRKVL+D+A+   ++F ++VEL++ +
Sbjct: 61  WIVRINAAARAEGMSYSRFMNGLLRAGVQLDRKVLADIAVRDKEAFSRLVELAKEQ 116


>gi|269956118|ref|YP_003325907.1| 50S ribosomal protein L20 [Xylanimonas cellulosilytica DSM 15894]
 gi|269304799|gb|ACZ30349.1| ribosomal protein L20 [Xylanimonas cellulosilytica DSM 15894]
          Length = 128

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  YAYRDR+VKK DFR L
Sbjct: 1   MARVKRAVNAQKKRRTTLERASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKVKKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++F+ GL  AG+ +DR++L++LA+  + +F  +VE++++ L  D
Sbjct: 61  WIQRINAAARAQGLTYNRFVQGLGLAGVEVDRRMLAELAVNDIAAFNALVEVAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|28199780|ref|NP_780094.1| 50S ribosomal protein L20 [Xylella fastidiosa Temecula1]
 gi|182682530|ref|YP_001830690.1| 50S ribosomal protein L20 [Xylella fastidiosa M23]
 gi|31563066|sp|Q87AB4|RL20_XYLFT RecName: Full=50S ribosomal protein L20
 gi|226730477|sp|B2I9P5|RL20_XYLF2 RecName: Full=50S ribosomal protein L20
 gi|28057901|gb|AAO29743.1| 50S ribosomal protein L20 [Xylella fastidiosa Temecula1]
 gi|182632640|gb|ACB93416.1| ribosomal protein L20 [Xylella fastidiosa M23]
 gi|307578808|gb|ADN62777.1| 50S ribosomal protein L20 [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 119

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 61/119 (51%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILSLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+ K GI LDRK+L+D+A+     F  + E +++ L  
Sbjct: 61  WIVRINAAARMNGLSYSRFMNGILKCGITLDRKMLADIAVHDPAGFTALAEKAKTMLAA 119


>gi|160893270|ref|ZP_02074058.1| hypothetical protein CLOL250_00816 [Clostridium sp. L2-50]
 gi|156865353|gb|EDO58784.1| hypothetical protein CLOL250_00816 [Clostridium sp. L2-50]
          Length = 118

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 80/118 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  KH + LK AKG+ G R    R AK +V R+   +Y  R+ +KR+FR L
Sbjct: 1   MARVKGGVGAKKKHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKREFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ D++YS+ ++GL  AG+ ++RK+LS++AI+  + F K+V +++ +L 
Sbjct: 61  WIARINAAARMNDISYSKLMHGLKLAGVDINRKMLSEMAISDPEGFAKLVAVAKEKLA 118


>gi|118411120|ref|YP_874514.1| 50S ribosomal protein L20 [Thalassiosira pseudonana]
 gi|125987552|sp|A0T0Q2|RK20_THAPS RecName: Full=50S ribosomal protein L20, chloroplastic
 gi|116739867|gb|ABK20737.1| 50S ribosomal protein L20 [Thalassiosira pseudonana]
          Length = 117

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/115 (40%), Positives = 71/115 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+  + KK+L+ AKG+ G      R A   V ++ +Y+Y  R+ KKR FR L
Sbjct: 1   MVRVKRGNVARKRRKKILQLAKGYRGAHSRLFRVANQQVMKALRYSYVGRKQKKRVFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINA+ R   + YS  IN   K+ I L+RK+L+ +A+    +F K+++ ++S
Sbjct: 61  WISRINASSREKGVTYSTLINSFKKSKINLNRKMLAQIAVLDCSTFYKLIDDAKS 115


>gi|313205747|ref|YP_004044924.1| LSU ribosomal protein l20p [Riemerella anatipestifer DSM 15868]
 gi|312445063|gb|ADQ81418.1| LSU ribosomal protein L20P [Riemerella anatipestifer DSM 15868]
 gi|315022857|gb|EFT35881.1| LSU ribosomal protein L20p [Riemerella anatipestifer RA-YM]
 gi|325336811|gb|ADZ13085.1| Ribosomal protein L20 [Riemerella anatipestifer RA-GD]
          Length = 114

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 61/114 (53%), Positives = 80/114 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKGF+GRRKN    AK AV+++ QYAYR R+ KKR+FRSL
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGFFGRRKNVWTVAKNAVEKAMQYAYRGRKEKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R Y ++YSQF+  L K  I L+RKVL+DLA+   ++FK +V+  +
Sbjct: 61  WIMRINAGCREYGMSYSQFMGALKKNNIELNRKVLADLAMNHPEAFKAVVDQVK 114


>gi|296116373|ref|ZP_06834988.1| 50S ribosomal protein L20 [Gluconacetobacter hansenii ATCC 23769]
 gi|295977073|gb|EFG83836.1| 50S ribosomal protein L20 [Gluconacetobacter hansenii ATCC 23769]
          Length = 118

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 87/118 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S A+HKKVL+ +KG+ GR     R A   ++++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTSHARHKKVLELSKGYRGRSSTNYRIALERLEKALRYAYRDRRNKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L YS+FINGL KAGI +DRKVL+ +A     +F +IV+ +++ L 
Sbjct: 61  WIQRINAAVREHGLTYSRFINGLDKAGIEIDRKVLAAIAFDDAATFAEIVKKAQAALA 118


>gi|222147172|ref|YP_002548129.1| 50S ribosomal protein L20 [Agrobacterium vitis S4]
 gi|254800292|sp|B9JYM9|RL20_AGRVS RecName: Full=50S ribosomal protein L20
 gi|221734162|gb|ACM35125.1| 50S ribosomal protein L20 [Agrobacterium vitis S4]
          Length = 134

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 100/118 (84%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKHKKVLK+AKGFYGRRKNTIRAAKAAVDRS+Q+AYRDR+V KR+FR+L
Sbjct: 1   MSRVKRGVAAHAKHKKVLKAAKGFYGRRKNTIRAAKAAVDRSKQFAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE S+  L 
Sbjct: 61  WIQRINAAVRESGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEASKKALS 118


>gi|94497863|ref|ZP_01304429.1| ribosomal protein L20 [Sphingomonas sp. SKA58]
 gi|94422752|gb|EAT07787.1| ribosomal protein L20 [Sphingomonas sp. SKA58]
          Length = 120

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/110 (62%), Positives = 88/110 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR L
Sbjct: 1   MARVKRGVTTKAKHKRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINA VR   L YSQF++GL  AG+ LDRKVL+D+A+ + ++F  I+
Sbjct: 61  WIQRINAGVRAEGLTYSQFMHGLKLAGVELDRKVLADIAMHEGEAFSAII 110


>gi|300781274|ref|ZP_07091128.1| 50S ribosomal protein L20 [Corynebacterium genitalium ATCC 33030]
 gi|300532981|gb|EFK54042.1| 50S ribosomal protein L20 [Corynebacterium genitalium ATCC 33030]
          Length = 129

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     SQ YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSQTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A + +DRK+L+DLA+    +F  I E++++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLKLAEVEVDRKILADLAVNDFAAFSAICEVAKNALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|308068137|ref|YP_003869742.1| 50S ribosomal protein L20 [Paenibacillus polymyxa E681]
 gi|310640926|ref|YP_003945684.1| ribosomal protein l20 [Paenibacillus polymyxa SC2]
 gi|305857416|gb|ADM69204.1| 50S ribosomal protein L20 [Paenibacillus polymyxa E681]
 gi|309245876|gb|ADO55443.1| Ribosomal protein L20 [Paenibacillus polymyxa SC2]
          Length = 119

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/119 (44%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK AKG++G +    + A   V +S  YAYRDRR  KR+FR L
Sbjct: 1   MARVKGGFVVRRRHKKVLKLAKGYFGSKHRIFKTANEQVMKSLVYAYRDRRQTKRNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+ ++GL  AG+ ++RK+L+DLA+  +++F  +  +++ ++  
Sbjct: 61  WIVRINAAARLNGLSYSKLMHGLKLAGVDINRKILADLAVNDINAFNSLATVAKGKINA 119


>gi|149194092|ref|ZP_01871190.1| 50S ribosomal protein L20 [Caminibacter mediatlanticus TB-2]
 gi|149136045|gb|EDM24523.1| 50S ribosomal protein L20 [Caminibacter mediatlanticus TB-2]
          Length = 116

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/115 (58%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V   +HKK+LK AKGFY  R+   R AK  V+RS  YA+RDR+ KKRDFR LWI
Sbjct: 2   RVKTGTVRRRRHKKILKMAKGFYSGRRKHFRKAKEQVERSLVYAFRDRKQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D++YS+FINGL KAGI LDRK+L+DLA+ + ++F KIV  ++  L
Sbjct: 62  IRINAACRLNDISYSRFINGLKKAGIELDRKILADLAMNEPEAFAKIVNKAKEAL 116


>gi|85709659|ref|ZP_01040724.1| ribosomal protein L20 [Erythrobacter sp. NAP1]
 gi|85688369|gb|EAQ28373.1| ribosomal protein L20 [Erythrobacter sp. NAP1]
          Length = 119

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 93/119 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRGV + AKHK++L  AKG+ GRRKNTIR A+ AV+++ QYAYRDRR+KKR+FR+L
Sbjct: 1   MPRIKRGVTTRAKHKRLLDQAKGYRGRRKNTIRIARQAVEKAGQYAYRDRRIKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAAVR   L YSQF++G+  AGI LDRKV++DLA+ +  +FK I+  ++  L  
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGVKLAGIELDRKVMADLAMNEEAAFKTIIAQAKKALPA 119


>gi|227505048|ref|ZP_03935097.1| 50S ribosomal protein L20 [Corynebacterium striatum ATCC 6940]
 gi|227198412|gb|EEI78460.1| 50S ribosomal protein L20 [Corynebacterium striatum ATCC 6940]
          Length = 127

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRRAILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I+GL  A I +DRK+L++LA+   ++F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIHGLRLAEIEVDRKILAELAVNDFEAFSALCEAAKAALPED 120

Query: 121 VAS 123
             +
Sbjct: 121 FNA 123


>gi|294084798|ref|YP_003551558.1| 50S ribosomal protein L20 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664373|gb|ADE39474.1| ribosomal protein L20 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 117

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 70/116 (60%), Positives = 93/116 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + A+H KV+K+AKG+YGRRKNT R A  AVD+++QYAYRDRRV+KR+FR+L
Sbjct: 1   MARVKRGTTTHARHGKVIKAAKGYYGRRKNTFRTATQAVDKARQYAYRDRRVRKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WIQRINAA R++ + YSQ + GL KAGI +DRK+L+DLA+ +  +F  +VE SR+ 
Sbjct: 61  WIQRINAAARIHGITYSQMMGGLIKAGIEIDRKMLADLAVNEPAAFTALVERSRAA 116


>gi|146328998|ref|YP_001209435.1| 50S ribosomal protein L20 [Dichelobacter nodosus VCS1703A]
 gi|166219640|sp|A5EVM2|RL20_DICNV RecName: Full=50S ribosomal protein L20
 gi|146232468|gb|ABQ13446.1| 50S ribosomal protein L20 [Dichelobacter nodosus VCS1703A]
          Length = 119

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK+AKG+Y  R+ T R AK AV ++ QYAYRDR+ KKR FR L
Sbjct: 1   MARVKRGVQAHARHKKVLKAAKGYYSARRKTFRVAKQAVIKAGQYAYRDRKTKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R++ L+YS+FINGL K+GI +DRK+LS+LA+     F  + E +++ L  
Sbjct: 61  WIIRINAGARIHGLSYSRFINGLKKSGIAVDRKILSELAVYDKSVFATLAEKAKAALSA 119


>gi|148654114|ref|YP_001281207.1| 50S ribosomal protein L20 [Psychrobacter sp. PRwf-1]
 gi|172048591|sp|A5WHW6|RL20_PSYWF RecName: Full=50S ribosomal protein L20
 gi|148573198|gb|ABQ95257.1| LSU ribosomal protein L20P [Psychrobacter sp. PRwf-1]
 gi|332975688|gb|EGK12573.1| inorganic pyrophosphatase [Psychrobacter sp. 1501(2011)]
          Length = 118

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV ++ +HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQANRRHKKILKRAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRNKKRTFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R+  L+YS+FINGL KA I +DR+VL+D+A+    +F  + E +++ L 
Sbjct: 61  WIARINAGARLNGLSYSRFINGLKKANIEIDRRVLADIAMHDAAAFTALTEKAKAALA 118


>gi|170781629|ref|YP_001709961.1| 50S ribosomal protein L20 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|189041854|sp|B0RHC2|RL20_CLAMS RecName: Full=50S ribosomal protein L20
 gi|169156197|emb|CAQ01339.1| 50S ribosomal protein L20 [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 130

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  YAYRDRR KK +FR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAAGYRGQRSRLYRKAKEQVTHSLVYAYRDRRAKKGEFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL  AG+ +DR++L++LA+ +  +F  +V+ +++ L  +
Sbjct: 61  WIQRINAAARANGLTYNRLIQGLSLAGVQVDRRILAELAVHEPATFASLVQTAKTALPAN 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|86140201|ref|ZP_01058763.1| ribosomal protein L20 [Roseobacter sp. MED193]
 gi|85823138|gb|EAQ43351.1| ribosomal protein L20 [Roseobacter sp. MED193]
          Length = 121

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/121 (58%), Positives = 97/121 (80%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKQRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV  ++S L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVRQAQSALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|148273190|ref|YP_001222751.1| 50S ribosomal protein L20 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|166219631|sp|A5CSJ9|RL20_CLAM3 RecName: Full=50S ribosomal protein L20
 gi|147831120|emb|CAN02072.1| 50S ribosomal protein L20 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 130

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  YAYRDRR KK +FR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAAGYRGQRSRLYRKAKEQVTHSLVYAYRDRRAKKGEFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL  AG+ +DR++L++LA+ +  +F  +V+ +++ L  +
Sbjct: 61  WIQRINAAARANGLTYNRLIQGLSLAGVQVDRRILAELAVHEPATFASLVQTAKAALPAN 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|160871981|ref|ZP_02062113.1| ribosomal protein L20 [Rickettsiella grylli]
 gi|159120780|gb|EDP46118.1| ribosomal protein L20 [Rickettsiella grylli]
          Length = 118

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK+AKG+ G R   IRAAK AV ++ QYAYRDR+ KKRDFR+L
Sbjct: 1   MPRVKRGVTARARHKKILKAAKGYRGARSRIIRAAKQAVIKAGQYAYRDRKQKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   + YS  I GL+KA I +DRK+L+DLA+T   +F + VE ++  L 
Sbjct: 61  WIVRINAAAREQGMRYSHLIAGLNKAEIAVDRKILADLAVTDKAAFAQFVEKAKQALA 118


>gi|154500002|ref|ZP_02038040.1| hypothetical protein BACCAP_03659 [Bacteroides capillosus ATCC
           29799]
 gi|150271600|gb|EDM98857.1| hypothetical protein BACCAP_03659 [Bacteroides capillosus ATCC
           29799]
          Length = 118

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/117 (44%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  +  KVLK AKG++G +    + AK  V +S +YAY  RR+KKRDFR L
Sbjct: 1   MARVKGAMMTRKRRNKVLKLAKGYWGAKSKHFKMAKEQVMKSLKYAYTGRRLKKRDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NGL KAG+ ++RK+L++LA+    +F  + E+++++L
Sbjct: 61  WITRISAACKMNGMNYSTFMNGLKKAGVEINRKMLAELAVNDKAAFTALTEMAKAQL 117


>gi|114769957|ref|ZP_01447567.1| 50S ribosomal protein L20 [alpha proteobacterium HTCC2255]
 gi|114549662|gb|EAU52544.1| 50S ribosomal protein L20 [alpha proteobacterium HTCC2255]
          Length = 119

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 70/119 (58%), Positives = 93/119 (78%), Gaps = 2/119 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV  G V+ A+HKKV+K+AKG+YG RKN  R A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MARVTSGKVTHARHKKVIKAAKGYYGARKNAFRTATQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR+ D  L YS+FING+ KAGI +DRKVL+DLA+ + ++F  IVE +++ L
Sbjct: 61  WIQRINAAVRLNDETLTYSRFINGVQKAGIEVDRKVLADLAVHEPEAFGAIVEQAKAAL 119


>gi|319942326|ref|ZP_08016641.1| 50S ribosomal protein L20 [Sutterella wadsworthensis 3_1_45B]
 gi|319804199|gb|EFW01099.1| 50S ribosomal protein L20 [Sutterella wadsworthensis 3_1_45B]
          Length = 116

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/116 (55%), Positives = 78/116 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+   +KG+  RR N  R AK AV R+ QYAYRDRR KK  FR L
Sbjct: 1   MPRVKRGVTARARHKKIFTLSKGYRLRRNNVFRVAKQAVMRAGQYAYRDRRDKKHVFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINA  R   L+YS F+NGL KAGI LDRKVL+D+A+   D F  +V   ++ 
Sbjct: 61  WIARINAGSRANGLSYSVFMNGLKKAGIALDRKVLADMAVNDKDGFAALVAQVKNA 116


>gi|256847507|ref|ZP_05552953.1| ribosomal protein L20 [Lactobacillus coleohominis 101-4-CHN]
 gi|256716171|gb|EEU31146.1| ribosomal protein L20 [Lactobacillus coleohominis 101-4-CHN]
          Length = 117

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 78/115 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ K+++K AKG+ G +    + AK  V +S  YA+RDR+V KR FR LWI
Sbjct: 2   RVKGGTVTRARRKRIMKLAKGYTGSKHRLFKTAKDQVMKSYTYAFRDRKVNKRKFRELWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R+ D++YS+ ++GL  A I ++RK+L+DLA+   + FK +V+ ++  L
Sbjct: 62  ARINAGARMNDISYSKLMHGLKLANIDINRKMLADLAVNDPEGFKAVVDEAKKAL 116


>gi|114776993|ref|ZP_01452013.1| 50S ribosomal protein L20 [Mariprofundus ferrooxydans PV-1]
 gi|114552514|gb|EAU54974.1| 50S ribosomal protein L20 [Mariprofundus ferrooxydans PV-1]
          Length = 118

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 92/117 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV + A+HK V+K+AKG+ GRRK+  R A  AVD+++QYAYRDR+VKKRDFRSL
Sbjct: 1   MPRVKSGVQAHARHKSVIKAAKGYRGRRKSCFRVATQAVDKARQYAYRDRKVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA +   L+YS+F++GL  AGI LDRKVL+D+A+   + F K+VE +R+++
Sbjct: 61  WIIRINAAAKSNGLSYSRFMHGLTLAGIDLDRKVLADIAVRDAEGFAKLVETARTQI 117


>gi|294791031|ref|ZP_06756189.1| ribosomal protein L20 [Scardovia inopinata F0304]
 gi|294458928|gb|EFG27281.1| ribosomal protein L20 [Scardovia inopinata F0304]
          Length = 127

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 76/123 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  +  S  Y +RDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTVLERASGYRGQRSRLYRKAKEQLLHSFNYNFRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RIN AVR   + Y++FI GLH AGI LDR+ L++LA+   D+F  IV  ++  L  D
Sbjct: 61  WISRINVAVRAEGMTYNRFIQGLHLAGIELDRRSLAELAVNDHDTFVAIVNEAKKVLPDD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|189424931|ref|YP_001952108.1| 50S ribosomal protein L20 [Geobacter lovleyi SZ]
 gi|226730404|sp|B3E1T8|RL20_GEOLS RecName: Full=50S ribosomal protein L20
 gi|189421190|gb|ACD95588.1| ribosomal protein L20 [Geobacter lovleyi SZ]
          Length = 117

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G  S  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFRSL
Sbjct: 1   MPRAKGGFKSRQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FI GL KA + +DRKVL+D+AIT    F +I  +++++L
Sbjct: 61  WIMRINAASRLNGLSYSKFIFGLKKADVQIDRKVLADIAITDPKGFAEISAVAKAQL 117


>gi|146296776|ref|YP_001180547.1| ribosomal protein L20 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|166219622|sp|A4XKC1|RL20_CALS8 RecName: Full=50S ribosomal protein L20
 gi|145410352|gb|ABP67356.1| LSU ribosomal protein L20P [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 118

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 61/115 (53%), Positives = 83/115 (72%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LWI
Sbjct: 2   RIKNGVWARKRHKKWLKLAKGYWGAKSRVFKQAHIAVMRSLRYAYIGRRLKKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R   L+YS+FINGL KAGI L+RKVL+D+AI    +F ++VE+++ ++
Sbjct: 62  TRINAAARQNGLSYSKFINGLKKAGISLNRKVLADMAINDQKAFAELVEIAKKQI 116


>gi|295696881|ref|YP_003590119.1| ribosomal protein L20 [Bacillus tusciae DSM 2912]
 gi|295412483|gb|ADG06975.1| ribosomal protein L20 [Bacillus tusciae DSM 2912]
          Length = 119

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 53/119 (44%), Positives = 81/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKV+K A+G++G +    + A   V +S  YAYRDRR +KRDFR L
Sbjct: 1   MARVKGGPVTRRRRKKVIKLARGYFGAKHRLYKMANQQVMKSLMYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+ ++GL  AG+ ++RK+L+DLA+    +F ++  L++++L  
Sbjct: 61  WISRINAAARLNGLSYSRLMHGLKMAGVEVNRKMLADLAVNDDKAFAELANLAKTKLNA 119


>gi|257066830|ref|YP_003153086.1| 50S ribosomal protein L20 [Anaerococcus prevotii DSM 20548]
 gi|256798710|gb|ACV29365.1| ribosomal protein L20 [Anaerococcus prevotii DSM 20548]
          Length = 117

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 77/115 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HKKVLK AKG+YG +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKKVLKQAKGYYGSKSLLFRTANQAVMKSLNYAYIGRKHRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+   +YS+F+  L KA I ++RK+L++LA+   + F K+VEL+  
Sbjct: 61  WIARINAAARLNGTSYSKFMGNLKKANIDINRKMLAELAVNNPEEFAKLVELANQ 115


>gi|164687658|ref|ZP_02211686.1| hypothetical protein CLOBAR_01300 [Clostridium bartlettii DSM
           16795]
 gi|164603432|gb|EDQ96897.1| hypothetical protein CLOBAR_01300 [Clostridium bartlettii DSM
           16795]
          Length = 118

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 81/118 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  + +  KHKKVLK AKG+ G R    R A   V ++ + AY  R++KKRDFR L
Sbjct: 1   MARVKGAMNARKKHKKVLKLAKGYRGSRSKLYRPANTFVMKALKNAYIGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R+  ++YS+ +NGL  AG+ ++RK+LS++AI     F ++VE+++++L 
Sbjct: 61  WIQRINAAARMNGISYSRLMNGLKLAGVEVNRKMLSEMAIQDPAGFAQLVEVAKAKLA 118


>gi|110678354|ref|YP_681361.1| 50S ribosomal protein L20 [Roseobacter denitrificans OCh 114]
 gi|123362196|sp|Q16BG8|RL20_ROSDO RecName: Full=50S ribosomal protein L20
 gi|109454470|gb|ABG30675.1| ribosomal protein L20 [Roseobacter denitrificans OCh 114]
          Length = 121

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 96/121 (79%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRTKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV+ ++  L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVKQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|71894618|ref|YP_278726.1| 50S ribosomal protein L20 [Mycoplasma synoviae 53]
 gi|109893125|sp|Q4A5F6|RL20_MYCS5 RecName: Full=50S ribosomal protein L20
 gi|71851406|gb|AAZ44015.1| 50S ribosomal protein L20 [Mycoplasma synoviae 53]
          Length = 116

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 61/116 (52%), Positives = 86/116 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK +K AKG++G +    + AK AV +S  YA+RDR+  KR+FR L
Sbjct: 1   MARVKGGTVTRARRKKWIKLAKGYFGHKSVGYKVAKQAVVKSWTYAFRDRKQVKRNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAAVR + L+YSQFINGL KA ++++RK+LS+LAI Q  +F+K+V+L + +
Sbjct: 61  WIARINAAVRPHGLSYSQFINGLKKAEVLINRKMLSELAINQPQTFEKLVKLVQGK 116


>gi|254519560|ref|ZP_05131616.1| ribosomal protein L20 [Clostridium sp. 7_2_43FAA]
 gi|226913309|gb|EEH98510.1| ribosomal protein L20 [Clostridium sp. 7_2_43FAA]
          Length = 118

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   HKKVLK AKG+YG +    + A  +V R+ + AY  RR+KKRDFR L
Sbjct: 1   MARVKRAVNARKNHKKVLKLAKGYYGGKSRLFKTANESVIRALRNAYVGRRLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL  AGI ++RK+LS++AI    +F  +VEL++S +
Sbjct: 61  WIARINAASRMNGLSYSRFMNGLKLAGIDMNRKMLSEIAINDPKAFADLVELAKSSI 117


>gi|253577271|ref|ZP_04854590.1| 50S ribosomal protein L20 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843385|gb|EES71414.1| 50S ribosomal protein L20 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 119

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/119 (46%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK AKG++G +    + A   V +S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGFVVRRRHKKVLKLAKGYFGSKHRIFKTANEQVMKSLLYAYRDRRAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+ ++GL  A + ++RK+L+DLA+  L++F  +  +++ ++  
Sbjct: 61  WIVRINAAARMNGLSYSKLMHGLKLADVNINRKMLADLAVNDLNAFNSLAAVAKEKINA 119


>gi|310658435|ref|YP_003936156.1| 50S ribosomal protein L20 [Clostridium sticklandii DSM 519]
 gi|308825213|emb|CBH21251.1| 50S ribosomal subunit protein L20 [Clostridium sticklandii]
          Length = 119

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/119 (46%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+ + +  KHKK+LK AKGF G R    R A A V ++ ++AY  R++KKRDFR +
Sbjct: 1   MARVKKALNARKKHKKILKLAKGFRGGRSKLFRPANAFVMKALKHAYSGRKLKKRDFRQM 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R++ L+YS+F+NGL  +GI L+RK+LS++AI     F+ +V  ++  L  
Sbjct: 61  WIARINAGTRMHGLSYSRFMNGLKISGINLNRKMLSEMAINDPQGFENLVNTAKKALNA 119


>gi|194246832|ref|YP_002004471.1| 50S ribosomal protein L20 [Candidatus Phytoplasma mali]
 gi|193807189|emb|CAP18630.1| LSU ribosomal protein L20 [Candidatus Phytoplasma mali]
          Length = 226

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+++        + KK+LK AKG+ G +    + A   V RS QYAYRDR+ +KR+F+ L
Sbjct: 1   MSKISFVPARHRRRKKILKLAKGYVGSKSTIYKTAHEQVMRSLQYAYRDRKQRKREFKKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINA+V  Y + YS F++GL  A + ++RKVLS+LAI   D F + VEL++  L   
Sbjct: 61  WISRINASVFAYGIKYSSFVHGLKLANVFINRKVLSELAIHNPDVFVQYVELAKKFLSEK 120

Query: 121 VAS 123
           +++
Sbjct: 121 IST 123


>gi|149913185|ref|ZP_01901719.1| 50S ribosomal protein L20 [Roseobacter sp. AzwK-3b]
 gi|149813591|gb|EDM73417.1| 50S ribosomal protein L20 [Roseobacter sp. AzwK-3b]
          Length = 121

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/120 (59%), Positives = 96/120 (80%), Gaps = 2/120 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVVKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVY--DLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +   L YS+FINGL KAG+ +DRKVL+DLA+ +  +F  IV+ ++S L 
Sbjct: 61  WIQRINAAVRAHDEGLTYSRFINGLAKAGVEVDRKVLADLAVREPAAFGAIVDQAKSALA 120


>gi|118470795|ref|YP_888084.1| 50S ribosomal protein L20 [Mycobacterium smegmatis str. MC2 155]
 gi|166219662|sp|A0QYU6|RL20_MYCS2 RecName: Full=50S ribosomal protein L20
 gi|118172082|gb|ABK72978.1| ribosomal protein L20 [Mycobacterium smegmatis str. MC2 155]
          Length = 129

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRALNAQKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L++LA++   +F  +V+++R+ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLAELAVSDPAAFTALVDVARAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|163732661|ref|ZP_02140106.1| 50S ribosomal protein L20 [Roseobacter litoralis Och 149]
 gi|161394021|gb|EDQ18345.1| 50S ribosomal protein L20 [Roseobacter litoralis Och 149]
          Length = 121

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 69/121 (57%), Positives = 95/121 (78%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R K G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRTKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL  AGI +DRKVL+DLA+ + ++F  IV+ ++  L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLSLAGIEVDRKVLADLAVHEPEAFGAIVKQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|260584102|ref|ZP_05851850.1| 50S ribosomal protein L20 [Granulicatella elegans ATCC 700633]
 gi|260158728|gb|EEW93796.1| 50S ribosomal protein L20 [Granulicatella elegans ATCC 700633]
          Length = 119

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 80/118 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  +  +VLK AKG+YG +    + AK AV +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRRRRNRVLKLAKGYYGAKSKLFKTAKQAVMKSYMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F  + E ++S L 
Sbjct: 61  WIARINAAARLNGLSYSKLMHGLKLAGIEMNRKMLADLAVNDAAAFTVLAEQAKSALA 118


>gi|71066551|ref|YP_265278.1| 50S ribosomal protein L20 [Psychrobacter arcticus 273-4]
 gi|93007124|ref|YP_581561.1| 50S ribosomal protein L20 [Psychrobacter cryohalolentis K5]
 gi|109893139|sp|Q4FQ64|RL20_PSYA2 RecName: Full=50S ribosomal protein L20
 gi|109893140|sp|Q1Q8C6|RL20_PSYCK RecName: Full=50S ribosomal protein L20
 gi|71039536|gb|AAZ19844.1| LSU ribosomal protein L20P [Psychrobacter arcticus 273-4]
 gi|92394802|gb|ABE76077.1| LSU ribosomal protein L20P [Psychrobacter cryohalolentis K5]
          Length = 118

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV ++ +HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQANRRHKKILKRAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRNKKRTFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R+  L+YS+FING+ KA I +DR+VL+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAGARLNGLSYSRFINGMKKANIAIDRRVLADIAMHDAATFTALVEKAKAELA 118


>gi|157964750|ref|YP_001499574.1| 50S ribosomal protein L20 [Rickettsia massiliae MTU5]
 gi|166984768|sp|A8F291|RL20_RICM5 RecName: Full=50S ribosomal protein L20
 gi|157844526|gb|ABV85027.1| 50S ribosomal protein L20 [Rickettsia massiliae MTU5]
          Length = 117

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVK G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRVKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR ++L YSQF+  L KAGI ++RKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHELVYSQFMGALKKAGIDINRKVLAELAVNNSDGFVSIVEKAKAHI 117


>gi|90021227|ref|YP_527054.1| 50S ribosomal protein L20 [Saccharophagus degradans 2-40]
 gi|109893149|sp|Q21KD7|RL20_SACD2 RecName: Full=50S ribosomal protein L20
 gi|89950827|gb|ABD80842.1| LSU ribosomal protein L20P [Saccharophagus degradans 2-40]
          Length = 119

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 69/119 (57%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKKVLK+AKG+YG R    R AK AV ++ QYAYRDRRVKKR+FR+L
Sbjct: 1   MARVKRGVVARRRHKKVLKAAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+ I GL KA I LDR+VL+DLAI    +F  IV  ++  L  
Sbjct: 61  WITRINAQSRAEGLSYSRLIAGLKKASIALDRRVLADLAIHDKTAFAAIVAKAQEALAA 119


>gi|120554975|ref|YP_959326.1| 50S ribosomal protein L20 [Marinobacter aquaeolei VT8]
 gi|166219659|sp|A1U2C0|RL20_MARAV RecName: Full=50S ribosomal protein L20
 gi|120324824|gb|ABM19139.1| LSU ribosomal protein L20P [Marinobacter aquaeolei VT8]
          Length = 117

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKILNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRRNRKRAFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA + +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARANGLSYSRLIAGLKKANVEIDRKVLADLAMNEQQAFAAVVEKAKASL 117


>gi|259417072|ref|ZP_05740991.1| ribosomal protein L20 [Silicibacter sp. TrichCH4B]
 gi|259345978|gb|EEW57792.1| ribosomal protein L20 [Silicibacter sp. TrichCH4B]
          Length = 121

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 70/121 (57%), Positives = 96/121 (79%), Gaps = 2/121 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV  ++  L 
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIVRQAQDALA 120

Query: 119 V 119
            
Sbjct: 121 A 121


>gi|18310874|ref|NP_562808.1| 50S ribosomal protein L20 [Clostridium perfringens str. 13]
 gi|110800475|ref|YP_696572.1| 50S ribosomal protein L20 [Clostridium perfringens ATCC 13124]
 gi|110803986|ref|YP_699170.1| 50S ribosomal protein L20 [Clostridium perfringens SM101]
 gi|168206057|ref|ZP_02632062.1| ribosomal protein L20 [Clostridium perfringens E str. JGS1987]
 gi|168211662|ref|ZP_02637287.1| ribosomal protein L20 [Clostridium perfringens B str. ATCC 3626]
 gi|168215518|ref|ZP_02641143.1| ribosomal protein L20 [Clostridium perfringens NCTC 8239]
 gi|169343623|ref|ZP_02864622.1| ribosomal protein L20 [Clostridium perfringens C str. JGS1495]
 gi|182626155|ref|ZP_02953915.1| ribosomal protein L20 [Clostridium perfringens D str. JGS1721]
 gi|20978574|sp|Q8XJ69|RL20_CLOPE RecName: Full=50S ribosomal protein L20
 gi|123148628|sp|Q0TP68|RL20_CLOP1 RecName: Full=50S ribosomal protein L20
 gi|123341669|sp|Q0SRT7|RL20_CLOPS RecName: Full=50S ribosomal protein L20
 gi|18145556|dbj|BAB81598.1| 50S ribosomal protein L20 [Clostridium perfringens str. 13]
 gi|110675122|gb|ABG84109.1| 50S ribosomal protein L20 [Clostridium perfringens ATCC 13124]
 gi|110684487|gb|ABG87857.1| 50S ribosomal protein L20 [Clostridium perfringens SM101]
 gi|169298183|gb|EDS80273.1| ribosomal protein L20 [Clostridium perfringens C str. JGS1495]
 gi|170662466|gb|EDT15149.1| ribosomal protein L20 [Clostridium perfringens E str. JGS1987]
 gi|170710359|gb|EDT22541.1| ribosomal protein L20 [Clostridium perfringens B str. ATCC 3626]
 gi|177908592|gb|EDT71117.1| ribosomal protein L20 [Clostridium perfringens D str. JGS1721]
 gi|182382110|gb|EDT79589.1| ribosomal protein L20 [Clostridium perfringens NCTC 8239]
          Length = 119

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 81/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   HKKVLK AKG+YG +    + A  +V R+ + AY  RR+KKRD+R L
Sbjct: 1   MARVKRAVNARKNHKKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRRLKKRDYRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+  AG+ ++RK+LS++AI    +F  +VEL++  L  
Sbjct: 61  WIARINAATRMNGLSYSRFMNGMKLAGVDINRKMLSEIAINDPKAFADLVELAKKHLNA 119


>gi|302330632|gb|ADL20826.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis 1002]
          Length = 127

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K +++LK+AKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSLDAKKKRREILKAAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  A I +DRKVL+DLA+    +F  I E +++ L  D
Sbjct: 61  WITRINAAARMNDITYNRLIQGLRLAEIEVDRKVLADLAVNDFAAFSAICEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|225181658|ref|ZP_03735098.1| ribosomal protein L20 [Dethiobacter alkaliphilus AHT 1]
 gi|225167639|gb|EEG76450.1| ribosomal protein L20 [Dethiobacter alkaliphilus AHT 1]
          Length = 117

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/116 (46%), Positives = 83/116 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HK+V+K AKG++G +    + A  AV +S   AYRDRR++KRD+R L
Sbjct: 1   MPRVKRGVATRARHKRVIKLAKGYFGAKSKLFKTANQAVMKSLANAYRDRRLRKRDYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA RV  ++YS+ + GL +AGI ++RK+L+DLA+   + F +++ +++  
Sbjct: 61  WISRINAAARVNGMSYSRMMYGLKRAGIDINRKMLADLAVNDAEGFSQLIGVAKEN 116


>gi|311693965|gb|ADP96838.1| ribosomal protein L20, bacterial-type [marine bacterium HP15]
          Length = 117

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L  AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MARVKRGVVARRRHKKILNQAKGYYGARSRVFRVAKQAVIKAGQYAYRDRRNRKRAFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R   L+YS+ I GL KA + +DRKVL+DLA+ +  +F  +VE +++ L
Sbjct: 61  WIARINAGARANGLSYSRLIAGLKKANVEIDRKVLADLAMNEQQAFAAVVEKAKASL 117


>gi|150398671|ref|YP_001329138.1| 50S ribosomal protein L20 [Sinorhizobium medicae WSM419]
 gi|166220787|sp|A6UF73|RL20_SINMW RecName: Full=50S ribosomal protein L20
 gi|150030186|gb|ABR62303.1| ribosomal protein L20 [Sinorhizobium medicae WSM419]
          Length = 134

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 99/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK LK+AKGFYGRRKNTIRAAKAAVDRS+Q+AYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLKAAKGFYGRRKNTIRAAKAAVDRSKQFAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE S+  L 
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEASKKALA 118


>gi|300858364|ref|YP_003783347.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|300685818|gb|ADK28740.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302206079|gb|ADL10421.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis C231]
 gi|308276317|gb|ADO26216.1| 50S ribosomal protein L20 [Corynebacterium pseudotuberculosis I19]
          Length = 127

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K +++LK+AKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSLNAKKKRREILKAAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  A I +DRKVL+DLA+    +F  I E +++ L  D
Sbjct: 61  WITRINAAARMNDITYNRLIQGLRLAEIEVDRKVLADLAVNDFAAFSAICEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|257790988|ref|YP_003181594.1| 50S ribosomal protein L20 [Eggerthella lenta DSM 2243]
 gi|317488302|ref|ZP_07946865.1| ribosomal protein L20 [Eggerthella sp. 1_3_56FAA]
 gi|325830898|ref|ZP_08164282.1| ribosomal protein L20 [Eggerthella sp. HGA1]
 gi|257474885|gb|ACV55205.1| ribosomal protein L20 [Eggerthella lenta DSM 2243]
 gi|316912587|gb|EFV34133.1| ribosomal protein L20 [Eggerthella sp. 1_3_56FAA]
 gi|325487305|gb|EGC89748.1| ribosomal protein L20 [Eggerthella sp. HGA1]
          Length = 117

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  AKG+YG +  + RAAK  V  S QY YRDRR KKR+ R L
Sbjct: 1   MPRVKRAVSAHKKRRTVLNRAKGYYGAKSRSYRAAKEQVQHSLQYMYRDRRNKKREIRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  +NGL KAG+ LDRKVLSD+AI    +F  I E+++  L
Sbjct: 61  WITRINAAARINGMSYSVLMNGLKKAGVQLDRKVLSDMAINDPAAFTAITEVAKKAL 117


>gi|15964037|ref|NP_384390.1| 50S ribosomal protein L20 [Sinorhizobium meliloti 1021]
 gi|307301183|ref|ZP_07580945.1| ribosomal protein L20 [Sinorhizobium meliloti BL225C]
 gi|307321084|ref|ZP_07600489.1| ribosomal protein L20 [Sinorhizobium meliloti AK83]
 gi|20978619|sp|Q92ST1|RL20_RHIME RecName: Full=50S ribosomal protein L20
 gi|15073213|emb|CAC41721.1| Probable 50S ribosomal protein L20 [Sinorhizobium meliloti 1021]
 gi|306893256|gb|EFN24037.1| ribosomal protein L20 [Sinorhizobium meliloti AK83]
 gi|306903639|gb|EFN34226.1| ribosomal protein L20 [Sinorhizobium meliloti BL225C]
          Length = 134

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 83/118 (70%), Positives = 99/118 (83%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK LK+AKGFYGRRKNTIRAAKAAVDRS+Q+AYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLKAAKGFYGRRKNTIRAAKAAVDRSKQFAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI +  +F  +VE S+  L 
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPAAFGALVEASKKALA 118


>gi|194366575|ref|YP_002029185.1| 50S ribosomal protein L20 [Stenotrophomonas maltophilia R551-3]
 gi|226730458|sp|B4SQH1|RL20_STRM5 RecName: Full=50S ribosomal protein L20
 gi|194349379|gb|ACF52502.1| ribosomal protein L20 [Stenotrophomonas maltophilia R551-3]
          Length = 119

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILDLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L  
Sbjct: 61  WITRINAAARINGLSYSRFMNGLLKAGITLDRKVLADIAVHDAAGFTALAEKAKGALAA 119


>gi|307293506|ref|ZP_07573350.1| ribosomal protein L20 [Sphingobium chlorophenolicum L-1]
 gi|306879657|gb|EFN10874.1| ribosomal protein L20 [Sphingobium chlorophenolicum L-1]
          Length = 120

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 68/110 (61%), Positives = 87/110 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR L
Sbjct: 1   MARVKRGTTTKAKHKRILDQAKGYYGRRKNTIRVARQAVEKAGQYAYRDRKVKKRTFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINA VR   L YSQF++GL  AG+ LDRKVL+D+A+ + ++F  I+
Sbjct: 61  WIQRINAGVRAEGLTYSQFMHGLKLAGVELDRKVLADIAMHEGEAFSAII 110


>gi|154509023|ref|ZP_02044665.1| hypothetical protein ACTODO_01540 [Actinomyces odontolyticus ATCC
           17982]
 gi|293192347|ref|ZP_06609458.1| ribosomal protein L20 [Actinomyces odontolyticus F0309]
 gi|153798657|gb|EDN81077.1| hypothetical protein ACTODO_01540 [Actinomyces odontolyticus ATCC
           17982]
 gi|292820262|gb|EFF79256.1| ribosomal protein L20 [Actinomyces odontolyticus F0309]
          Length = 126

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y+YRDR+ KK DFR L
Sbjct: 1   MARVKRSVNAKKKRRTVLEQASGYRGQRSRMYRKAKEQVTHSFVYSYRDRKAKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL+ AG+ +DR++L++LA+  +++F  +V++++  L  D
Sbjct: 61  WIQRINAASRAQGLTYNRLIQGLNLAGVEVDRRMLAELAVGDINAFNALVKVAKDALPAD 120

Query: 121 VAS 123
           + +
Sbjct: 121 INA 123


>gi|315604405|ref|ZP_07879471.1| inorganic diphosphatase [Actinomyces sp. oral taxon 180 str. F0310]
 gi|315314111|gb|EFU62162.1| inorganic diphosphatase [Actinomyces sp. oral taxon 180 str. F0310]
          Length = 126

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y+YRDR+ KK DFR L
Sbjct: 1   MARVKRSVNAKKKRRTVLEQASGYRGQRSRMYRKAKEQVTHSFVYSYRDRKAKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL+ AG+ +DR++L++LA+  +++F  +V +++  L  D
Sbjct: 61  WIQRINAASRAQGLTYNRLIQGLNLAGVEVDRRMLAELAVNDINAFNALVTVAKDVLPAD 120

Query: 121 VAS 123
           + +
Sbjct: 121 INA 123


>gi|295099718|emb|CBK88807.1| LSU ribosomal protein L20P [Eubacterium cylindroides T2-87]
          Length = 119

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/119 (44%), Positives = 78/119 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G VS A+ K+VLK AKG++G +    + A   V  S +YAY DRR  K + R +
Sbjct: 1   MARVKGGTVSRARRKRVLKLAKGYFGSKHTLYKTANEQVMHSFKYAYNDRRKLKGNMRKI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+ DL+YS+ ++GL  A I ++RK+LS++AI   +SF K+ + +++ L  
Sbjct: 61  WIARINAAARMNDLSYSRLMHGLKLANISINRKMLSEMAIHDAESFTKLCDEAKAALNA 119


>gi|163839503|ref|YP_001623908.1| 50S ribosomal protein L20P [Renibacterium salmoninarum ATCC 33209]
 gi|189041878|sp|A9WQB1|RL20_RENSM RecName: Full=50S ribosomal protein L20
 gi|162952979|gb|ABY22494.1| LSU ribosomal protein L20P [Renibacterium salmoninarum ATCC 33209]
          Length = 127

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ AKG+ G+R    R AK  +  S  Y+Y DRR +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAKGYRGQRSRLYRKAKEQLLHSFVYSYGDRRKRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL  A I +DR++LS+LA+    +F  +V+L+++ L  D
Sbjct: 61  WIQRINAASRANGLTYNRLIQGLKAASIEVDRRMLSELAVNDAAAFAGLVKLAKAALPAD 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|29654621|ref|NP_820313.1| 50S ribosomal protein L20 [Coxiella burnetii RSA 493]
 gi|153207450|ref|ZP_01946150.1| ribosomal protein L20 [Coxiella burnetii 'MSU Goat Q177']
 gi|154706682|ref|YP_001424760.1| 50S ribosomal protein L20 [Coxiella burnetii Dugway 5J108-111]
 gi|161830026|ref|YP_001597172.1| 50S ribosomal protein L20 [Coxiella burnetii RSA 331]
 gi|165924061|ref|ZP_02219893.1| ribosomal protein L20 [Coxiella burnetii RSA 334]
 gi|212212296|ref|YP_002303232.1| 50S ribosomal protein L20 [Coxiella burnetii CbuG_Q212]
 gi|212218735|ref|YP_002305522.1| 50S ribosomal protein L20 [Coxiella burnetii CbuK_Q154]
 gi|39931900|sp|Q83C13|RL20_COXBU RecName: Full=50S ribosomal protein L20
 gi|189041858|sp|A9KGB8|RL20_COXBN RecName: Full=50S ribosomal protein L20
 gi|189041859|sp|A9N8K2|RL20_COXBR RecName: Full=50S ribosomal protein L20
 gi|226730381|sp|B6J7X8|RL20_COXB1 RecName: Full=50S ribosomal protein L20
 gi|226730382|sp|B6IZF9|RL20_COXB2 RecName: Full=50S ribosomal protein L20
 gi|29541889|gb|AAO90827.1| LSU ribosomal protein L20P [Coxiella burnetii RSA 493]
 gi|120576581|gb|EAX33205.1| ribosomal protein L20 [Coxiella burnetii 'MSU Goat Q177']
 gi|154355968|gb|ABS77430.1| LSU ribosomal protein L20P [Coxiella burnetii Dugway 5J108-111]
 gi|161761893|gb|ABX77535.1| ribosomal protein L20 [Coxiella burnetii RSA 331]
 gi|165916493|gb|EDR35097.1| ribosomal protein L20 [Coxiella burnetii RSA 334]
 gi|212010706|gb|ACJ18087.1| LSU ribosomal protein L20P [Coxiella burnetii CbuG_Q212]
 gi|212012997|gb|ACJ20377.1| LSU ribosomal protein L20P [Coxiella burnetii CbuK_Q154]
          Length = 119

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+ +KR FR+L
Sbjct: 1   MPRVKRGVTARARHKKVLTKAKGYYGARSRVFRVAKQAVIKAAQYAYRDRKQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R + L+YS+ INGL KA + +DRK L++LA+    +F K+ E ++  L
Sbjct: 61  WIVRINAAAREHGLSYSRLINGLMKASVAIDRKNLAELAVYDKAAFGKLAEKAKQAL 117


>gi|294013439|ref|YP_003546899.1| ribosomal protein L20 [Sphingobium japonicum UT26S]
 gi|292676769|dbj|BAI98287.1| ribosomal protein L20 [Sphingobium japonicum UT26S]
          Length = 120

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 68/110 (61%), Positives = 87/110 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR L
Sbjct: 1   MARVKRGTTTKAKHKRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRTFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINA VR   L YSQF++GL  AG+ LDRKVL+D+A+ + ++F  I+
Sbjct: 61  WIQRINAGVRAEGLTYSQFMHGLKLAGVELDRKVLADIAMHEGEAFSAII 110


>gi|15604459|ref|NP_220977.1| 50S ribosomal protein L20 [Rickettsia prowazekii str. Madrid E]
 gi|6225976|sp|Q9ZCV0|RL20_RICPR RecName: Full=50S ribosomal protein L20
 gi|3861153|emb|CAA15053.1| CYANELLE 50S RIBOSOMAL PROTEIN L20 (rplT) [Rickettsia prowazekii]
 gi|292572233|gb|ADE30148.1| 50S ribosomal protein L20 [Rickettsia prowazekii Rp22]
          Length = 117

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  N  R A   V++  QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKKRHKKILKLAKGYRGRANNCFRVAIEKVEKGLQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L KAGI +DRKVL++LA+   D F  IV+ S++ +
Sbjct: 61  WIQRINAAVREHGLIYSQFMGALKKAGINIDRKVLAELAVNNNDGFASIVQQSKAHI 117


>gi|103488416|ref|YP_617977.1| 50S ribosomal protein L20 [Sphingopyxis alaskensis RB2256]
 gi|122984715|sp|Q1GNX8|RL20_SPHAL RecName: Full=50S ribosomal protein L20
 gi|98978493|gb|ABF54644.1| LSU ribosomal protein L20P [Sphingopyxis alaskensis RB2256]
          Length = 121

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 70/118 (59%), Positives = 92/118 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R+KRG  + AKHK++L  AKG+YGRRKNTIR A+ AV+++ QYAYRDR+VKKR FR+L
Sbjct: 1   MSRIKRGTTTRAKHKRILDQAKGYYGRRKNTIRIARQAVEKAGQYAYRDRKVKKRSFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L YSQF++G+  AGI LDRKV++DLA+ +   F  IV  +++ L 
Sbjct: 61  WIQRINAAVRAEGLTYSQFMHGVKLAGIELDRKVMADLAMNEGGVFTAIVAQAKAALP 118


>gi|259046986|ref|ZP_05737387.1| 50S ribosomal protein L20 [Granulicatella adiacens ATCC 49175]
 gi|259036429|gb|EEW37684.1| 50S ribosomal protein L20 [Granulicatella adiacens ATCC 49175]
          Length = 119

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 79/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  +  +VLK AKG+YG +    + AK AV +S  YAYRDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRRRRNRVLKLAKGYYGAKSKLFKTAKQAVMKSYMYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  AGI ++RK+L+DLA+    +F  + + ++  L 
Sbjct: 61  WIARINAAARLNGLSYSKLMHGLKLAGIEMNRKMLADLAVNDAAAFTVLADKAKEALA 118


>gi|256832337|ref|YP_003161064.1| 50S ribosomal protein L20 [Jonesia denitrificans DSM 20603]
 gi|256685868|gb|ACV08761.1| ribosomal protein L20 [Jonesia denitrificans DSM 20603]
          Length = 128

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  Y YRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTVLERASGYRGQRSRLYRKAKEQVTHSLVYNYRDRKRRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  AG+ +DR+VL++LA++ +++F  +V ++++ L  D
Sbjct: 61  WIQRINAAARAQGMTYNRFIQGLKAAGVEVDRRVLAELAVSDINAFNALVTVAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|332798667|ref|YP_004460166.1| 50S ribosomal protein L20 [Tepidanaerobacter sp. Re1]
 gi|332696402|gb|AEE90859.1| 50S ribosomal protein L20 [Tepidanaerobacter sp. Re1]
          Length = 118

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 85/116 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+GV +  KHKKV+K AKG+ G +    R A  AV ++Q +AYR R++KKRDFR L
Sbjct: 1   MARVKKGVTARKKHKKVIKLAKGYRGSKSKLFRPANQAVLKAQSHAYRGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   ++YS+FINGL KAG+ ++RK+LS++AI   + F ++V+++++ 
Sbjct: 61  WIARINAAARSNGISYSKFINGLKKAGVQINRKMLSEMAINDANGFTQLVDIAKAN 116


>gi|330813585|ref|YP_004357824.1| LSU ribosomal protein L20p [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486680|gb|AEA81085.1| LSU ribosomal protein L20p [Candidatus Pelagibacter sp. IMCC9063]
          Length = 118

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 76/117 (64%), Positives = 87/117 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  S  KHKKV K AKGF GRRKNTIR AK AV++S QYAYRDRR  KR FRSL
Sbjct: 1   MARVKRGQASHQKHKKVFKQAKGFRGRRKNTIRVAKQAVEKSLQYAYRDRRRNKRIFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINA VR   L YS+FINGL K+ I +DRKVL+D+A    ++FK IV+  +S L
Sbjct: 61  WIQRINAGVRAEGLTYSKFINGLIKSKIKIDRKVLADIAYHNPETFKSIVKKVQSHL 117


>gi|331697624|ref|YP_004333863.1| 50S ribosomal protein L20 [Pseudonocardia dioxanivorans CB1190]
 gi|326952313|gb|AEA26010.1| 50S ribosomal protein L20 [Pseudonocardia dioxanivorans CB1190]
          Length = 128

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 76/122 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L++A G+ G+R    R AK  +  S  YAYRDRR KK +FR L
Sbjct: 1   MARVKRAVNAQKKRRTTLEAASGYRGQRSRLYRKAKEQMLHSLNYAYRDRRAKKGEFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINA  R   + Y++FI GL  AG+ +DRK LS+LAI+   +F  +VEL+R+ +   
Sbjct: 61  WITRINAGARANGMTYNRFIQGLKAAGVEVDRKNLSELAISDPAAFTALVELARANVPAQ 120

Query: 121 VA 122
            A
Sbjct: 121 GA 122


>gi|163815464|ref|ZP_02206837.1| hypothetical protein COPEUT_01629 [Coprococcus eutactus ATCC 27759]
 gi|158449101|gb|EDP26096.1| hypothetical protein COPEUT_01629 [Coprococcus eutactus ATCC 27759]
 gi|295093747|emb|CBK82838.1| LSU ribosomal protein L20P [Coprococcus sp. ART55/1]
          Length = 118

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  KH KVLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARVKGGMNAKQKHNKVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ D++YS+ ++GL  AG+ ++RK+LS++AI+  + F K+VE+++++L 
Sbjct: 61  WIARINAAARMNDISYSKLMHGLKLAGVDINRKMLSEMAISDAEGFAKLVEVAKAQLS 118


>gi|116495178|ref|YP_806912.1| 50S ribosomal protein L20 [Lactobacillus casei ATCC 334]
 gi|191638686|ref|YP_001987852.1| 50S ribosomal protein L20 [Lactobacillus casei BL23]
 gi|227534806|ref|ZP_03964855.1| 50S ribosomal protein L20 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239632059|ref|ZP_04675090.1| 50S ribosomal protein L20 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301066741|ref|YP_003788764.1| 50S ribosomal protein L20 [Lactobacillus casei str. Zhang]
 gi|122263405|sp|Q038A2|RL20_LACC3 RecName: Full=50S ribosomal protein L20
 gi|226730412|sp|B3WF43|RL20_LACCB RecName: Full=50S ribosomal protein L20
 gi|116105328|gb|ABJ70470.1| LSU ribosomal protein L20P [Lactobacillus casei ATCC 334]
 gi|190712988|emb|CAQ66994.1| 50S ribosomal protein L20 [Lactobacillus casei BL23]
 gi|227187562|gb|EEI67629.1| 50S ribosomal protein L20 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239526524|gb|EEQ65525.1| 50S ribosomal protein L20 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300439148|gb|ADK18914.1| Ribosomal protein L20 [Lactobacillus casei str. Zhang]
 gi|327382727|gb|AEA54203.1| 50S ribosomal protein L20 [Lactobacillus casei LC2W]
 gi|327385914|gb|AEA57388.1| 50S ribosomal protein L20 [Lactobacillus casei BD-II]
          Length = 118

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 81/118 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KKVLK AKG+ G +    +AA A V  S +YA+RDRR KKRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKVLKLAKGYRGAKHLLFKAANAQVMVSYRYAFRDRRAKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ D++YS+ ++GL  A + ++RK+L+DLA++  D FK + + ++  L 
Sbjct: 61  WIARINAAARMNDISYSKLMHGLKVANVDMNRKMLADLAVSDPDGFKAVADTAKKALA 118


>gi|319440342|ref|ZP_07989498.1| 50S ribosomal protein L20 [Corynebacterium variabile DSM 44702]
          Length = 127

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++L  A G+ G+R    R AK  V  S+ YA+RDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREILNEASGYRGQRSRLYRKAKEQVLHSKTYAFRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R  D+ Y++ I GL  AGI +DRK L+++A++   +F  +VE +++ L  D
Sbjct: 61  WIQRINAAARANDITYNRLIQGLRLAGIEVDRKNLAEIAVSDPAAFTALVEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|220934625|ref|YP_002513524.1| ribosomal protein L20 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254800349|sp|B8GRI3|RL20_THISH RecName: Full=50S ribosomal protein L20
 gi|219995935|gb|ACL72537.1| ribosomal protein L20 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 119

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 64/109 (58%), Positives = 84/109 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG RKN  R A  AV ++ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKVLKKAKGYYGARKNVYRVAVQAVTKAGQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKI 109
           WI RINAA R + L+YS+ ++GL+KA + +DRKVL+DLA+  + +F +I
Sbjct: 61  WIVRINAAARQFGLSYSRMMDGLNKANVEIDRKVLADLAVHDITAFGQI 109


>gi|108799945|ref|YP_640142.1| 50S ribosomal protein L20 [Mycobacterium sp. MCS]
 gi|119869055|ref|YP_939007.1| 50S ribosomal protein L20 [Mycobacterium sp. KMS]
 gi|126435573|ref|YP_001071264.1| 50S ribosomal protein L20 [Mycobacterium sp. JLS]
 gi|122976853|sp|Q1B7P8|RL20_MYCSS RecName: Full=50S ribosomal protein L20
 gi|166219663|sp|A3Q0U6|RL20_MYCSJ RecName: Full=50S ribosomal protein L20
 gi|166219664|sp|A1UHA9|RL20_MYCSK RecName: Full=50S ribosomal protein L20
 gi|108770364|gb|ABG09086.1| LSU ribosomal protein L20P [Mycobacterium sp. MCS]
 gi|119695144|gb|ABL92217.1| LSU ribosomal protein L20P [Mycobacterium sp. KMS]
 gi|126235373|gb|ABN98773.1| LSU ribosomal protein L20P [Mycobacterium sp. JLS]
          Length = 129

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VLK++KG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAQKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+++A++   +F  +VE++++ L  D
Sbjct: 61  WISRINAAARANDITYNRLIQGLKAAGVEVDRKNLAEIAVSDAAAFTALVEVAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|34557221|ref|NP_907036.1| 50S ribosomal protein L20 [Wolinella succinogenes DSM 1740]
 gi|39931691|sp|Q7M9L7|RL20_WOLSU RecName: Full=50S ribosomal protein L20
 gi|34482937|emb|CAE09936.1| RIBOSOMAL PROTEIN L20 [Wolinella succinogenes]
          Length = 117

 Score =  148 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK A+GFY  R+   R AK  ++RS  YA+RDR+ KKRDFRSL
Sbjct: 1   MPRVKTGTVRRQRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ +++YS+F++GL  A I LDRK+L+D+A+ +  +F KIVE ++  L
Sbjct: 61  WITRINAACRINEISYSRFMHGLKLANIELDRKILADMAMNEPANFAKIVEAAKKAL 117


>gi|257440570|ref|ZP_05616325.1| ribosomal protein L20 [Faecalibacterium prausnitzii A2-165]
 gi|257196893|gb|EEU95177.1| ribosomal protein L20 [Faecalibacterium prausnitzii A2-165]
          Length = 116

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 75/116 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K   ++  + KK+LK AKGFYG +    + AK  V +S  YA   RR+KKR FR+L
Sbjct: 1   MARIKGATMTHKRRKKMLKLAKGFYGCKSKHFKMAKQQVMKSGNYALAGRRMKKRQFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RIN AVR   +NYS F+ GL KAGI L+RK+LS++AI    SF  +VE  ++ 
Sbjct: 61  WICRINNAVRPLGMNYSTFMAGLKKAGIELNRKMLSEMAINDPQSFAALVETVKNA 116


>gi|50086059|ref|YP_047569.1| 50S ribosomal protein L20 [Acinetobacter sp. ADP1]
 gi|126640666|ref|YP_001083650.1| 50S ribosomal protein L20 [Acinetobacter baumannii ATCC 17978]
 gi|169797151|ref|YP_001714944.1| 50S ribosomal protein L20 [Acinetobacter baumannii AYE]
 gi|184156921|ref|YP_001845260.1| 50S ribosomal protein L20 [Acinetobacter baumannii ACICU]
 gi|213156059|ref|YP_002318104.1| ribosomal protein L20 [Acinetobacter baumannii AB0057]
 gi|215484614|ref|YP_002326849.1| ribosomal protein L20 [Acinetobacter baumannii AB307-0294]
 gi|226954301|ref|ZP_03824765.1| 50S ribosomal protein L20 [Acinetobacter sp. ATCC 27244]
 gi|239500695|ref|ZP_04660005.1| 50S ribosomal protein L20 [Acinetobacter baumannii AB900]
 gi|260551936|ref|ZP_05825798.1| ribosomal protein L20 [Acinetobacter sp. RUH2624]
 gi|260556054|ref|ZP_05828273.1| ribosomal protein L20 [Acinetobacter baumannii ATCC 19606]
 gi|262281015|ref|ZP_06058798.1| ribosomal protein L20 [Acinetobacter calcoaceticus RUH2202]
 gi|262374314|ref|ZP_06067590.1| ribosomal protein L20 [Acinetobacter junii SH205]
 gi|293610412|ref|ZP_06692713.1| 50S ribosomal protein L20 [Acinetobacter sp. SH024]
 gi|294649372|ref|ZP_06726803.1| 50S ribosomal protein L20 [Acinetobacter haemolyticus ATCC 19194]
 gi|299771529|ref|YP_003733555.1| 50S ribosomal protein L20 [Acinetobacter sp. DR1]
 gi|301345038|ref|ZP_07225779.1| 50S ribosomal protein L20 [Acinetobacter baumannii AB056]
 gi|301510737|ref|ZP_07235974.1| 50S ribosomal protein L20 [Acinetobacter baumannii AB058]
 gi|301596047|ref|ZP_07241055.1| 50S ribosomal protein L20 [Acinetobacter baumannii AB059]
 gi|332856890|ref|ZP_08436299.1| ribosomal protein L20 [Acinetobacter baumannii 6013150]
 gi|332867207|ref|ZP_08437472.1| ribosomal protein L20 [Acinetobacter baumannii 6013113]
 gi|332874002|ref|ZP_08441937.1| ribosomal protein L20 [Acinetobacter baumannii 6014059]
 gi|60390407|sp|Q6F868|RL20_ACIAD RecName: Full=50S ribosomal protein L20
 gi|166219597|sp|A3M2A4|RL20_ACIBT RecName: Full=50S ribosomal protein L20
 gi|226730337|sp|B7GZZ9|RL20_ACIB3 RecName: Full=50S ribosomal protein L20
 gi|226730338|sp|B7I694|RL20_ACIB5 RecName: Full=50S ribosomal protein L20
 gi|226730339|sp|B2HTH6|RL20_ACIBC RecName: Full=50S ribosomal protein L20
 gi|226730341|sp|B0V5Q9|RL20_ACIBY RecName: Full=50S ribosomal protein L20
 gi|49532035|emb|CAG69747.1| 50S ribosomal protein L20, also posttranslational autoregulator
           [Acinetobacter sp. ADP1]
 gi|126386550|gb|ABO11048.1| 50S ribosomal protein L20 [Acinetobacter baumannii ATCC 17978]
 gi|169150078|emb|CAM87972.1| 50S ribosomal protein L20, also posttranslational autoregulator
           [Acinetobacter baumannii AYE]
 gi|183208515|gb|ACC55913.1| putative 50S ribosomal protein L20 [Acinetobacter baumannii ACICU]
 gi|213055219|gb|ACJ40121.1| ribosomal protein L20 [Acinetobacter baumannii AB0057]
 gi|213987996|gb|ACJ58295.1| ribosomal protein L20 [Acinetobacter baumannii AB307-0294]
 gi|226834972|gb|EEH67355.1| 50S ribosomal protein L20 [Acinetobacter sp. ATCC 27244]
 gi|260405339|gb|EEW98834.1| ribosomal protein L20 [Acinetobacter sp. RUH2624]
 gi|260410109|gb|EEX03408.1| ribosomal protein L20 [Acinetobacter baumannii ATCC 19606]
 gi|262257915|gb|EEY76650.1| ribosomal protein L20 [Acinetobacter calcoaceticus RUH2202]
 gi|262310872|gb|EEY91960.1| ribosomal protein L20 [Acinetobacter junii SH205]
 gi|292824742|gb|EFF83514.1| 50S ribosomal protein L20 [Acinetobacter haemolyticus ATCC 19194]
 gi|292827644|gb|EFF86008.1| 50S ribosomal protein L20 [Acinetobacter sp. SH024]
 gi|298701617|gb|ADI92182.1| 50S ribosomal protein L20 [Acinetobacter sp. DR1]
 gi|322506817|gb|ADX02271.1| rplT [Acinetobacter baumannii 1656-2]
 gi|323516686|gb|ADX91067.1| 50S ribosomal protein L20 [Acinetobacter baumannii TCDC-AB0715]
 gi|325124568|gb|ADY84091.1| rplT; 50S ribosomal protein L20 [Acinetobacter calcoaceticus
           PHEA-2]
 gi|332726944|gb|EGJ58449.1| ribosomal protein L20 [Acinetobacter baumannii 6013150]
 gi|332734146|gb|EGJ65278.1| ribosomal protein L20 [Acinetobacter baumannii 6013113]
 gi|332737743|gb|EGJ68635.1| ribosomal protein L20 [Acinetobacter baumannii 6014059]
          Length = 119

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 60/119 (50%), Positives = 81/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVVAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+ I+GL KA +++DR+VL+D+A+    +F  + E ++  L  
Sbjct: 61  WIARINAGARQNGLSYSRMIDGLKKAQVIIDRRVLADIAMHDAVAFAALAEKAKGALAA 119


>gi|118580720|ref|YP_901970.1| 50S ribosomal protein L20 [Pelobacter propionicus DSM 2379]
 gi|166219674|sp|A1ARE2|RL20_PELPD RecName: Full=50S ribosomal protein L20
 gi|118503430|gb|ABK99912.1| LSU ribosomal protein L20P [Pelobacter propionicus DSM 2379]
          Length = 117

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFRSL
Sbjct: 1   MARVKRGFKARRRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+FI GL KA + +DRKVL+D+A++    F +I  ++R+ +
Sbjct: 61  WITRINAASRLNGLSYSKFIFGLKKANVEIDRKVLADIAVSDPKGFSEIAGVARASI 117


>gi|288940718|ref|YP_003442958.1| 50S ribosomal protein L20 [Allochromatium vinosum DSM 180]
 gi|288896090|gb|ADC61926.1| ribosomal protein L20 [Allochromatium vinosum DSM 180]
          Length = 118

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 61/106 (57%), Positives = 79/106 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+L+ AKG+YG R    R AK AV ++ QYAYRDRR KKR+FR+L
Sbjct: 1   MPRVKRGVTAHARHKKILEEAKGYYGARSKVFRVAKQAVIKAGQYAYRDRRQKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R   L+YS+ I+GL KAG+ +DRK+L+D+A     +F
Sbjct: 61  WIARINAAARDNGLSYSRLIDGLKKAGVEVDRKMLADIAYHDSVAF 106


>gi|296110551|ref|YP_003620932.1| ribosomal protein L20 [Leuconostoc kimchii IMSNU 11154]
 gi|295832082|gb|ADG39963.1| ribosomal protein L20 [Leuconostoc kimchii IMSNU 11154]
          Length = 139

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 84/118 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G VS A+ KK++K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVSRARRKKIVKLAKGYRGQRRINFKVAKQQVWKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG+ L+RK+L+++A+T  D+F K+ + +++ L  D
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGVELNRKMLAEIAVTDFDTFSKLADQAKAALASD 119


>gi|227501360|ref|ZP_03931409.1| ribosomal protein L20 [Anaerococcus tetradius ATCC 35098]
 gi|227216459|gb|EEI81869.1| ribosomal protein L20 [Anaerococcus tetradius ATCC 35098]
          Length = 114

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 78/114 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  +HKKVLK AKG+YG +    + A  AV +S  YA+  R+ +KRDFR L
Sbjct: 1   MARVKRAVNAKKRHKKVLKQAKGYYGSKSLLFKTANQAVMKSLAYAFIGRKHRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R+   +YS+ + GL KA I ++RK+L++LAI   + F K+VEL++
Sbjct: 61  WIARINAAARLNGTSYSKLMGGLKKANIEINRKMLAELAINNPEEFAKLVELAK 114


>gi|190575248|ref|YP_001973093.1| 50S ribosomal protein L20 [Stenotrophomonas maltophilia K279a]
 gi|254524211|ref|ZP_05136266.1| ribosomal protein L20 [Stenotrophomonas sp. SKA14]
 gi|226730459|sp|B2FN76|RL20_STRMK RecName: Full=50S ribosomal protein L20
 gi|190013170|emb|CAQ46803.1| putative 50S ribosomal protein L20 [Stenotrophomonas maltophilia
           K279a]
 gi|219721802|gb|EED40327.1| ribosomal protein L20 [Stenotrophomonas sp. SKA14]
          Length = 119

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILDLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L  
Sbjct: 61  WITRINAAARINGLSYSRFMNGLLKAGITLDRKVLADIAVHDAAGFAALAEKAKGALAA 119


>gi|15895626|ref|NP_348975.1| 50S ribosomal protein L20 [Clostridium acetobutylicum ATCC 824]
 gi|20978632|sp|Q97GK7|RL20_CLOAB RecName: Full=50S ribosomal protein L20
 gi|15025370|gb|AAK80315.1|AE007736_5 Ribosomal protein L20 [Clostridium acetobutylicum ATCC 824]
 gi|325509774|gb|ADZ21410.1| 50S ribosomal protein L20 [Clostridium acetobutylicum EA 2018]
          Length = 119

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/119 (47%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +   H+KVLK AKG+YG +    + A  +V R+ + AY  RR++KRDFR L
Sbjct: 1   MARVKRAVNARKNHRKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRRLRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+FING+  AGI ++RK+LS++AI    +F ++VE+++ ++  
Sbjct: 61  WIARINAATRINGLSYSKFINGIKLAGIDMNRKMLSEIAINDPKAFSELVEVAKKQINA 119


>gi|49473759|ref|YP_031801.1| 50S ribosomal protein L20 [Bartonella quintana str. Toulouse]
 gi|81827665|sp|Q6G1G7|RL20_BARQU RecName: Full=50S ribosomal protein L20
 gi|49239262|emb|CAF25583.1| 50s ribosomal protein l20 [Bartonella quintana str. Toulouse]
          Length = 133

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 80/118 (67%), Positives = 96/118 (81%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ AKHKKVLK A+GFYGRRKNTIRAAKAAVDRS+QYAYRDR+ +KR FR+L
Sbjct: 1   MARVKRGVVAHAKHKKVLKQAEGFYGRRKNTIRAAKAAVDRSKQYAYRDRKNRKRIFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR   L Y +FI+GL KAGI +DRKVLSD+A+ +  +F  +V  ++  L 
Sbjct: 61  WIQRINAAVRAEGLTYGRFIDGLSKAGIEIDRKVLSDIAVHESAAFSALVASAKKALE 118


>gi|289449572|ref|YP_003475579.1| 50S ribosomal protein L20 [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184119|gb|ADC90544.1| ribosomal protein L20 [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 118

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKK+LK AKG++G +    + A   V +S  YAYRDR+ KKRDFR L
Sbjct: 1   MARVKRGVAAHARHKKILKMAKGYFGHKSKLFKVANQQVMKSGNYAYRDRKAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ +NG+HKA I LDRK+L++LA++   +F  + E ++  L
Sbjct: 61  WIARINAAARMNGLSYSRLMNGVHKAEIALDRKMLAELAVSDAKAFTAVCEAAKKAL 117


>gi|198284329|ref|YP_002220650.1| 50S ribosomal protein L20 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667881|ref|YP_002426990.1| ribosomal protein L20 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226730342|sp|B7J7S7|RL20_ACIF2 RecName: Full=50S ribosomal protein L20
 gi|226730343|sp|B5EN54|RL20_ACIF5 RecName: Full=50S ribosomal protein L20
 gi|198248850|gb|ACH84443.1| ribosomal protein L20 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218520094|gb|ACK80680.1| ribosomal protein L20 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 119

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 67/119 (56%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKGF G+RK+  R A  AV ++  Y YRDRR KKRDFRSL
Sbjct: 1   MSRVKRGVTAHARHKKVLARAKGFRGQRKSNYRIAHQAVMKALTYEYRDRRTKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   + YS+F+NGL +AGI LDRKVL+D+A+    +F ++VE+ + +L  
Sbjct: 61  WIVRINAAARSEGVTYSRFMNGLLRAGIQLDRKVLADIAVRDKAAFSRLVEVVKGQLAA 119


>gi|312129889|ref|YP_003997229.1| lsu ribosomal protein l20p [Leadbetterella byssophila DSM 17132]
 gi|311906435|gb|ADQ16876.1| LSU ribosomal protein L20P [Leadbetterella byssophila DSM 17132]
          Length = 114

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 66/114 (57%), Positives = 80/114 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK AKG++GRRKN    AK AV++   YAY  R+ KKR+FRSL
Sbjct: 1   MPRSVNHVASRARRKKVLKLAKGYFGRRKNVWTVAKNAVEKGLVYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA VR Y L+YS FIN + KAGI L+RKVL+DLA+   D+FK IVE  +
Sbjct: 61  WIVRINAGVRPYGLSYSVFINKVQKAGIELNRKVLADLALNHPDAFKAIVEKVK 114


>gi|300778189|ref|ZP_07088047.1| 50S ribosomal protein L20 [Chryseobacterium gleum ATCC 35910]
 gi|300503699|gb|EFK34839.1| 50S ribosomal protein L20 [Chryseobacterium gleum ATCC 35910]
          Length = 114

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 79/114 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+ K AKG++GRRKN    AK AV+++ QYAYR R+ KKR+FR+L
Sbjct: 1   MPRSVNAVASRARRKKIFKHAKGYFGRRKNVWTVAKNAVEKAMQYAYRGRKEKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R + ++YSQF+  L K  I L+RKVL+DLA+   ++FK +V+  +
Sbjct: 61  WITRINAGTREHGMSYSQFMGALKKNNIELNRKVLADLAMNHPEAFKAVVDQVK 114


>gi|224417826|ref|ZP_03655832.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
 gi|253827166|ref|ZP_04870051.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
 gi|313141367|ref|ZP_07803560.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
 gi|253510572|gb|EES89231.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
 gi|313130398|gb|EFR48015.1| 50S ribosomal protein L20 [Helicobacter canadensis MIT 98-5491]
          Length = 117

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GFY  R    R AK  ++RS  YA+RDR+ KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFYSARHKHFRKAKEQLERSLCYAFRDRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+F+ GL KAGI LDRK+L+D+A+ +  SF KIVE ++  L
Sbjct: 61  WIVRINAACRINAISYSRFMFGLKKAGITLDRKILADIAMNEPQSFTKIVESAKKAL 117


>gi|169634336|ref|YP_001708072.1| 50S ribosomal protein L20 [Acinetobacter baumannii SDF]
 gi|226730340|sp|B0VV91|RL20_ACIBS RecName: Full=50S ribosomal protein L20
 gi|169153128|emb|CAP02204.1| 50S ribosomal protein L20, also posttranslational autoregulator
           [Acinetobacter baumannii]
          Length = 119

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 59/119 (49%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+  +HKK+L   KG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVVAHRRHKKILARTKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+ I+GL KA +++DR+VL+D+A+    +F  + E ++  L  
Sbjct: 61  WIARINAGARQNGLSYSRMIDGLKKAQVIIDRRVLADIAMHDAVAFAALAEKAKGALAA 119


>gi|76576279|gb|ABA53853.1| L20 [Leptospira biflexa serovar Patoc]
          Length = 138

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 73/115 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R   G +   + KKVL  AKGF G R    R AK+AV ++ Q+AYRDRR KK +FR L
Sbjct: 1   MPRAVNGTIHKNRRKKVLAKAKGFRGGRSKLFRTAKSAVMKAGQWAYRDRRKKKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAAVR   ++YS+FI+ L   GI LDRK L+DLA    + F  IVE  +S
Sbjct: 61  WITRINAAVRENGMSYSKFIHALKTHGINLDRKTLADLAYNHKEVFNAIVEKPKS 115


>gi|227537390|ref|ZP_03967439.1| ribosomal protein L20 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300772851|ref|ZP_07082720.1| 50S ribosomal protein L20 [Sphingobacterium spiritivorum ATCC
           33861]
 gi|227242768|gb|EEI92783.1| ribosomal protein L20 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300759022|gb|EFK55849.1| 50S ribosomal protein L20 [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 114

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 75/114 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+LK AKG+YG R      AK  V++  QYAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNAVASRRRRKKILKLAKGYYGSRSKVYTIAKNTVEKGLQYAYRDRKTKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R + ++YSQ I  L+   I L+RKVL+DLA+   D+FK +V+  +
Sbjct: 61  WIQRINAGSRQHGISYSQLIGKLNAKNIGLNRKVLADLALNNPDAFKAVVDAVK 114


>gi|293401375|ref|ZP_06645518.1| ribosomal protein L20 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305013|gb|EFE46259.1| ribosomal protein L20 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 122

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 72/112 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  + KKVLK AKG+YG +    + A   V  S +YAY DR+  KR+ R L
Sbjct: 1   MARVKGGYTTRQRRKKVLKLAKGYYGAKHLLYKTAHEQVMHSFKYAYNDRKDLKREMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVEL 112
           WI RINAA R+ D++YS+ ++GL  A + ++RK+LS++AI     F KIVE 
Sbjct: 61  WIARINAAARMNDISYSRLMHGLKLANVTINRKMLSEIAIHDEKGFTKIVET 112


>gi|296140118|ref|YP_003647361.1| ribosomal protein L20 [Tsukamurella paurometabola DSM 20162]
 gi|296028252|gb|ADG79022.1| ribosomal protein L20 [Tsukamurella paurometabola DSM 20162]
          Length = 126

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+++KG+ G+R    R AK     S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSILEASKGYRGQRSRLYRKAKEQQLHSMTYAYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++F+ GL  AG+ +DRK L++LA++   +F  +V++++  L  D
Sbjct: 61  WITRINAAARANDITYNRFMQGLKLAGVEVDRKNLAELAVSDSAAFTALVDIAKKALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|160946415|ref|ZP_02093624.1| hypothetical protein PEPMIC_00375 [Parvimonas micra ATCC 33270]
 gi|158447531|gb|EDP24526.1| hypothetical protein PEPMIC_00375 [Parvimonas micra ATCC 33270]
          Length = 114

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 79/114 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KR + +  KH+KVLK AKG+YG +    + A  A+ +S  YA+  R+ KKRDFRSL
Sbjct: 1   MARIKRSLNARKKHRKVLKQAKGYYGAKSKLFKVANQAIMKSMTYAFIGRKRKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R Y L+YS+F+ GL K  I ++RK+LS++AI   + FKK+VEL R
Sbjct: 61  WIARINAGTRQYGLSYSKFMYGLKKNNINMNRKMLSEMAINDPEGFKKLVELVR 114


>gi|67458741|ref|YP_246365.1| 50S ribosomal protein L20 [Rickettsia felis URRWXCal2]
 gi|75536802|sp|Q4UMK8|RL20_RICFE RecName: Full=50S ribosomal protein L20
 gi|67004274|gb|AAY61200.1| 50S ribosomal protein L20 [Rickettsia felis URRWXCal2]
          Length = 117

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L KA I +DRKVL++LA+   D F  I+E +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKAEIDIDRKVLAELAVNNSDGFASIIEQAKAHI 117


>gi|325103183|ref|YP_004272837.1| LSU ribosomal protein L20P [Pedobacter saltans DSM 12145]
 gi|324972031|gb|ADY51015.1| LSU ribosomal protein L20P [Pedobacter saltans DSM 12145]
          Length = 114

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 74/114 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+L  AKG++G R      AK  V++  QYAYRDR+VKKR+FR+L
Sbjct: 1   MPRSVNAVASRRRRKKILNLAKGYWGSRSKVYTIAKNTVEKGLQYAYRDRKVKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R Y ++YSQ +  L    I L+RKVL+DLA+   ++FK IV+  +
Sbjct: 61  WIQRINAGARQYGVSYSQLMGKLAAKNIGLNRKVLADLAMNHPEAFKAIVDTVK 114


>gi|255531807|ref|YP_003092179.1| 50S ribosomal protein L20 [Pedobacter heparinus DSM 2366]
 gi|255344791|gb|ACU04117.1| ribosomal protein L20 [Pedobacter heparinus DSM 2366]
          Length = 114

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 73/114 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KKVL  AKG++G R      AK  V++  QYAYRDR+VKKR+FR L
Sbjct: 1   MPRSVNAVASRRRRKKVLNLAKGYWGSRSKVFTIAKNTVEKGLQYAYRDRKVKKREFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R + ++YSQ I  L    I L+RKVL+DLA+   ++FK +++  +
Sbjct: 61  WIQRINAGARQHGISYSQLIGKLAAKNIGLNRKVLADLAMNHPEAFKAVIDTVK 114


>gi|255263270|ref|ZP_05342612.1| ribosomal protein L20 [Thalassiobium sp. R2A62]
 gi|255105605|gb|EET48279.1| ribosomal protein L20 [Thalassiobium sp. R2A62]
          Length = 119

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 68/117 (58%), Positives = 88/117 (75%), Gaps = 2/117 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKK+   AKG+YGRRKNT + A  AVD++ QYA RDR+ +KR+FR+LWI
Sbjct: 2   RVKSGPVTHRRHKKITDQAKGYYGRRKNTFKVATQAVDKANQYATRDRKNRKRNFRALWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           QRINAAVR  D  L YS+FINGL  AGI +DRKVL+DLA+ + D+F  IV  +++ L
Sbjct: 62  QRINAAVRSVDETLTYSKFINGLALAGIEVDRKVLADLAVNEPDAFGAIVSQAKAAL 118


>gi|38233752|ref|NP_939519.1| 50S ribosomal protein L20 [Corynebacterium diphtheriae NCTC 13129]
 gi|60390473|sp|Q6NHH5|RL20_CORDI RecName: Full=50S ribosomal protein L20
 gi|38200013|emb|CAE49682.1| 50S ribosomal protein L20 [Corynebacterium diphtheriae]
          Length = 127

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K +++LKSAKG+ G+R    R AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRSLNAKKKRREILKSAKGYRGQRSRLYRKAKEQWLHSMTYAYRDRRARKSEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++ I GL  A I +DRKVL+DLA+    +F  I E +++ L  D
Sbjct: 61  WITRINAAARMNDITYNRLIQGLRLAEIEVDRKVLADLAVNDFAAFSAICEAAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|332367207|gb|EGJ44943.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK1059]
          Length = 119

 Score =  147 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 74/107 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+   ++F 
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDAEAFT 107


>gi|222056444|ref|YP_002538806.1| ribosomal protein L20 [Geobacter sp. FRC-32]
 gi|254800324|sp|B9M521|RL20_GEOSF RecName: Full=50S ribosomal protein L20
 gi|221565733|gb|ACM21705.1| ribosomal protein L20 [Geobacter sp. FRC-32]
          Length = 117

 Score =  147 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 83/116 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  ++YS+ I+GL +A + +DRKV++DLA++    F +IV L+++ 
Sbjct: 61  WITRINAAARINGISYSKLIHGLKQAKVEVDRKVMADLAVSDPRGFAEIVSLAKAN 116


>gi|121997233|ref|YP_001002020.1| ribosomal protein L20 [Halorhodospira halophila SL1]
 gi|166219651|sp|A1WU56|RL20_HALHL RecName: Full=50S ribosomal protein L20
 gi|121588638|gb|ABM61218.1| LSU ribosomal protein L20P [Halorhodospira halophila SL1]
          Length = 119

 Score =  147 bits (373), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 88/118 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + AKHKKVLK+AKG+YG R +  R A+  V +S QYAY  RR++KR+FRSL
Sbjct: 1   MSRVKRGVTNRAKHKKVLKAAKGYYGMRGSAFRIARQQVIKSGQYAYAHRRLRKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R + L+YS+ +NGL +AGI +DRK L+DLA+ +  SF  + E ++  L 
Sbjct: 61  WIQRINAAARQHGLSYSRLMNGLQQAGIEVDRKQLADLAVHEPQSFAALAERAQGALS 118


>gi|313836586|gb|EFS74300.1| ribosomal protein L20 [Propionibacterium acnes HL037PA2]
 gi|314928096|gb|EFS91927.1| ribosomal protein L20 [Propionibacterium acnes HL044PA1]
 gi|314972096|gb|EFT16193.1| ribosomal protein L20 [Propionibacterium acnes HL037PA3]
          Length = 123

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 84/123 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL+ A G+ G+R    R AK     S  Y++RDRR KK DFRSL
Sbjct: 1   MARVKRSVNAKKKRREVLEQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FINGL  AG+ +DRKVL++LA++ +D+F  +VE++++    +
Sbjct: 61  WIQRINAASRAQGMTYNRFINGLKNAGVEVDRKVLAELAVSDIDAFNSLVEVAKANQPQN 120

Query: 121 VAS 123
            A+
Sbjct: 121 AAA 123


>gi|317052585|ref|YP_004113701.1| 50S ribosomal protein L20 [Desulfurispirillum indicum S5]
 gi|316947669|gb|ADU67145.1| ribosomal protein L20 [Desulfurispirillum indicum S5]
          Length = 117

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 81/116 (69%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVLK  KG+ G R N  R A   + R+  +A+RDR+V+KR+FR LWI
Sbjct: 2   RVKGGFVTRRRHKKVLKQTKGYRGGRSNLFRMANTTLVRALNFAFRDRKVRKREFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
            RINAAVR + L+YS+F++GL +A + LDRKVL+D+A+    SF+ +V  ++  L 
Sbjct: 62  IRINAAVRPHGLSYSRFMHGLKQAQVHLDRKVLADMAVNSPSSFEAVVGKAKGALS 117


>gi|134101782|ref|YP_001107443.1| 50S ribosomal protein L20 [Saccharopolyspora erythraea NRRL 2338]
 gi|291009829|ref|ZP_06567802.1| 50S ribosomal protein L20 [Saccharopolyspora erythraea NRRL 2338]
 gi|166220742|sp|A4FKE3|RL20_SACEN RecName: Full=50S ribosomal protein L20
 gi|133914405|emb|CAM04518.1| 50S ribosomal subunit protein L20 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 122

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 79/122 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+SAKG+ G+R    R AK  +  S  Y+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTILESAKGYRGQRSRLYRKAKEQMLHSMTYSYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R   ++Y++F+ GL  AG+ +DRK+L++LA+    +F  +V+++R  L   
Sbjct: 61  WITRINAATRQNGMSYNRFVQGLKAAGVEVDRKILAELAVNDSQAFAALVDVARQNLPEG 120

Query: 121 VA 122
            A
Sbjct: 121 AA 122


>gi|124516420|gb|EAY57928.1| ribosomal protein L20 [Leptospirillum rubarum]
          Length = 118

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 87/118 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G +  ++ KK++  AKGF+G R    R+A+  V++   YAYRDR+VKKR+FRSL
Sbjct: 1   MSRVKGGTIHKSRRKKIMDLAKGFWGGRSRLYRSARHTVEKGLTYAYRDRKVKKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R+  +NYS+F+ GL K GI LDRK+L+DLA+ Q ++F+++ + ++  + 
Sbjct: 61  WIQRINAACRMESINYSRFMAGLKKLGISLDRKILADLALNQPETFRELTQKAKQAIS 118


>gi|188577596|ref|YP_001914525.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|226730475|sp|B2SUM0|RL20_XANOP RecName: Full=50S ribosomal protein L20
 gi|188522048|gb|ACD59993.1| ribosomal protein L20 [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 119

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILTLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L  
Sbjct: 61  WITRINAAARINGLSYSRFMNGLLKAGITLDRKVLADIAVHDAAGFTALAEKAKGALAA 119


>gi|291519540|emb|CBK74761.1| LSU ribosomal protein L20P [Butyrivibrio fibrisolvens 16/4]
          Length = 119

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 51/119 (42%), Positives = 78/119 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  +H + LK AKG+ G R    R AK +V R+   +Y  R+ KKR FR L
Sbjct: 1   MARVKGGLNAKKRHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+ GL  AG+ ++RK+L++LA+   + F K+VE+++ ++  
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLAGVEMNRKMLAELAVNDAEGFAKLVEVAKEKVAA 119


>gi|77164652|ref|YP_343177.1| 50S ribosomal protein L20 [Nitrosococcus oceani ATCC 19707]
 gi|254434859|ref|ZP_05048367.1| ribosomal protein L20 [Nitrosococcus oceani AFC27]
 gi|109893128|sp|Q3JBZ9|RL20_NITOC RecName: Full=50S ribosomal protein L20
 gi|76882966|gb|ABA57647.1| LSU ribosomal protein L20P [Nitrosococcus oceani ATCC 19707]
 gi|207091192|gb|EDZ68463.1| ribosomal protein L20 [Nitrosococcus oceani AFC27]
          Length = 119

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  AKG+ GRRKN  R A  A+ R+ QYAYRDRR +KR FR+L
Sbjct: 1   MPRVKRGVTAHARHKKVIAQAKGYRGRRKNVYRVANQAITRASQYAYRDRRQRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+ I+GL +A I +DRKVL+DLA+    +F  I E ++  L 
Sbjct: 61  WIVRINAAARECGLSYSRLISGLKRAAIEIDRKVLADLAVRDKAAFTTIAEQAKVALS 118


>gi|255320844|ref|ZP_05362018.1| ribosomal protein L20 [Acinetobacter radioresistens SK82]
 gi|262380263|ref|ZP_06073418.1| ribosomal protein L20 [Acinetobacter radioresistens SH164]
 gi|255302013|gb|EET81256.1| ribosomal protein L20 [Acinetobacter radioresistens SK82]
 gi|262298457|gb|EEY86371.1| ribosomal protein L20 [Acinetobacter radioresistens SH164]
          Length = 119

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 60/119 (50%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+YG R    R A  AV ++ QYAYRDRR KKR FRSL
Sbjct: 1   MARVKRGVQAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+ I+GL KA +++DR+VL+D+A+    +F  + E ++  L  
Sbjct: 61  WIARINAGARQNGLSYSRMISGLKKAQVIIDRRVLADIAMHDAVAFAALAEKAKGALAA 119


>gi|167771638|ref|ZP_02443691.1| hypothetical protein ANACOL_03010 [Anaerotruncus colihominis DSM
           17241]
 gi|167666278|gb|EDS10408.1| hypothetical protein ANACOL_03010 [Anaerotruncus colihominis DSM
           17241]
          Length = 117

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 79/117 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  + KK L+ AKG++G +    + AK  V +S  YA+  R+ KKR+FRSL
Sbjct: 1   MARVKGAMMTRKRRKKTLRLAKGYFGAKSKLFKMAKQQVMKSGNYAFIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA R   +NYS F+NGL KAG+ L+RK+LS++AI    +F  +VE +++ L
Sbjct: 61  WITRISAACRTNGINYSSFMNGLKKAGVELNRKMLSEIAIHDAAAFTALVEKAKAAL 117


>gi|226355446|ref|YP_002785186.1| 50S ribosomal protein L20 [Deinococcus deserti VCD115]
 gi|259646179|sp|C1D0Q8|RL20_DEIDV RecName: Full=50S ribosomal protein L20
 gi|226317436|gb|ACO45432.1| putative 50S ribosomal protein L20 [Deinococcus deserti VCD115]
          Length = 117

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 59/115 (51%), Positives = 79/115 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V   +HKKVLK AKGF G R    R A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MPRVKTGTVRRRRHKKVLKRAKGFEGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           W+QRINA  R++ +NYS FI GL +AG+ L+RKVL+D+A  + ++FK +V+ +++
Sbjct: 61  WVQRINAGARLHGMNYSTFIGGLKRAGVDLNRKVLADIAAREPEAFKALVDAAKN 115


>gi|150016447|ref|YP_001308701.1| 50S ribosomal protein L20 [Clostridium beijerinckii NCIMB 8052]
 gi|189041855|sp|A6LTR5|RL20_CLOB8 RecName: Full=50S ribosomal protein L20
 gi|149902912|gb|ABR33745.1| ribosomal protein L20 [Clostridium beijerinckii NCIMB 8052]
          Length = 119

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 56/119 (47%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR   S   HKKVLK AKG+YG +    + A  +V R+ + +Y  R+ KKRD+RSL
Sbjct: 1   MARVKRAKNSRKNHKKVLKLAKGYYGGKSKLYKTANESVIRALRNSYVGRKNKKRDYRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+ +L+YS+F+NG+  AGI ++RK+LS++AI    +F ++VE+++ +L  
Sbjct: 61  WIARINAATRINNLSYSKFMNGIKLAGIDINRKMLSEIAINDPKAFTELVEVAKKQLNA 119


>gi|326693740|ref|ZP_08230745.1| 50S ribosomal protein L20 [Leuconostoc argentinum KCTC 3773]
          Length = 139

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 84/118 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ KK++K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVTRARRKKMVKLAKGYRGQRRINFKVAKQQVWKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG+ L+RK+L+D+A+T  D+F K+ E +++ L  D
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGVELNRKMLADIAVTDFDTFAKLAEQAKAALASD 119


>gi|312793385|ref|YP_004026308.1| 50S ribosomal protein L20 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180525|gb|ADQ40695.1| ribosomal protein L20 [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 119

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 83/118 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LWI
Sbjct: 2   RIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRRLKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R   L+YS+FINGL KAGI L+RKVL+D+A+    +F ++VE+++ ++   
Sbjct: 62  TRINAAARQNGLSYSKFINGLKKAGISLNRKVLADMAVNDQKAFAELVEIAKKQINAQ 119


>gi|285017867|ref|YP_003375578.1| 50s ribosomal protein l20 [Xanthomonas albilineans GPE PC73]
 gi|283473085|emb|CBA15590.1| probable 50s ribosomal protein l20 [Xanthomonas albilineans]
          Length = 119

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKKVL  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKVLNLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  ++YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L  
Sbjct: 61  WITRINAAARINGMSYSRFMNGLLKAGITLDRKVLADIAVHDAQGFAALAEKAKGALAA 119


>gi|323341713|ref|ZP_08081946.1| 50S ribosomal protein L20 [Erysipelothrix rhusiopathiae ATCC 19414]
 gi|322464138|gb|EFY09331.1| 50S ribosomal protein L20 [Erysipelothrix rhusiopathiae ATCC 19414]
          Length = 119

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 74/118 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ K+ LK AKG+YG +    R A   V RSQ+YAYRDR+  KR+ R L
Sbjct: 1   MPRSTNSVASRARRKRTLKLAKGYYGSKHVLYRTANEQVMRSQRYAYRDRKQLKREMRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ D++YSQ ++GL  A I ++RK+LS++AI     F  +V  ++  L 
Sbjct: 61  WITRINAAARLNDMSYSQLMHGLRLANIEINRKMLSEIAIHDPKGFTTLVGKAQKALE 118


>gi|238650657|ref|YP_002916509.1| 50S ribosomal protein L20 [Rickettsia peacockii str. Rustic]
 gi|259646198|sp|C4K1L0|RL20_RICPU RecName: Full=50S ribosomal protein L20
 gi|238624755|gb|ACR47461.1| 50S ribosomal protein L20 [Rickettsia peacockii str. Rustic]
          Length = 117

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKFAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L K  I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKTEIDIDRKVLAELAVNNSDGFVSIVEKAKAHI 117


>gi|291533295|emb|CBL06408.1| LSU ribosomal protein L20P [Megamonas hypermegale ART12/1]
          Length = 117

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV + A+HKK+LK AKG+ G R    + A   V ++  YA RDRR KK +FR L
Sbjct: 1   MPRVKSGVTAHARHKKILKLAKGYRGARSKQFKKANELVMKALYYARRDRRAKKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   ++YS+FI GL KAG+ ++RK+L+D+AI    +F K+VE+++S L
Sbjct: 61  WIARINAATRANGMSYSRFICGLTKAGVQVNRKMLADVAINDAAAFAKLVEVAKSNL 117


>gi|289426534|ref|ZP_06428277.1| ribosomal protein L20 [Propionibacterium acnes SK187]
 gi|295130949|ref|YP_003581612.1| ribosomal protein L20 [Propionibacterium acnes SK137]
 gi|289153262|gb|EFD01980.1| ribosomal protein L20 [Propionibacterium acnes SK187]
 gi|291376999|gb|ADE00854.1| ribosomal protein L20 [Propionibacterium acnes SK137]
 gi|313763450|gb|EFS34814.1| ribosomal protein L20 [Propionibacterium acnes HL013PA1]
 gi|313793836|gb|EFS41865.1| ribosomal protein L20 [Propionibacterium acnes HL110PA1]
 gi|313801226|gb|EFS42484.1| ribosomal protein L20 [Propionibacterium acnes HL110PA2]
 gi|313808090|gb|EFS46567.1| ribosomal protein L20 [Propionibacterium acnes HL087PA2]
 gi|313811440|gb|EFS49154.1| ribosomal protein L20 [Propionibacterium acnes HL083PA1]
 gi|313813591|gb|EFS51305.1| ribosomal protein L20 [Propionibacterium acnes HL025PA1]
 gi|313816632|gb|EFS54346.1| ribosomal protein L20 [Propionibacterium acnes HL059PA1]
 gi|313819729|gb|EFS57443.1| ribosomal protein L20 [Propionibacterium acnes HL046PA2]
 gi|313822262|gb|EFS59976.1| ribosomal protein L20 [Propionibacterium acnes HL036PA1]
 gi|313823744|gb|EFS61458.1| ribosomal protein L20 [Propionibacterium acnes HL036PA2]
 gi|313826066|gb|EFS63780.1| ribosomal protein L20 [Propionibacterium acnes HL063PA1]
 gi|313829639|gb|EFS67353.1| ribosomal protein L20 [Propionibacterium acnes HL063PA2]
 gi|313831179|gb|EFS68893.1| ribosomal protein L20 [Propionibacterium acnes HL007PA1]
 gi|313834840|gb|EFS72554.1| ribosomal protein L20 [Propionibacterium acnes HL056PA1]
 gi|313840043|gb|EFS77757.1| ribosomal protein L20 [Propionibacterium acnes HL086PA1]
 gi|314914609|gb|EFS78440.1| ribosomal protein L20 [Propionibacterium acnes HL005PA4]
 gi|314919434|gb|EFS83265.1| ribosomal protein L20 [Propionibacterium acnes HL050PA1]
 gi|314920658|gb|EFS84489.1| ribosomal protein L20 [Propionibacterium acnes HL050PA3]
 gi|314924558|gb|EFS88389.1| ribosomal protein L20 [Propionibacterium acnes HL036PA3]
 gi|314930428|gb|EFS94259.1| ribosomal protein L20 [Propionibacterium acnes HL067PA1]
 gi|314954517|gb|EFS98923.1| ribosomal protein L20 [Propionibacterium acnes HL027PA1]
 gi|314957362|gb|EFT01465.1| ribosomal protein L20 [Propionibacterium acnes HL002PA1]
 gi|314962174|gb|EFT06275.1| ribosomal protein L20 [Propionibacterium acnes HL002PA2]
 gi|314963803|gb|EFT07903.1| ribosomal protein L20 [Propionibacterium acnes HL082PA1]
 gi|314968368|gb|EFT12467.1| ribosomal protein L20 [Propionibacterium acnes HL037PA1]
 gi|314974058|gb|EFT18154.1| ribosomal protein L20 [Propionibacterium acnes HL053PA1]
 gi|314976762|gb|EFT20857.1| ribosomal protein L20 [Propionibacterium acnes HL045PA1]
 gi|314978783|gb|EFT22877.1| ribosomal protein L20 [Propionibacterium acnes HL072PA2]
 gi|314984484|gb|EFT28576.1| ribosomal protein L20 [Propionibacterium acnes HL005PA1]
 gi|314986661|gb|EFT30753.1| ribosomal protein L20 [Propionibacterium acnes HL005PA2]
 gi|314990776|gb|EFT34867.1| ribosomal protein L20 [Propionibacterium acnes HL005PA3]
 gi|315079655|gb|EFT51645.1| ribosomal protein L20 [Propionibacterium acnes HL053PA2]
 gi|315081116|gb|EFT53092.1| ribosomal protein L20 [Propionibacterium acnes HL078PA1]
 gi|315083437|gb|EFT55413.1| ribosomal protein L20 [Propionibacterium acnes HL027PA2]
 gi|315087004|gb|EFT58980.1| ribosomal protein L20 [Propionibacterium acnes HL002PA3]
 gi|315089179|gb|EFT61155.1| ribosomal protein L20 [Propionibacterium acnes HL072PA1]
 gi|315095233|gb|EFT67209.1| ribosomal protein L20 [Propionibacterium acnes HL038PA1]
 gi|315099078|gb|EFT71054.1| ribosomal protein L20 [Propionibacterium acnes HL059PA2]
 gi|315100541|gb|EFT72517.1| ribosomal protein L20 [Propionibacterium acnes HL046PA1]
 gi|315108911|gb|EFT80887.1| ribosomal protein L20 [Propionibacterium acnes HL030PA2]
 gi|327329568|gb|EGE71327.1| ribosomal protein L20 [Propionibacterium acnes HL096PA3]
 gi|327329587|gb|EGE71345.1| ribosomal protein L20 [Propionibacterium acnes HL096PA2]
 gi|327444367|gb|EGE91021.1| ribosomal protein L20 [Propionibacterium acnes HL043PA2]
 gi|327444568|gb|EGE91222.1| ribosomal protein L20 [Propionibacterium acnes HL043PA1]
 gi|327446240|gb|EGE92894.1| ribosomal protein L20 [Propionibacterium acnes HL013PA2]
 gi|327452175|gb|EGE98829.1| ribosomal protein L20 [Propionibacterium acnes HL092PA1]
 gi|327452808|gb|EGE99462.1| ribosomal protein L20 [Propionibacterium acnes HL087PA3]
 gi|327457885|gb|EGF04540.1| ribosomal protein L20 [Propionibacterium acnes HL083PA2]
 gi|328752002|gb|EGF65618.1| ribosomal protein L20 [Propionibacterium acnes HL020PA1]
 gi|328755366|gb|EGF68982.1| ribosomal protein L20 [Propionibacterium acnes HL087PA1]
 gi|328757791|gb|EGF71407.1| ribosomal protein L20 [Propionibacterium acnes HL025PA2]
 gi|328760150|gb|EGF73727.1| ribosomal protein L20 [Propionibacterium acnes HL099PA1]
 gi|332675829|gb|AEE72645.1| 50S ribosomal protein L20 [Propionibacterium acnes 266]
          Length = 123

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 83/123 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL  A G+ G+R    R AK     S  Y++RDRR KK DFRSL
Sbjct: 1   MARVKRSVNAKKKRREVLDQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FINGL  AG+ +DRK+L++LA++ +++F  +VE++++    +
Sbjct: 61  WIQRINAASRAQGMTYNRFINGLKNAGVEVDRKMLAELAVSDINAFNSLVEVAKASQPQN 120

Query: 121 VAS 123
            A+
Sbjct: 121 AAA 123


>gi|302871992|ref|YP_003840628.1| ribosomal protein L20 [Caldicellulosiruptor obsidiansis OB47]
 gi|302574851|gb|ADL42642.1| ribosomal protein L20 [Caldicellulosiruptor obsidiansis OB47]
          Length = 119

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 83/118 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  R++KKRDFR LWI
Sbjct: 2   RIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRKLKKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R   L+YS+F+NGL KAGI L+RKVL+D+A+    +F ++VE+++ ++   
Sbjct: 62  TRINAAARQNGLSYSKFMNGLKKAGINLNRKVLADMAVNDQKAFAELVEIAKKQINAQ 119


>gi|21243322|ref|NP_642904.1| 50S ribosomal protein L20 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|58582807|ref|YP_201823.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|78048348|ref|YP_364523.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|84624681|ref|YP_452053.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166711591|ref|ZP_02242798.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|294626195|ref|ZP_06704801.1| 50S ribosomal protein L20 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294667579|ref|ZP_06732794.1| 50S ribosomal protein L20 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325917700|ref|ZP_08179891.1| LSU ribosomal protein L20P [Xanthomonas vesicatoria ATCC 35937]
 gi|325927166|ref|ZP_08188429.1| LSU ribosomal protein L20P [Xanthomonas perforans 91-118]
 gi|23822043|sp|Q8PJE3|RL20_XANAC RecName: Full=50S ribosomal protein L20
 gi|81311791|sp|Q5GXY3|RL20_XANOR RecName: Full=50S ribosomal protein L20
 gi|109893169|sp|Q3BRU0|RL20_XANC5 RecName: Full=50S ribosomal protein L20
 gi|109893170|sp|Q2P0Z8|RL20_XANOM RecName: Full=50S ribosomal protein L20
 gi|21108864|gb|AAM37440.1| 50S ribosomal protein L20 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|58427401|gb|AAW76438.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|78036778|emb|CAJ24471.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|84368621|dbj|BAE69779.1| 50S ribosomal protein L20 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|292599547|gb|EFF43678.1| 50S ribosomal protein L20 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292602699|gb|EFF46135.1| 50S ribosomal protein L20 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325536094|gb|EGD07899.1| LSU ribosomal protein L20P [Xanthomonas vesicatoria ATCC 35937]
 gi|325542479|gb|EGD13958.1| LSU ribosomal protein L20P [Xanthomonas perforans 91-118]
          Length = 119

 Score =  147 bits (372), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILTLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NGL KAGI LDRKVL+D+A+     F  + E ++  L  
Sbjct: 61  WITRINAAARINGLSYSRFMNGLLKAGITLDRKVLADIAVHDAAGFAALAEKAKGALAA 119


>gi|15892858|ref|NP_360572.1| 50S ribosomal protein L20 [Rickettsia conorii str. Malish 7]
 gi|34581432|ref|ZP_00142912.1| 50S ribosomal protein L20 [Rickettsia sibirica 246]
 gi|229586952|ref|YP_002845453.1| 50S ribosomal protein L20 [Rickettsia africae ESF-5]
 gi|20139545|sp|Q92H37|RL20_RICCN RecName: Full=50S ribosomal protein L20
 gi|259646197|sp|C3PP50|RL20_RICAE RecName: Full=50S ribosomal protein L20
 gi|15620045|gb|AAL03473.1| 50S ribosomal protein L20 [Rickettsia conorii str. Malish 7]
 gi|28262817|gb|EAA26321.1| 50S ribosomal protein L20 [Rickettsia sibirica 246]
 gi|228022002|gb|ACP53710.1| 50S ribosomal protein L20 [Rickettsia africae ESF-5]
          Length = 117

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L K  I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKTEIDIDRKVLAELAVNNSDGFVSIVEKAKAHI 117


>gi|325954890|ref|YP_004238550.1| 50S ribosomal protein L20 [Weeksella virosa DSM 16922]
 gi|323437508|gb|ADX67972.1| 50S ribosomal protein L20 [Weeksella virosa DSM 16922]
          Length = 114

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 66/114 (57%), Positives = 83/114 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK AKG+YGRRKN    AK AV++  QYAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNSVASRARRKKVLKLAKGYYGRRKNVWTVAKNAVEKGLQYAYRDRRQKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R++ ++YSQF+    KAGI L+RKVL+DLA+   ++FK IVE  +
Sbjct: 61  WIQRINAGARLHGMSYSQFMGATKKAGIELNRKVLADLAMNNPEAFKAIVEKVK 114


>gi|160945995|ref|ZP_02093221.1| hypothetical protein FAEPRAM212_03528 [Faecalibacterium prausnitzii
           M21/2]
 gi|313115004|ref|ZP_07800497.1| ribosomal protein L20 [Faecalibacterium cf. prausnitzii KLE1255]
 gi|158443726|gb|EDP20731.1| hypothetical protein FAEPRAM212_03528 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103247|emb|CBL00791.1| LSU ribosomal protein L20P [Faecalibacterium prausnitzii SL3/3]
 gi|310622695|gb|EFQ06157.1| ribosomal protein L20 [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 116

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 75/116 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K   ++  + KK+LK AKGFYG +    + AK  V +S  YA   RR+KKR FR+L
Sbjct: 1   MARIKGATMTHKRRKKMLKLAKGFYGCKSKHFKMAKQQVMKSGNYALAGRRMKKRQFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RIN AVR   +NYS F+ GL KAGI L+RK+LS++AI    SF  +VE  ++ 
Sbjct: 61  WICRINNAVRPLGMNYSTFMAGLKKAGIELNRKMLSEMAINDPKSFAALVETVKNA 116


>gi|242309946|ref|ZP_04809101.1| 50S ribosomal protein L20 [Helicobacter pullorum MIT 98-5489]
 gi|239523243|gb|EEQ63109.1| 50S ribosomal protein L20 [Helicobacter pullorum MIT 98-5489]
          Length = 117

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKK+LK A+GFY  R    R AK  ++RS  YA+RDR+ KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKILKLARGFYSARHKHFRKAKEQLERSLCYAFRDRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+F+ GL KAGI LDRK+L+D+A+ +  SF KIVE ++  L
Sbjct: 61  WIVRINAACRINAISYSRFMFGLKKAGIALDRKILADIAMNEPQSFAKIVESAKKAL 117


>gi|157826002|ref|YP_001493722.1| 50S ribosomal protein L20 [Rickettsia akari str. Hartford]
 gi|166220736|sp|A8GP89|RL20_RICAH RecName: Full=50S ribosomal protein L20
 gi|157799960|gb|ABV75214.1| 50S ribosomal protein L20 [Rickettsia akari str. Hartford]
          Length = 117

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR +   YSQFI  L KA I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGFVYSQFIGALKKAEIDIDRKVLAELAVNNSDGFASIVEKTKAHI 117


>gi|149276296|ref|ZP_01882440.1| 50S ribosomal protein L20 [Pedobacter sp. BAL39]
 gi|149232816|gb|EDM38191.1| 50S ribosomal protein L20 [Pedobacter sp. BAL39]
          Length = 114

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 73/114 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KKVL  AKG++G R      AK  V++  QYAYRDR+VKKR+FR L
Sbjct: 1   MPRSVNAVASRRRRKKVLNLAKGYWGSRSKVFTIAKNTVEKGLQYAYRDRKVKKREFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R + ++YSQ I  L    I L+RKVL+DLA+   ++FK +++  +
Sbjct: 61  WIQRINAGARQHGISYSQLIGKLASKNIGLNRKVLADLAMNHPEAFKAVIDAVK 114


>gi|322383964|ref|ZP_08057694.1| 50S ribosomal protein L20-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321151441|gb|EFX44628.1| 50S ribosomal protein L20-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 119

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G ++  +HKKVLK AKG++G +    + A A V +S  YAYRDRR +KRDFR L
Sbjct: 1   MARVKGGFITRRRHKKVLKLAKGYFGSKHRIFKTANAQVMKSLLYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  ++YS+ ++GL  AGI ++RK+L+DLA+    +F  +   ++ ++  
Sbjct: 61  WITRINAAARMNGISYSKMMHGLKLAGIEVNRKMLADLAVNDAKAFADLANAAKQKVNA 119


>gi|126733939|ref|ZP_01749686.1| ribosomal protein L20 [Roseobacter sp. CCS2]
 gi|126716805|gb|EBA13669.1| ribosomal protein L20 [Roseobacter sp. CCS2]
          Length = 120

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 65/119 (54%), Positives = 84/119 (70%), Gaps = 2/119 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVL  AKG+Y RR  T + A  AVD++ QYA RDR  +KR+FR+LWI
Sbjct: 2   RVKGGTVTHRRHKKVLDQAKGYYDRRSKTFKVAAQAVDKANQYATRDRHNRKRNFRALWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           QRINA VR  D  LNYS+FINGL  AGI +DRKVL+DLA+ + ++F  +V  ++  L  
Sbjct: 62  QRINAGVRSVDETLNYSKFINGLTLAGIEVDRKVLADLAVNEPEAFAAVVGKAKDALAA 120


>gi|326800363|ref|YP_004318182.1| 50S ribosomal protein L20 [Sphingobacterium sp. 21]
 gi|326551127|gb|ADZ79512.1| 50S ribosomal protein L20 [Sphingobacterium sp. 21]
          Length = 114

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 74/114 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+LK AKG+YG R      AK  V++  QYAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNAVASRRRRKKILKLAKGYYGSRSKVYTIAKNTVEKGLQYAYRDRKTKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R + ++YSQ I  L    I L+RKVL+DLA+   ++FK +V+  +
Sbjct: 61  WIQRINAGARQHGISYSQLIGKLSAKNIGLNRKVLADLALNNPNAFKAVVDAVK 114


>gi|315320526|ref|YP_004072582.1| 50S ribosomal protein L20 [Thalassiosira oceanica CCMP1005]
 gi|283568999|gb|ADB27536.1| 50S ribosomal protein L20 [Thalassiosira oceanica CCMP1005]
          Length = 119

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 49/114 (42%), Positives = 70/114 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+  + KK+L+ AKG+ G      R A   V ++ +YAY  R+ KKR FR L
Sbjct: 1   MVRVKRGNVARKRRKKILQLAKGYKGAHSRLFRVANQQVMKALRYAYVGRKQKKRVFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA+ R     YSQ IN L +  I L+RK+L+ +A+    SF +I++ ++
Sbjct: 61  WISRINASARQSGTTYSQLINCLKENKINLNRKMLAQMAVLDYSSFYEIIKQTK 114


>gi|50842893|ref|YP_056120.1| 50S ribosomal protein L20 [Propionibacterium acnes KPA171202]
 gi|282854557|ref|ZP_06263892.1| ribosomal protein L20 [Propionibacterium acnes J139]
 gi|60390367|sp|Q6A7V3|RL20_PROAC RecName: Full=50S ribosomal protein L20
 gi|50840495|gb|AAT83162.1| 50S ribosomal protein L20 [Propionibacterium acnes KPA171202]
 gi|282582139|gb|EFB87521.1| ribosomal protein L20 [Propionibacterium acnes J139]
 gi|314923956|gb|EFS87787.1| ribosomal protein L20 [Propionibacterium acnes HL001PA1]
 gi|314966002|gb|EFT10101.1| ribosomal protein L20 [Propionibacterium acnes HL082PA2]
 gi|314981815|gb|EFT25908.1| ribosomal protein L20 [Propionibacterium acnes HL110PA3]
 gi|315090683|gb|EFT62659.1| ribosomal protein L20 [Propionibacterium acnes HL110PA4]
 gi|315094894|gb|EFT66870.1| ribosomal protein L20 [Propionibacterium acnes HL060PA1]
 gi|315104166|gb|EFT76142.1| ribosomal protein L20 [Propionibacterium acnes HL050PA2]
 gi|315106685|gb|EFT78661.1| ribosomal protein L20 [Propionibacterium acnes HL030PA1]
 gi|327327989|gb|EGE69758.1| ribosomal protein L20 [Propionibacterium acnes HL103PA1]
 gi|327333953|gb|EGE75669.1| ribosomal protein L20 [Propionibacterium acnes HL097PA1]
          Length = 123

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 83/123 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL  A G+ G+R    R AK     S  Y++RDRR KK DFRSL
Sbjct: 1   MARVKRSVNAKKKRREVLDQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FINGL  AG+ +DRK+L++LA++ +++F  +VE++++    +
Sbjct: 61  WIQRINAASRAQGMTYNRFINGLKNAGVEVDRKMLAELAVSDINAFNSLVEVAKANQPQN 120

Query: 121 VAS 123
            A+
Sbjct: 121 AAA 123


>gi|253682029|ref|ZP_04862826.1| ribosomal protein L20 [Clostridium botulinum D str. 1873]
 gi|253561741|gb|EES91193.1| ribosomal protein L20 [Clostridium botulinum D str. 1873]
          Length = 119

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 61/119 (51%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  KHKK+LK AKG+YGRR  T R A   V R+  +AY  R++KKRDFR L
Sbjct: 1   MARVKRAIHARKKHKKILKLAKGYYGRRSRTFRNANETVLRAMNFAYVGRKLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NGL  AGI ++RK+LS++AI    +F  +VE+++ +L  
Sbjct: 61  WIARINAAARMNGLSYSRFMNGLKLAGINMNRKMLSEIAINDEKAFTDLVEVAKKQLNA 119


>gi|51245277|ref|YP_065161.1| 50S ribosomal protein L20 [Desulfotalea psychrophila LSv54]
 gi|60390369|sp|Q6ANC0|RL20_DESPS RecName: Full=50S ribosomal protein L20
 gi|50876314|emb|CAG36154.1| probable 50S ribosomal protein L20 [Desulfotalea psychrophila
           LSv54]
          Length = 118

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 58/116 (50%), Positives = 78/116 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV RG  +  +  +VLK AKG+ G R    + A  AVDR+  YAYRDR+ +KRDFR L
Sbjct: 1   MPRVTRGFKARRRRNRVLKLAKGYRGARSRLFKTATEAVDRALCYAYRDRKQRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINA  ++ D+NYS+FI GL KAGI LDRKVL++LA+    +F K+  +++  
Sbjct: 61  WITRINAGAKMNDINYSRFIGGLAKAGIELDRKVLANLAVLDAPAFTKLSVIAKEA 116


>gi|313674623|ref|YP_004052619.1| LSU ribosomal protein l20p [Marivirga tractuosa DSM 4126]
 gi|312941321|gb|ADR20511.1| LSU ribosomal protein L20P [Marivirga tractuosa DSM 4126]
          Length = 114

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 81/114 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+LK AKG++GR+KN    AK AV++   YAYRDR+ KKR+FR L
Sbjct: 1   MPRSVNHVASRARRKKILKYAKGYWGRKKNVWTVAKNAVEKGWLYAYRDRKQKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R + ++YSQF+  ++K GI L+RKVL+DLA+   ++FK +V+  +
Sbjct: 61  WIQRINAGAREHGMSYSQFMGAVNKKGIELNRKVLADLAMNHPEAFKSVVDSVK 114


>gi|270158048|ref|ZP_06186705.1| 50S ribosomal protein L20 [Legionella longbeachae D-4968]
 gi|289163684|ref|YP_003453822.1| 50S ribosomal protein L20 [Legionella longbeachae NSW150]
 gi|269990073|gb|EEZ96327.1| 50S ribosomal protein L20 [Legionella longbeachae D-4968]
 gi|288856857|emb|CBJ10668.1| 50S ribosomal protein L20 [Legionella longbeachae NSW150]
          Length = 119

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 78/106 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKV+  AKG+YG R  T R AK AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRVKRGVIAKARHKKVMDQAKGYYGARSRTYRMAKQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINA  R   L+YS+ I+GL KA I LDRKVL+DLA+    +F
Sbjct: 61  WITRINAQARECGLSYSRLIDGLKKASIELDRKVLADLAVHDKVAF 106


>gi|184155785|ref|YP_001844125.1| 50S ribosomal protein L20 [Lactobacillus fermentum IFO 3956]
 gi|260663498|ref|ZP_05864388.1| 50S ribosomal protein L20 [Lactobacillus fermentum 28-3-CHN]
 gi|215274798|sp|B2GDB3|RL20_LACF3 RecName: Full=50S ribosomal protein L20
 gi|183227129|dbj|BAG27645.1| 50S ribosomal protein L20 [Lactobacillus fermentum IFO 3956]
 gi|260552039|gb|EEX25092.1| 50S ribosomal protein L20 [Lactobacillus fermentum 28-3-CHN]
          Length = 117

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 79/115 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ K+++K AKG+ G +    + AK  V +S  YA+RDR+V KR+FR LWI
Sbjct: 2   RVKGGTVTRARRKRIMKLAKGYTGSKHRLFKTAKDQVMKSYTYAFRDRKVNKRNFRELWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R+  L+YS+ ++GL  A I ++RK+L+DLA+   D+FK +V+ ++  L
Sbjct: 62  ARINAGARMNGLSYSKLMHGLKLANIDINRKMLADLAVNDADAFKAVVDEAKKAL 116


>gi|323138785|ref|ZP_08073849.1| ribosomal protein L20 [Methylocystis sp. ATCC 49242]
 gi|322395933|gb|EFX98470.1| ribosomal protein L20 [Methylocystis sp. ATCC 49242]
          Length = 121

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 81/119 (68%), Positives = 95/119 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKK LK+AKGFYGRRKNTIR AKAAVDRS QYA RDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKTLKAAKGFYGRRKNTIRTAKAAVDRSMQYATRDRKAKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQR+NAAVR + L YS+FI+GL KAG+ +DRKVLS LAI + ++F  IV  ++S L  
Sbjct: 61  WIQRLNAAVREHGLTYSRFIDGLAKAGVAVDRKVLSQLAIEKPEAFAAIVAQAKSALPA 119


>gi|54023884|ref|YP_118126.1| 50S ribosomal protein L20 [Nocardia farcinica IFM 10152]
 gi|60390313|sp|Q5YYH9|RL20_NOCFA RecName: Full=50S ribosomal protein L20
 gi|54015392|dbj|BAD56762.1| putative ribosomal protein L20 [Nocardia farcinica IFM 10152]
          Length = 126

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 82/123 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+++KG+ G+R    R AK     S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSILEASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D+ Y++FI GL  AG+ +DRK L++LA++  ++F  +V ++++ L  D
Sbjct: 61  WIARINAAARLNDITYNRFIQGLKAAGVEVDRKNLAELAVSDAEAFAGLVAIAKAALPQD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|222529197|ref|YP_002573079.1| 50S ribosomal protein L20 [Caldicellulosiruptor bescii DSM 6725]
 gi|312622556|ref|YP_004024169.1| 50S ribosomal protein L20 [Caldicellulosiruptor kronotskyensis
           2002]
 gi|254800295|sp|B9MRK2|RL20_ANATD RecName: Full=50S ribosomal protein L20
 gi|222456044|gb|ACM60306.1| ribosomal protein L20 [Caldicellulosiruptor bescii DSM 6725]
 gi|312203023|gb|ADQ46350.1| ribosomal protein L20 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 119

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 83/118 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LWI
Sbjct: 2   RIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRRLKKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R   L+YS+F+NGL KAGI L+RKVL+D+A+    +F ++VE+++ ++   
Sbjct: 62  TRINAAARQNGLSYSKFMNGLKKAGINLNRKVLADMAVNDQKAFAELVEIAKKQINAQ 119


>gi|81429006|ref|YP_396006.1| 50S ribosomal protein L20 [Lactobacillus sakei subsp. sakei 23K]
 gi|109893119|sp|Q38VT4|RL20_LACSS RecName: Full=50S ribosomal protein L20
 gi|78610648|emb|CAI55699.1| 50S ribosomal protein L20 [Lactobacillus sakei subsp. sakei 23K]
          Length = 119

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + KK+LK AKG+ G +    ++A   V  S +YA+RDRR +KRDFR L
Sbjct: 1   MPRVKGGTVTRKRRKKILKLAKGYRGAKHLLFKSANTQVMVSYRYAFRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YSQ ++GL  A I ++RK+L+DLA+    +F  +VE +++ L
Sbjct: 61  WIARINAAARMNDMSYSQLMHGLRVAEIDMNRKMLADLAVNDAAAFTSVVEAAKAAL 117


>gi|51473787|ref|YP_067544.1| 50S ribosomal protein L20 [Rickettsia typhi str. Wilmington]
 gi|60390365|sp|Q68WD0|RL20_RICTY RecName: Full=50S ribosomal protein L20
 gi|51460099|gb|AAU04062.1| 50S ribosomal protein L20 [Rickettsia typhi str. Wilmington]
          Length = 117

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 64/115 (55%), Positives = 82/115 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++  YAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKKRHKKILKLAKGYRGRANSCFRVAIEKVEKALLYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAAVR + L YSQF+  L KAGI +DRKVL++LA+   D F  IV+ S++
Sbjct: 61  WIQRINAAVREHGLIYSQFMGALKKAGINIDRKVLAELAVNNNDGFTSIVQQSKA 115


>gi|291542635|emb|CBL15745.1| LSU ribosomal protein L20P [Ruminococcus bromii L2-63]
          Length = 116

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 54/116 (46%), Positives = 78/116 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  +++  + KK LK AKG++G +    + AK AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARVKGAMMTRKRRKKTLKLAKGYWGAKSRHFKMAKQAVMKSGNYAYIGRKQRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RI+AA +    NYS F+NGL KAGI L+RK+LS++AI+   +F  +VE +++ 
Sbjct: 61  WITRISAACKANGTNYSTFMNGLKKAGIALNRKMLSEIAISDPAAFTSLVEQAKNA 116


>gi|260887112|ref|ZP_05898375.1| ribosomal protein L20 [Selenomonas sputigena ATCC 35185]
 gi|330839115|ref|YP_004413695.1| ribosomal protein L20 [Selenomonas sputigena ATCC 35185]
 gi|260863174|gb|EEX77674.1| ribosomal protein L20 [Selenomonas sputigena ATCC 35185]
 gi|329746879|gb|AEC00236.1| ribosomal protein L20 [Selenomonas sputigena ATCC 35185]
          Length = 117

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 52/116 (44%), Positives = 77/116 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  +HKK+LK AKG+ G +    + A   V ++  YA RDRR KK +FR L
Sbjct: 1   MPRVKSGVTAHRRHKKILKLAKGYRGAKSKQFKKANETVMKALYYARRDRRAKKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  ++YS+ INGL KAG+ ++RK+ +DLA+    +F ++V +++  
Sbjct: 61  WIARINAAARMNGISYSRLINGLTKAGVEVNRKMFADLAVHDEKAFAQLVAIAKEN 116


>gi|237667040|ref|ZP_04527024.1| ribosomal protein L20 [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|237655388|gb|EEP52944.1| ribosomal protein L20 [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 118

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 81/118 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR   S   HKKVLK AKG+YG +    + A  +V R+ + AY  R+ KKRD+RSL
Sbjct: 1   MARVKRAKNSRKNHKKVLKLAKGYYGGKSKLFKTANESVIRALRNAYVGRKNKKRDYRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ +++YS+F+NG+  AGI ++RK+LS++AI    +F ++VE ++  L 
Sbjct: 61  WIARINAAARMNEMSYSKFMNGIKLAGIEINRKMLSEIAINDPKAFAELVETAKKALA 118


>gi|326792019|ref|YP_004309840.1| ribosomal protein L20 [Clostridium lentocellum DSM 5427]
 gi|326542783|gb|ADZ84642.1| ribosomal protein L20 [Clostridium lentocellum DSM 5427]
          Length = 118

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 81/117 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  +  +VLK AKG+ G +    R AK AV +S  YAY  R+++KR+FR L
Sbjct: 1   MARVKGGMSTKKRRNRVLKLAKGYRGAKSKQFRTAKQAVMKSLNYAYVGRKLRKREFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL  A + ++RK+LS+LAIT   +F ++VE +++ L
Sbjct: 61  WIARINAAARLNGLSYSRFMNGLKNANVNINRKMLSELAITNPAAFTQLVETAKANL 117


>gi|149371733|ref|ZP_01891149.1| 50S ribosomal protein L20 [unidentified eubacterium SCB49]
 gi|149355360|gb|EDM43920.1| 50S ribosomal protein L20 [unidentified eubacterium SCB49]
          Length = 114

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 61/114 (53%), Positives = 80/114 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AVD++  Y+YRDRR KKR FRSL
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGYFGRRKNVWTVAKNAVDKAMSYSYRDRRAKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R + ++YSQF+ G+ K+GI L+RKVL+DLA+   ++F+ IV   +
Sbjct: 61  WITRINAGARQHGMSYSQFMGGVKKSGIELNRKVLADLAMNHPEAFEAIVNKVK 114


>gi|299830573|ref|YP_003735021.1| 50S ribosomal protein L20 [Durinskia baltica]
 gi|297384937|gb|ADI40236.1| 50S ribosomal protein L20 [Durinskia baltica]
          Length = 114

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 47/112 (41%), Positives = 69/112 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+  + KK+L  A G+ G      R A   V ++ +Y+Y  R+ KKR FR +
Sbjct: 1   MVRVKRGNVARKRRKKILSLASGYRGAHSILFRVANQQVMKALRYSYIGRKQKKRIFRRI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVEL 112
           WI RINA  R+  ++YSQ IN   K+ I L+RK+LS +AI    +F+ ++E+
Sbjct: 61  WISRINATSRLNGISYSQLINKFKKSNIDLNRKMLSQIAILDSSTFQSLIEI 112


>gi|254438636|ref|ZP_05052130.1| ribosomal protein L20 [Octadecabacter antarcticus 307]
 gi|254451519|ref|ZP_05064956.1| ribosomal protein L20 [Octadecabacter antarcticus 238]
 gi|198254082|gb|EDY78396.1| ribosomal protein L20 [Octadecabacter antarcticus 307]
 gi|198265925|gb|EDY90195.1| ribosomal protein L20 [Octadecabacter antarcticus 238]
          Length = 119

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 69/118 (58%), Positives = 90/118 (76%), Gaps = 2/118 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKV  +AKG+YGRR NT + A+ AVD++ QYA RDR  +KR+FR+LWI
Sbjct: 2   RVKGGTVTHRRHKKVTDAAKGYYGRRSNTFKVARQAVDKANQYATRDRHNRKRNFRALWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           QRINAAVR  D  L YS+FINGL+ AGI +DRKVL+DLA+ + D+F  IVE ++S + 
Sbjct: 62  QRINAAVRSIDETLTYSRFINGLNLAGIEVDRKVLADLAVHEPDAFGAIVEKAKSAMA 119


>gi|154482662|ref|ZP_02025110.1| hypothetical protein EUBVEN_00335 [Eubacterium ventriosum ATCC
           27560]
 gi|149736438|gb|EDM52324.1| hypothetical protein EUBVEN_00335 [Eubacterium ventriosum ATCC
           27560]
          Length = 118

 Score =  147 bits (371), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 80/118 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y  R+ KKR FR L
Sbjct: 1   MARIKGGMNAKKKHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  AG+ ++RK+L+++A+   + F K+VE+++++L 
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLAGVEMNRKMLAEMAVNDAEGFAKLVEVAKAKLA 118


>gi|28211882|ref|NP_782826.1| 50S ribosomal protein L20 [Clostridium tetani E88]
 gi|31563101|sp|Q891T2|RL20_CLOTE RecName: Full=50S ribosomal protein L20
 gi|28204324|gb|AAO36763.1| LSU ribosomal protein L20P [Clostridium tetani E88]
          Length = 119

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  KHKK+LK +KG++G +    + A  +V R+ + AY  R++KKRD+R L
Sbjct: 1   MARVKRAMNARKKHKKILKLSKGYFGGKSRLFKTANESVIRALRNAYTGRKLKKRDYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+F+NGL  AGI ++RK+LS++AI    +F ++VE ++ +L  
Sbjct: 61  WIARINAATRANGLSYSRFMNGLKLAGIDMNRKMLSEIAINDPKAFSELVEAAKKQLNA 119


>gi|297562010|ref|YP_003680984.1| ribosomal protein L20 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296846458|gb|ADH68478.1| ribosomal protein L20 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 123

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 76/123 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K K VL  A G+ G+R    R AK  +  S  Y+YRDR+ +K  FR L
Sbjct: 1   MARVKRALNAKKKRKVVLDRASGYRGQRSRLYRKAKEQMLHSMTYSYRDRKDRKGQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++F+ GL  AGI +DR++L++LA+    +F  +VE ++  L  +
Sbjct: 61  WIQRINAASRAQGLTYNRFMQGLKLAGIEVDRRMLAELAVNDQAAFASLVETAKKALPAE 120

Query: 121 VAS 123
            A+
Sbjct: 121 AAA 123


>gi|298369381|ref|ZP_06980699.1| ribosomal protein L20 [Neisseria sp. oral taxon 014 str. F0314]
 gi|298283384|gb|EFI24871.1| ribosomal protein L20 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 119

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTAHARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE +++ L  
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKAAFAQLVEKAKAALAA 119


>gi|293363863|ref|ZP_06610599.1| ribosomal protein L20 [Mycoplasma alligatoris A21JP2]
 gi|292552353|gb|EFF41127.1| ribosomal protein L20 [Mycoplasma alligatoris A21JP2]
          Length = 117

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 82/116 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK LK AKG++G +    + AK AV +S  YA+RDR+  KR+FR L
Sbjct: 1   MARVKGGTVTRARRKKWLKLAKGYFGHKSVGYKVAKQAVVKSWTYAFRDRKQVKRNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   ++YS+FINGL KA I+++RK+LS+LAI +  +F  +VEL+R  
Sbjct: 61  WIARINAATRAAGMSYSRFINGLKKANILINRKMLSELAINEPKTFATLVELARDA 116


>gi|206895235|ref|YP_002246955.1| ribosomal protein L20 [Coprothermobacter proteolyticus DSM 5265]
 gi|206737852|gb|ACI16930.1| ribosomal protein L20 [Coprothermobacter proteolyticus DSM 5265]
          Length = 117

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 76/114 (66%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK  V   A+HKKVLK AKG++G      R A  AV ++ + A+  R+ +KRD RSLWI
Sbjct: 2   RVKTSVAKRARHKKVLKEAKGYFGASHRVYRKAHEAVLKAGEDAFAGRKQRKRDMRSLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
            RINAA R + +NYS F++GL  AGI +DRK+L++LA+T  + F  +VE ++  
Sbjct: 62  TRINAAARNHGMNYSNFMHGLKVAGIQIDRKMLAELAVTDPEGFSALVEKAKEA 115


>gi|254974301|ref|ZP_05270773.1| 50S ribosomal protein L20 [Clostridium difficile QCD-66c26]
 gi|255091698|ref|ZP_05321176.1| 50S ribosomal protein L20 [Clostridium difficile CIP 107932]
 gi|255313426|ref|ZP_05355009.1| 50S ribosomal protein L20 [Clostridium difficile QCD-76w55]
 gi|255516113|ref|ZP_05383789.1| 50S ribosomal protein L20 [Clostridium difficile QCD-97b34]
 gi|255649209|ref|ZP_05396111.1| 50S ribosomal protein L20 [Clostridium difficile QCD-37x79]
 gi|255654728|ref|ZP_05400137.1| 50S ribosomal protein L20 [Clostridium difficile QCD-23m63]
 gi|260682384|ref|YP_003213669.1| 50S ribosomal protein L20 [Clostridium difficile CD196]
 gi|260685983|ref|YP_003217116.1| 50S ribosomal protein L20 [Clostridium difficile R20291]
 gi|296878206|ref|ZP_06902218.1| 50S ribosomal protein L20 [Clostridium difficile NAP07]
 gi|306519313|ref|ZP_07405660.1| 50S ribosomal protein L20 [Clostridium difficile QCD-32g58]
 gi|260208547|emb|CBA61209.1| 50S ribosomal protein L20 [Clostridium difficile CD196]
 gi|260211999|emb|CBE02533.1| 50S ribosomal protein L20 [Clostridium difficile R20291]
 gi|296430775|gb|EFH16610.1| 50S ribosomal protein L20 [Clostridium difficile NAP07]
          Length = 118

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+ + +  KHKK+LK AKGF G R    R A   V ++ + AY  R++KKRDFR L
Sbjct: 1   MARVKKAMNARKKHKKILKLAKGFRGSRSKLYRPANTFVMKALKNAYIGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R+  ++YS+ +NGL  +GI ++RK+LS++AI   + F K+ E+++++L 
Sbjct: 61  WIQRINAAARMNGISYSRLMNGLKLSGIEVNRKMLSEMAIQDPEGFAKLAEVAKAKLA 118


>gi|157149726|ref|YP_001450323.1| 50S ribosomal protein L20 [Streptococcus gordonii str. Challis
           substr. CH1]
 gi|189041892|sp|A8AX13|RL20_STRGC RecName: Full=50S ribosomal protein L20
 gi|157074520|gb|ABV09203.1| ribosomal protein L20 [Streptococcus gordonii str. Challis substr.
           CH1]
          Length = 119

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 73/107 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+    +F 
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDATAFT 107


>gi|312127731|ref|YP_003992605.1| 50S ribosomal protein L20 [Caldicellulosiruptor hydrothermalis 108]
 gi|311777750|gb|ADQ07236.1| ribosomal protein L20 [Caldicellulosiruptor hydrothermalis 108]
          Length = 119

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 83/118 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LWI
Sbjct: 2   RIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYVGRRLKKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R   L+YS+F+NGL KAGI L+RKVL+D+A+    +F ++VE+++ ++   
Sbjct: 62  TRINAAARQNGLSYSKFMNGLKKAGINLNRKVLADMAVNDQKAFAELVEIAKKQINAQ 119


>gi|86355920|ref|YP_467812.1| 50S ribosomal protein L20 [Rhizobium etli CFN 42]
 gi|109893142|sp|Q2KDK1|RL20_RHIEC RecName: Full=50S ribosomal protein L20
 gi|86280022|gb|ABC89085.1| 50S ribosomal protein L20 [Rhizobium etli CFN 42]
          Length = 134

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 78/106 (73%), Positives = 94/106 (88%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKVLK+AKGFYGRRKNTIR AKAAVDR++QYAYRDR+V KR+FR+L
Sbjct: 1   MARVKRGVAAHAKHKKVLKAAKGFYGRRKNTIRTAKAAVDRAKQYAYRDRKVNKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAAVR + L Y +FI+GL+KAGI +DRKVLSD+AI + ++F
Sbjct: 61  WIQRINAAVREFGLTYGRFIDGLNKAGIEVDRKVLSDMAIHEPEAF 106


>gi|238924311|ref|YP_002937827.1| ribosomal protein L20 [Eubacterium rectale ATCC 33656]
 gi|259646185|sp|C4ZBG1|RL20_EUBR3 RecName: Full=50S ribosomal protein L20
 gi|238875986|gb|ACR75693.1| ribosomal protein L20 [Eubacterium rectale ATCC 33656]
 gi|291525081|emb|CBK90668.1| LSU ribosomal protein L20P [Eubacterium rectale DSM 17629]
 gi|291529176|emb|CBK94762.1| LSU ribosomal protein L20P [Eubacterium rectale M104/1]
          Length = 118

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 79/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  +H + LK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARVKGGLGAKKRHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YSQF++GL  A + L+RKVL+D+A+T    F K+VE+++S+L 
Sbjct: 61  WIARINAAARLNGLSYSQFMHGLKLANVDLNRKVLADMAVTDAAGFAKLVEVAKSKLA 118


>gi|220928738|ref|YP_002505647.1| 50S ribosomal protein L20 [Clostridium cellulolyticum H10]
 gi|254800312|sp|B8I169|RL20_CLOCE RecName: Full=50S ribosomal protein L20
 gi|219999066|gb|ACL75667.1| ribosomal protein L20 [Clostridium cellulolyticum H10]
          Length = 117

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 61/116 (52%), Positives = 81/116 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V + A+HKK+LK AKG++G +    R A  AV +S  YAY DRR KKRDFR L
Sbjct: 1   MARVKGAVRTRARHKKILKLAKGYFGAKSKLFRMANQAVMKSLNYAYNDRRAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  L YS+FI+GL K+GI L+RKVL+DLA+    +F ++ E +++ 
Sbjct: 61  WIARINAAARINGLTYSRFISGLRKSGIELNRKVLADLAVNDAAAFAQLAETAKAA 116


>gi|291544308|emb|CBL17417.1| LSU ribosomal protein L20P [Ruminococcus sp. 18P13]
          Length = 118

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 55/117 (47%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  + +  +  K LK AKG++G +    + AK AV +S  YAY  R+ KKRDFR+L
Sbjct: 1   MARVKGAMATRKRRNKTLKLAKGYWGNKSKHFKMAKQAVMKSGNYAYIGRKQKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NG  KAGI L+RK+LS++AI     F KI E +++ L
Sbjct: 61  WITRISAACKLNGMNYSTFMNGCKKAGITLNRKMLSEIAINDAAGFTKITEQAKAAL 117


>gi|227510527|ref|ZP_03940576.1| ribosomal protein L20 [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227513536|ref|ZP_03943585.1| ribosomal protein L20 [Lactobacillus buchneri ATCC 11577]
 gi|227524679|ref|ZP_03954728.1| ribosomal protein L20 [Lactobacillus hilgardii ATCC 8290]
 gi|227083409|gb|EEI18721.1| ribosomal protein L20 [Lactobacillus buchneri ATCC 11577]
 gi|227088163|gb|EEI23475.1| ribosomal protein L20 [Lactobacillus hilgardii ATCC 8290]
 gi|227190179|gb|EEI70246.1| ribosomal protein L20 [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
          Length = 118

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 80/117 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ K+VLK AKG+ G +    + AK  V +SQ YA+RDRR  K +FR +
Sbjct: 1   MPRVKGGTVTHARRKRVLKLAKGYRGGKSRLFKTAKDQVMKSQVYAFRDRRANKGNFRKI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ DL+YS+ ++GL  A I ++RK+L++LA+   D+FK + + ++  L
Sbjct: 61  WIARINAAARLNDLSYSKLMHGLKLANIDMNRKMLAELAVNDADAFKALTDEAKKAL 117


>gi|331269139|ref|YP_004395631.1| 50S ribosomal protein L20 [Clostridium botulinum BKT015925]
 gi|329125689|gb|AEB75634.1| ribosomal protein L20 [Clostridium botulinum BKT015925]
          Length = 119

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 61/119 (51%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  KHKK+LK AKG+YGRR  T R A   V R+  +AY  R++KKRDFR L
Sbjct: 1   MARVKRAIHARKKHKKILKLAKGYYGRRSRTFRNANETVLRAMNFAYVGRKLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NGL  AGI ++RK+LS++AI    +F  +VE+++ +L  
Sbjct: 61  WIARINAATRMNGLSYSRFMNGLKLAGINMNRKMLSEIAINDEKAFADLVEVAKKQLNA 119


>gi|82523879|emb|CAI78602.1| Ribosomal protein L20 [uncultured delta proteobacterium]
          Length = 115

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 64/114 (56%), Positives = 82/114 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V S  + K++LK AKG+ G R   IR A  +V+R+  YAYRDR+ KKRDFR L
Sbjct: 2   MPRVKNAVSSRKRRKRILKLAKGYRGARSKLIRIATESVNRALNYAYRDRKAKKRDFRRL 61

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R+ +++YS+ INGL KA I LDRKVLS+LAI+  + F +IV L+R
Sbjct: 62  WIIRINAAARMNNISYSKLINGLKKANIELDRKVLSELAISDPNGFSEIVALAR 115


>gi|261368267|ref|ZP_05981150.1| ribosomal protein L20 [Subdoligranulum variabile DSM 15176]
 gi|282569782|gb|EFB75317.1| ribosomal protein L20 [Subdoligranulum variabile DSM 15176]
          Length = 117

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K   ++  +  K LK AKG+YG +    R AK AV +S  YA+  R++KKR FR+L
Sbjct: 1   MARIKGATMTHKRRAKTLKLAKGYYGSKSKHFRMAKQAVMKSGNYAFVGRKLKKRQFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RIN AVR   +NYS F+NGL KAGI L+RK+LS++AI    SF  +VE ++  L
Sbjct: 61  WITRINNAVRAQGMNYSTFMNGLKKAGIELNRKMLSEMAIHDAASFNALVETAKKAL 117


>gi|296112357|ref|YP_003626295.1| 50S ribosomal protein L20 [Moraxella catarrhalis RH4]
 gi|295920051|gb|ADG60402.1| 50S ribosomal protein L20 [Moraxella catarrhalis RH4]
 gi|326561865|gb|EGE12200.1| 50S ribosomal protein L20 [Moraxella catarrhalis 7169]
 gi|326563300|gb|EGE13567.1| 50S ribosomal protein L20 [Moraxella catarrhalis 46P47B1]
 gi|326563415|gb|EGE13680.1| 50S ribosomal protein L20 [Moraxella catarrhalis 12P80B1]
 gi|326565954|gb|EGE16115.1| 50S ribosomal protein L20 [Moraxella catarrhalis 103P14B1]
 gi|326568911|gb|EGE18980.1| 50S ribosomal protein L20 [Moraxella catarrhalis BC1]
 gi|326569212|gb|EGE19273.1| 50S ribosomal protein L20 [Moraxella catarrhalis BC7]
 gi|326571885|gb|EGE21890.1| 50S ribosomal protein L20 [Moraxella catarrhalis BC8]
 gi|326575397|gb|EGE25322.1| 50S ribosomal protein L20 [Moraxella catarrhalis 101P30B1]
 gi|326576516|gb|EGE26424.1| 50S ribosomal protein L20 [Moraxella catarrhalis CO72]
 gi|326577985|gb|EGE27849.1| 50S ribosomal protein L20 [Moraxella catarrhalis O35E]
          Length = 118

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 61/118 (51%), Positives = 81/118 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV ++ +HKKVL  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQANRRHKKVLARAKGYYGARSRVYRVAVQAVMKAGQYAYRDRRNKKRSFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R+  L+YS+ INGL KA + +DR++L+D+A+    +F  I E +++ L 
Sbjct: 61  WIARINAGARLNGLSYSRLINGLKKANVEIDRRILADIAMHDAAAFTAITEKAKAALA 118


>gi|237752908|ref|ZP_04583388.1| 50S ribosomal protein L20 [Helicobacter winghamensis ATCC BAA-430]
 gi|229375175|gb|EEO25266.1| 50S ribosomal protein L20 [Helicobacter winghamensis ATCC BAA-430]
          Length = 117

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GFY  R    R AK  ++RS  YA+RDR+ KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFYSARHKHFRKAKEQLERSLCYAFRDRKQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS+F+ GL KAGI LDRK+L+D+A+ +  +F KIVE ++  L
Sbjct: 61  WIVRINAACRINAISYSRFMFGLKKAGITLDRKILADIAMHEPVAFAKIVENAKKAL 117


>gi|167629868|ref|YP_001680367.1| 50S ribosomal protein l20 [Heliobacterium modesticaldum Ice1]
 gi|226730405|sp|B0TEV4|RL20_HELMI RecName: Full=50S ribosomal protein L20
 gi|167592608|gb|ABZ84356.1| 50S ribosomal protein l20 [Heliobacterium modesticaldum Ice1]
          Length = 119

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 51/116 (43%), Positives = 79/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G +S  +HKK+LK A+G+        R A  +V ++  YAY  R+ KK DFR +
Sbjct: 1   MARVKTGPMSRKRHKKILKLARGYRNAHSKLFRTAHQSVMKALSYAYAHRKKKKGDFRKI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  ++YS  +NGL KAG+ ++RK+L+DLA+  L +F K+V++++++
Sbjct: 61  WITRINAAARMNGISYSVMMNGLKKAGVAVNRKMLADLAVNDLPAFAKLVDVAKAK 116


>gi|170016927|ref|YP_001727846.1| ribosomal protein L20 [Leuconostoc citreum KM20]
 gi|215274801|sp|B1MY00|RL20_LEUCK RecName: Full=50S ribosomal protein L20
 gi|169803784|gb|ACA82402.1| Ribosomal protein L20 [Leuconostoc citreum KM20]
          Length = 139

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 84/118 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G VS A+ KK++K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVSRARRKKMVKLAKGYRGQRRINFKVAKQQVWKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG+ L+RK+L+++A+T  D+F K+ + +++ L  D
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGVELNRKMLAEIAVTDFDTFAKLADQAKAALASD 119


>gi|68535911|ref|YP_250616.1| 50S ribosomal protein L20 [Corynebacterium jeikeium K411]
 gi|109893108|sp|Q4JW09|RL20_CORJK RecName: Full=50S ribosomal protein L20
 gi|68263510|emb|CAI36998.1| 50S ribosomal protein L20 [Corynebacterium jeikeium K411]
          Length = 127

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VLKSAKG+ G+R    R AK  +  S+ Y +RDR+ +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREVLKSAKGYRGQRSRLYRKAKEQMLHSKTYEFRDRKARKNEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINA  R   + Y++ I GL  A I +DRK L++LA+   D+F  + E +++ L  D
Sbjct: 61  WIQRINAGARQNGMTYNRLIQGLRLAEIEVDRKNLAELAVNDFDAFTALCEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|225848298|ref|YP_002728461.1| 50S ribosomal protein L20 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643070|gb|ACN98120.1| ribosomal protein L20 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 117

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 83/117 (70%), Gaps = 1/117 (0%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G  S    K++LK AKG+YG++  + R AK  V  S  YAYRDRR KKR FRSLWI
Sbjct: 2   RVK-GPSSKKHKKRILKLAKGYYGQKHRSYRRAKEQVMHSLAYAYRDRRQKKRQFRSLWI 60

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
            RINAA R+  +NYSQFINGL KAGI LDRK+L+D+A+  + +F K+VE ++S L  
Sbjct: 61  TRINAAARLNGINYSQFINGLKKAGIELDRKILADMAVNDMQAFAKLVETAKSALAA 117


>gi|224178079|ref|YP_002600935.1| ribosomal protein L20 [Pyramimonas parkeae]
 gi|215882746|gb|ACJ71119.1| ribosomal protein L20 [Pyramimonas parkeae]
          Length = 118

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 60/113 (53%), Positives = 78/113 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  + +++LK  KGF G      R A     ++ +Y+Y DRR +K +FR L
Sbjct: 1   MTRVKRGAVARNRRRRILKLTKGFQGSHSTLFRTANQQAMKALKYSYVDRRKRKIEFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI+RINA+ R+Y LNYSQ I GL KA I L+RKVL+ LAI   DSFKKI+EL+
Sbjct: 61  WIRRINASSRMYGLNYSQLIYGLKKAKIDLNRKVLAQLAILDPDSFKKIIELA 113


>gi|312135022|ref|YP_004002360.1| 50S ribosomal protein L20 [Caldicellulosiruptor owensensis OL]
 gi|311775073|gb|ADQ04560.1| ribosomal protein L20 [Caldicellulosiruptor owensensis OL]
          Length = 119

 Score =  146 bits (370), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 83/118 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+K GV +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LWI
Sbjct: 2   RIKNGVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRRLKKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R   L+YS+F+NGL KAGI L+RKVL+D+A+    +F ++VE+++ ++   
Sbjct: 62  TRINAAARQNGLSYSRFMNGLKKAGINLNRKVLADMAVNDQKAFAELVEIAKKQINAQ 119


>gi|295100357|emb|CBK97902.1| LSU ribosomal protein L20P [Faecalibacterium prausnitzii L2-6]
          Length = 116

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 75/116 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K   ++  + KK+LK AKGFYG +    + AK  V +S  YA   RR+KKR FR+L
Sbjct: 1   MARIKGATMTHKRRKKMLKLAKGFYGCKSKHFKMAKQQVMKSGNYALAGRRMKKRQFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RIN AVR   +NYS F+ GL KAGI L+RK+LS++AI    SF  +VE  ++ 
Sbjct: 61  WICRINNAVRPLGMNYSSFMAGLKKAGIELNRKMLSEMAINDPKSFAALVETVKNA 116


>gi|160878607|ref|YP_001557575.1| ribosomal protein L20 [Clostridium phytofermentans ISDg]
 gi|189041857|sp|A9KHG9|RL20_CLOPH RecName: Full=50S ribosomal protein L20
 gi|160427273|gb|ABX40836.1| ribosomal protein L20 [Clostridium phytofermentans ISDg]
          Length = 118

 Score =  146 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 79/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH KVLK AKG+ G R    R AK +V R+   A+  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKKHNKVLKLAKGYRGARSKQYRVAKQSVMRALTSAFAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  A + ++RK+L++LA+   + FK +VE+++S+L 
Sbjct: 61  WIARINAAARMNGLSYSKFMYGLKLAEVSVNRKMLAELAVNDAEGFKALVEVAKSKLA 118


>gi|255534994|ref|YP_003095365.1| LSU ribosomal protein L20p [Flavobacteriaceae bacterium 3519-10]
 gi|255341190|gb|ACU07303.1| LSU ribosomal protein L20p [Flavobacteriaceae bacterium 3519-10]
          Length = 114

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 76/114 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKGF+GRRKN    AK AV ++ QYAYR R+ KKR FRSL
Sbjct: 1   MPRSVNAVASRARRKKVMKLAKGFFGRRKNVWTVAKNAVQKAMQYAYRGRKEKKRSFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R + + YSQF+  L    I L+RKVL+DLA+   ++FK +V+  +
Sbjct: 61  WIMRINAGAREHGMTYSQFMGALKSNNIELNRKVLADLAMNHPEAFKAVVDQVK 114


>gi|326201565|ref|ZP_08191436.1| ribosomal protein L20 [Clostridium papyrosolvens DSM 2782]
 gi|325988165|gb|EGD48990.1| ribosomal protein L20 [Clostridium papyrosolvens DSM 2782]
          Length = 117

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/116 (52%), Positives = 82/116 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V + A+HKK+LK AKG++G +    R A  AV +S  YA+ DRR KKRDFR L
Sbjct: 1   MARVKGAVRTRARHKKILKLAKGYFGAKSKLYRMANQAVMKSLNYAFNDRRAKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  L+YS+FI+GL K+GI L+RKVL+DLA+    +F K+ E +++ 
Sbjct: 61  WIARINAAARINGLSYSKFISGLKKSGIELNRKVLADLAVNDAAAFAKLAETAKAA 116


>gi|11467305|ref|NP_043162.1| ribosomal protein L20 [Cyanophora paradoxa]
 gi|132762|sp|P14809|RK20_CYAPA RecName: Full=50S ribosomal protein L20, cyanelle
 gi|11293|emb|CAA34908.1| ribosomal protein L20 [Cyanophora paradoxa]
 gi|1016106|gb|AAA81193.1| ribosomal protein L20 [Cyanophora paradoxa]
          Length = 114

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 72/112 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  + KK+LK A GF G      R A   V ++ +YAY DR  +KRDFR+L
Sbjct: 1   MTRVKRGNVARKRRKKILKLASGFRGAHSRLFRVANQQVMKALRYAYNDRNKRKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVEL 112
           WI RINA+ R+  + YS+ +  L K  I+L+RK LS LAI   D+F +I++ 
Sbjct: 61  WIARINASARLEGMTYSKLMGSLKKLNIILNRKSLSQLAIYDKDAFMEILKT 112


>gi|15900838|ref|NP_345442.1| 50S ribosomal protein L20 [Streptococcus pneumoniae TIGR4]
 gi|15902907|ref|NP_358457.1| 50S ribosomal protein L20 [Streptococcus pneumoniae R6]
 gi|111658038|ref|ZP_01408740.1| hypothetical protein SpneT_02000771 [Streptococcus pneumoniae
           TIGR4]
 gi|116516545|ref|YP_816331.1| 50S ribosomal protein L20 [Streptococcus pneumoniae D39]
 gi|148984703|ref|ZP_01817971.1| ribosomal protein L20 [Streptococcus pneumoniae SP3-BS71]
 gi|148988401|ref|ZP_01819848.1| ribosomal protein L20 [Streptococcus pneumoniae SP6-BS73]
 gi|148992904|ref|ZP_01822523.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP9-BS68]
 gi|148998604|ref|ZP_01826044.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP11-BS70]
 gi|149002511|ref|ZP_01827445.1| ribosomal protein L20 [Streptococcus pneumoniae SP14-BS69]
 gi|149006363|ref|ZP_01830075.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP18-BS74]
 gi|149010393|ref|ZP_01831764.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP19-BS75]
 gi|149019552|ref|ZP_01834871.1| ribosomal protein L20 [Streptococcus pneumoniae SP23-BS72]
 gi|168483031|ref|ZP_02707983.1| ribosomal protein L20 [Streptococcus pneumoniae CDC1873-00]
 gi|168485913|ref|ZP_02710421.1| ribosomal protein L20 [Streptococcus pneumoniae CDC1087-00]
 gi|168490220|ref|ZP_02714419.1| ribosomal protein L20 [Streptococcus pneumoniae SP195]
 gi|168491050|ref|ZP_02715193.1| ribosomal protein L20 [Streptococcus pneumoniae CDC0288-04]
 gi|168494390|ref|ZP_02718533.1| ribosomal protein L20 [Streptococcus pneumoniae CDC3059-06]
 gi|168575623|ref|ZP_02721559.1| ribosomal protein L20 [Streptococcus pneumoniae MLV-016]
 gi|169833852|ref|YP_001694406.1| 50S ribosomal protein L20 [Streptococcus pneumoniae Hungary19A-6]
 gi|182683907|ref|YP_001835654.1| 50S ribosomal protein L20 [Streptococcus pneumoniae CGSP14]
 gi|194398245|ref|YP_002037596.1| 50S ribosomal protein L20 [Streptococcus pneumoniae G54]
 gi|221231724|ref|YP_002510876.1| 50S ribosomal protein L20 [Streptococcus pneumoniae ATCC 700669]
 gi|225854465|ref|YP_002735977.1| 50S ribosomal protein L20 [Streptococcus pneumoniae JJA]
 gi|225856619|ref|YP_002738130.1| 50S ribosomal protein L20 [Streptococcus pneumoniae P1031]
 gi|225858754|ref|YP_002740264.1| 50S ribosomal protein L20 [Streptococcus pneumoniae 70585]
 gi|225861152|ref|YP_002742661.1| 50S ribosomal protein L20 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650889|ref|ZP_04525141.1| 50S ribosomal protein L20 [Streptococcus pneumoniae CCRI 1974]
 gi|237821898|ref|ZP_04597743.1| 50S ribosomal protein L20 [Streptococcus pneumoniae CCRI 1974M2]
 gi|298229845|ref|ZP_06963526.1| 50S ribosomal protein L20 [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298254544|ref|ZP_06978130.1| 50S ribosomal protein L20 [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298503029|ref|YP_003724969.1| 50S ribosomal protein L20 [Streptococcus pneumoniae TCH8431/19A]
 gi|303254429|ref|ZP_07340535.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS455]
 gi|303259873|ref|ZP_07345848.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP-BS293]
 gi|303262287|ref|ZP_07348231.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP14-BS292]
 gi|303264709|ref|ZP_07350627.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS397]
 gi|303267238|ref|ZP_07353103.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS457]
 gi|303269524|ref|ZP_07355289.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS458]
 gi|307067618|ref|YP_003876584.1| hypothetical protein SPAP_0993 [Streptococcus pneumoniae AP200]
 gi|307127488|ref|YP_003879519.1| 50S ribosomal protein L20 [Streptococcus pneumoniae 670-6B]
 gi|54039130|sp|P66113|RL20_STRR6 RecName: Full=50S ribosomal protein L20
 gi|54041833|sp|P66112|RL20_STRPN RecName: Full=50S ribosomal protein L20
 gi|122278783|sp|Q04KW7|RL20_STRP2 RecName: Full=50S ribosomal protein L20
 gi|226730460|sp|B5E480|RL20_STRP4 RecName: Full=50S ribosomal protein L20
 gi|226730461|sp|B1IBC1|RL20_STRPI RecName: Full=50S ribosomal protein L20
 gi|226730462|sp|B2IPB5|RL20_STRPS RecName: Full=50S ribosomal protein L20
 gi|254800341|sp|C1C6T8|RL20_STRP7 RecName: Full=50S ribosomal protein L20
 gi|254800342|sp|B8ZP58|RL20_STRPJ RecName: Full=50S ribosomal protein L20
 gi|254800344|sp|C1CDV6|RL20_STRZJ RecName: Full=50S ribosomal protein L20
 gi|254800345|sp|C1CK42|RL20_STRZP RecName: Full=50S ribosomal protein L20
 gi|254800346|sp|C1CRT9|RL20_STRZT RecName: Full=50S ribosomal protein L20
 gi|14972435|gb|AAK75082.1| ribosomal protein L20 [Streptococcus pneumoniae TIGR4]
 gi|15458467|gb|AAK99667.1| 50S Ribosomal protein L20 [Streptococcus pneumoniae R6]
 gi|116077121|gb|ABJ54841.1| ribosomal protein L20 [Streptococcus pneumoniae D39]
 gi|147755602|gb|EDK62649.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP11-BS70]
 gi|147759448|gb|EDK66440.1| ribosomal protein L20 [Streptococcus pneumoniae SP14-BS69]
 gi|147762140|gb|EDK69102.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP18-BS74]
 gi|147764874|gb|EDK71803.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP19-BS75]
 gi|147923094|gb|EDK74209.1| ribosomal protein L20 [Streptococcus pneumoniae SP3-BS71]
 gi|147926082|gb|EDK77156.1| ribosomal protein L20 [Streptococcus pneumoniae SP6-BS73]
 gi|147928356|gb|EDK79372.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP9-BS68]
 gi|147930927|gb|EDK81907.1| ribosomal protein L20 [Streptococcus pneumoniae SP23-BS72]
 gi|168996354|gb|ACA36966.1| ribosomal protein L20 [Streptococcus pneumoniae Hungary19A-6]
 gi|172043473|gb|EDT51519.1| ribosomal protein L20 [Streptococcus pneumoniae CDC1873-00]
 gi|182629241|gb|ACB90189.1| 50S ribosomal protein L20 [Streptococcus pneumoniae CGSP14]
 gi|183570963|gb|EDT91491.1| ribosomal protein L20 [Streptococcus pneumoniae CDC1087-00]
 gi|183571420|gb|EDT91948.1| ribosomal protein L20 [Streptococcus pneumoniae SP195]
 gi|183574586|gb|EDT95114.1| ribosomal protein L20 [Streptococcus pneumoniae CDC0288-04]
 gi|183575637|gb|EDT96165.1| ribosomal protein L20 [Streptococcus pneumoniae CDC3059-06]
 gi|183578551|gb|EDT99079.1| ribosomal protein L20 [Streptococcus pneumoniae MLV-016]
 gi|194357912|gb|ACF56360.1| 50S ribosomal protein L20 [Streptococcus pneumoniae G54]
 gi|220674184|emb|CAR68712.1| 50S ribosomal protein L20 [Streptococcus pneumoniae ATCC 700669]
 gi|225720302|gb|ACO16156.1| ribosomal protein L20 [Streptococcus pneumoniae 70585]
 gi|225723595|gb|ACO19448.1| ribosomal protein L20 [Streptococcus pneumoniae JJA]
 gi|225726279|gb|ACO22131.1| ribosomal protein L20 [Streptococcus pneumoniae P1031]
 gi|225726453|gb|ACO22304.1| ribosomal protein L20 [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238624|gb|ADI69755.1| 50S ribosomal protein L20 [Streptococcus pneumoniae TCH8431/19A]
 gi|301794099|emb|CBW36505.1| 50S ribosomal protein L20 [Streptococcus pneumoniae INV104]
 gi|301799937|emb|CBW32520.1| 50S ribosomal protein L20 [Streptococcus pneumoniae OXC141]
 gi|302598596|gb|EFL65636.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS455]
 gi|302636610|gb|EFL67101.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP14-BS292]
 gi|302639078|gb|EFL69538.1| 50S ribosomal protein L20 [Streptococcus pneumoniae SP-BS293]
 gi|302640960|gb|EFL71342.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS458]
 gi|302643247|gb|EFL73529.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS457]
 gi|302645796|gb|EFL76025.1| 50S ribosomal protein L20 [Streptococcus pneumoniae BS397]
 gi|306409155|gb|ADM84582.1| hypothetical protein SPAP_0993 [Streptococcus pneumoniae AP200]
 gi|306484550|gb|ADM91419.1| ribosomal protein L20 [Streptococcus pneumoniae 670-6B]
 gi|327389239|gb|EGE87584.1| ribosomal protein L20 [Streptococcus pneumoniae GA04375]
 gi|332073294|gb|EGI83773.1| ribosomal protein L20 [Streptococcus pneumoniae GA17570]
 gi|332075577|gb|EGI86045.1| ribosomal protein L20 [Streptococcus pneumoniae GA17545]
 gi|332076235|gb|EGI86701.1| ribosomal protein L20 [Streptococcus pneumoniae GA41301]
 gi|332201427|gb|EGJ15497.1| ribosomal protein L20 [Streptococcus pneumoniae GA47368]
 gi|332202816|gb|EGJ16885.1| ribosomal protein L20 [Streptococcus pneumoniae GA41317]
 gi|332204964|gb|EGJ19029.1| ribosomal protein L20 [Streptococcus pneumoniae GA47901]
          Length = 119

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 58/107 (54%), Positives = 73/107 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+    +F 
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDAVAFT 107


>gi|227875290|ref|ZP_03993432.1| ribosomal protein L20 [Mobiluncus mulieris ATCC 35243]
 gi|306818552|ref|ZP_07452275.1| 50S ribosomal protein L20 [Mobiluncus mulieris ATCC 35239]
 gi|227844195|gb|EEJ54362.1| ribosomal protein L20 [Mobiluncus mulieris ATCC 35243]
 gi|304648725|gb|EFM46027.1| 50S ribosomal protein L20 [Mobiluncus mulieris ATCC 35239]
          Length = 126

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 76/122 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  Y YRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTTLERASGYRGQRSRLYRKAKEQVTHSFVYNYRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R   + Y++FI GL  A + +DR++L++LA++ + +F  +V++++  L  D
Sbjct: 61  WITRINAACRAEGMTYNRFIQGLRLAEVEVDRRMLAELAVSDITAFNALVKVAKDALPKD 120

Query: 121 VA 122
           V 
Sbjct: 121 VN 122


>gi|21231895|ref|NP_637812.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767977|ref|YP_242739.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991103|ref|YP_001903113.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. B100]
 gi|23822041|sp|Q8P7Z4|RL20_XANCP RecName: Full=50S ribosomal protein L20
 gi|81306046|sp|Q4UW54|RL20_XANC8 RecName: Full=50S ribosomal protein L20
 gi|226730474|sp|B0RRH2|RL20_XANCB RecName: Full=50S ribosomal protein L20
 gi|21113619|gb|AAM41736.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66573309|gb|AAY48719.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167732863|emb|CAP51057.1| 50S ribosomal protein L20 [Xanthomonas campestris pv. campestris]
          Length = 119

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 63/119 (52%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR+FRSL
Sbjct: 1   MARVKRGVQARRRHKKILTLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+ KAGI LDRKVL+D+A+     F  + E ++  L  
Sbjct: 61  WITRINAAARINGLSYSRFMNGMLKAGITLDRKVLADIAVHDAAGFAALAEKAKGALAA 119


>gi|262091798|gb|ACY25386.1| LSU ribosomal protein L20P [uncultured actinobacterium]
          Length = 119

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 74/117 (63%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRGV ++ K +  L+ A G+ G+R      AK  V  S  YA+ DR+ KK DFR LWI
Sbjct: 2   RVKRGVHAAKKRRTTLERASGYRGQRSRLFTKAKEQVTHSMVYAFNDRKDKKGDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           QRINA  R + L Y++FI GL  +G+ +DR+VLS+LA     +FK +V+++R  L  
Sbjct: 62  QRINAGCREHGLTYNRFIQGLKASGVEVDRRVLSELATNDPATFKTLVDVARKSLAA 118


>gi|126698266|ref|YP_001087163.1| 50S ribosomal protein L20 [Clostridium difficile 630]
 gi|255099799|ref|ZP_05328776.1| 50S ribosomal protein L20 [Clostridium difficile QCD-63q42]
 gi|255305684|ref|ZP_05349856.1| 50S ribosomal protein L20 [Clostridium difficile ATCC 43255]
 gi|123066950|sp|Q189N4|RL20_CLOD6 RecName: Full=50S ribosomal protein L20
 gi|115249703|emb|CAJ67520.1| 50S ribosomal protein L20 [Clostridium difficile]
          Length = 118

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+ + +  KHKK+LK AKGF G R    R A   V ++ + AY  R++KKRDFR L
Sbjct: 1   MARVKKAMNARKKHKKILKLAKGFRGSRSKLYRPANTFVMKALKNAYIGRKLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R+  ++YS+ +NGL  +G+ ++RK+LS++AI   + F K+ E+++++L 
Sbjct: 61  WIQRINAAARMNGISYSRLMNGLKLSGVEVNRKMLSEMAIQDPEGFAKLAEVAKAKLA 118


>gi|297623449|ref|YP_003704883.1| 50S ribosomal protein L20 [Truepera radiovictrix DSM 17093]
 gi|297164629|gb|ADI14340.1| ribosomal protein L20 [Truepera radiovictrix DSM 17093]
          Length = 116

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 81/116 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G V   KHKKVLK AKGF+G R  + R A+  +  +  Y YRDRR KK DFR L
Sbjct: 1   MPRAKTGTVRRQKHKKVLKRAKGFWGLRSRSFRIAQQTLLNAADYEYRDRRDKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   L+YS F++GL KAG+ ++RK+L+DLA+   D+FK++VE++++ 
Sbjct: 61  WIARINAAARQEGLSYSVFVSGLRKAGVEINRKILADLAVQHPDAFKRLVEIAKAA 116


>gi|239948220|ref|ZP_04699973.1| ribosomal protein L20 [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922496|gb|EER22520.1| ribosomal protein L20 [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 117

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/117 (54%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AK + GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKSYRGRANSCFRIAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQFI  L KA I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFIGALKKAEIDIDRKVLAELAVNNSDGFASIVEQAKAHI 117


>gi|295107328|emb|CBL04871.1| LSU ribosomal protein L20P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 117

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 78/117 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  AKG+YG +  + RAAK  V  S QY YRDRR KKR+ R L
Sbjct: 1   MARVKRAVSAHKKRRTVLNRAKGYYGAKSRSYRAAKEQVQHSLQYMYRDRRNKKREIRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  ++YS  +NGL KAG+ LDRKVLSD+A+    +F  I E+++  L
Sbjct: 61  WITRINAAARINGMSYSVLMNGLKKAGVQLDRKVLSDMAVNDPAAFTAITEVAKKAL 117


>gi|298346968|ref|YP_003719655.1| 50S ribosomal protein L20 [Mobiluncus curtisii ATCC 43063]
 gi|304389321|ref|ZP_07371286.1| 50S ribosomal protein L20 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315655514|ref|ZP_07908413.1| inorganic diphosphatase [Mobiluncus curtisii ATCC 51333]
 gi|315656579|ref|ZP_07909466.1| inorganic diphosphatase [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
 gi|298237029|gb|ADI68161.1| 50S ribosomal protein L20 [Mobiluncus curtisii ATCC 43063]
 gi|304327439|gb|EFL94672.1| 50S ribosomal protein L20 [Mobiluncus curtisii subsp. curtisii ATCC
           35241]
 gi|315490169|gb|EFU79795.1| inorganic diphosphatase [Mobiluncus curtisii ATCC 51333]
 gi|315492534|gb|EFU82138.1| inorganic diphosphatase [Mobiluncus curtisii subsp. holmesii ATCC
           35242]
          Length = 127

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A+G+ G+R    R AK  V  S  Y YRDR+V+K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTTLERAEGYRGQRSRLYRKAKEQVTHSFVYNYRDRKVRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R   + Y++F+ GL  AGI +DR++L++LA++ + +F ++V+ +++ L  D
Sbjct: 61  WITRINAACRAQGMTYNRFMQGLRLAGIEVDRRMLAELAVSDIAAFNELVKAAQAALPKD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|257455762|ref|ZP_05620988.1| ribosomal protein L20 [Enhydrobacter aerosaccus SK60]
 gi|257446776|gb|EEV21793.1| ribosomal protein L20 [Enhydrobacter aerosaccus SK60]
          Length = 119

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 62/119 (52%), Positives = 79/119 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV ++ +HKKVL  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MARVKRGVQANRRHKKVLARAKGYYGARSRVFRVAVQAVTKAGQYAYRDRRNKKRSFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R+  L+YS+ INGL KA I +DR+VL+D+A+     F  + E ++  L  
Sbjct: 61  WIARINAGARLNGLSYSRMINGLKKASIEIDRRVLADIAMHDAQGFTALAEKAKQALAA 119


>gi|300933425|ref|ZP_07148681.1| 50S ribosomal protein L20 [Corynebacterium resistens DSM 45100]
          Length = 127

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL SAKG+ G+R    R AK  +  S+ Y +RDRR +K DFR L
Sbjct: 1   MARVKRSVNAKKKRREVLNSAKGYRGQRSRLYRKAKEQMLHSKTYEFRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R+ D+ Y++ I GL  A I +DRK+L++LA+   D+F  + E +++ L  D
Sbjct: 61  WIQRINAAARMNDITYNRLIQGLRLAEIEVDRKMLAELAVNDFDAFSALCEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|302874882|ref|YP_003843515.1| 50S ribosomal protein L20 [Clostridium cellulovorans 743B]
 gi|307690501|ref|ZP_07632947.1| 50S ribosomal protein L20 [Clostridium cellulovorans 743B]
 gi|302577739|gb|ADL51751.1| ribosomal protein L20 [Clostridium cellulovorans 743B]
          Length = 118

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/117 (50%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + S  KHKKVLK AKG+YG +    R A   V R+ + AY  RR+KKRDFR L
Sbjct: 1   MARVKRAMNSRKKHKKVLKLAKGYYGAKSKLFRTANETVIRALRNAYVGRRLKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+NGL  AGI ++RK+LS++AI    +F ++V ++++ +
Sbjct: 61  WIARINAAARMNGLSYSRFMNGLKVAGIDMNRKMLSEIAIHDPKAFTELVAVAKANI 117


>gi|320547005|ref|ZP_08041306.1| 50S ribosomal protein L20 [Streptococcus equinus ATCC 9812]
 gi|320448407|gb|EFW89149.1| 50S ribosomal protein L20 [Streptococcus equinus ATCC 9812]
          Length = 119

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/107 (55%), Positives = 73/107 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFK 107
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+    +F 
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVNDATAFT 107


>gi|297182197|gb|ADI18368.1| hypothetical protein [uncultured actinobacterium HF4000_04C13]
          Length = 119

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 79/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V S  KHK +L+ A+G+YG R  T ++A  AV  +  YA+RDRR +K  FR L
Sbjct: 1   MARVKRAVHSKKKHKAILEQAQGYYGDRSRTFKSANEAVMHAGNYAFRDRRARKGQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WIQRINAA R +  +YS FI GL  AG+ +DRKVL+DLA+ +  +F  +V+L+ S 
Sbjct: 61  WIQRINAACRQHGTSYSVFIAGLKNAGVEVDRKVLADLAVAEPTAFAALVQLATSA 116


>gi|268678726|ref|YP_003303157.1| ribosomal protein L20 [Sulfurospirillum deleyianum DSM 6946]
 gi|268616757|gb|ACZ11122.1| ribosomal protein L20 [Sulfurospirillum deleyianum DSM 6946]
          Length = 117

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKK+LK A+GF+  R+   R AK  ++RS  YA+RDRR KKRDFR L
Sbjct: 1   MARVKTGIVRRRRHKKILKMARGFFSGRRKHFRKAKEQLERSLVYAFRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YS+FIN L+KA I LDRK+L+D+A+   ++F  +V+ +++ L
Sbjct: 61  WITRINAACRLNDISYSRFINALNKANIDLDRKILADMAMNDPEAFATVVKQAKAAL 117


>gi|227485252|ref|ZP_03915568.1| ribosomal protein L20 [Anaerococcus lactolyticus ATCC 51172]
 gi|227236712|gb|EEI86727.1| ribosomal protein L20 [Anaerococcus lactolyticus ATCC 51172]
          Length = 117

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 55/115 (47%), Positives = 77/115 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KR V +  +HKKVLK AKG+YG +    R A  AV +S  YAY  R+ +KRDFR L
Sbjct: 1   MARIKRAVNAKKRHKKVLKQAKGYYGSKSLLFRTANQAVMKSLSYAYIGRKHRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R+   +YS+ + GL KA I ++RK+L++LA+   + F K+VE ++ 
Sbjct: 61  WIARINAAARLNGTSYSKLMGGLKKANIDINRKMLAELAVNSPEEFAKLVEAAKK 115


>gi|11467492|ref|NP_043638.1| ribosomal protein L20 [Odontella sinensis]
 gi|1350627|sp|P49556|RK20_ODOSI RecName: Full=50S ribosomal protein L20, chloroplastic
 gi|1185187|emb|CAA91670.1| 50S ribosomal protein L20 [Odontella sinensis]
          Length = 114

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 74/114 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG ++  + KK+L+ AKG+ G      R A   V ++ +Y+Y  R+ KKR FR L
Sbjct: 1   MARVKRGNIARKRAKKILQLAKGYRGAHSRLFRIANQQVMKALRYSYVGRKQKKRVFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R+  L+YS+ I+   K+ I L+RK+LS +A+  + +F +++ +S+
Sbjct: 61  WITRINAASRLNGLSYSRLIHNFKKSNIELNRKMLSQIAVLDIPTFNQLIAISK 114


>gi|213966322|ref|ZP_03394504.1| ribosomal protein L20 [Corynebacterium amycolatum SK46]
 gi|213951028|gb|EEB62428.1| ribosomal protein L20 [Corynebacterium amycolatum SK46]
          Length = 127

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL SAKG+ G+R    R AK  +  S+ Y +RDRR +K  FR L
Sbjct: 1   MARVKRSVNAKKKRREVLDSAKGYRGQRSRLYRKAKEQMLHSKTYEFRDRRHRKGQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R  D+ Y++F+ GL+ AG+ +DRK L++LA+    +F  +V++++  L  D
Sbjct: 61  WIQRINAAARANDITYNRFVQGLNLAGVEVDRKNLAELAVNDPQAFAALVKVAKDALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|282877702|ref|ZP_06286517.1| ribosomal protein L20 [Prevotella buccalis ATCC 35310]
 gi|281300274|gb|EFA92628.1| ribosomal protein L20 [Prevotella buccalis ATCC 35310]
          Length = 114

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 76/114 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+  ++LK  KG++G RKN    AK   ++   YAYRDRR KKR FRSL
Sbjct: 1   MPRSVNHVASKARRTRILKQTKGYFGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+  ++YS  +  L+KAGI ++RKVL+DLA+   ++FK IV+  +
Sbjct: 61  WIQRINAAARLEGMSYSTLMGALNKAGIEINRKVLADLAVNNPEAFKAIVDKVK 114


>gi|328953977|ref|YP_004371311.1| 50S ribosomal protein L20 [Desulfobacca acetoxidans DSM 11109]
 gi|328454301|gb|AEB10130.1| 50S ribosomal protein L20 [Desulfobacca acetoxidans DSM 11109]
          Length = 117

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 66/116 (56%), Positives = 91/116 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+K AKG+ G R++  R+A+ AVDR+  +AYRDR+V+KR+FR+L
Sbjct: 1   MPRVKRGVRARARHKKVMKLAKGYRGGRRSLYRSAREAVDRALCFAYRDRKVRKREFRNL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI R+NAAVR + L+YS+FI+ L KA I LDRKVL+DLA+   + F +IVEL++  
Sbjct: 61  WIVRLNAAVRPFGLSYSRFIHQLDKANIRLDRKVLADLAVYHPEDFSRIVELAQKA 116


>gi|206603261|gb|EDZ39741.1| Ribosomal protein L20 [Leptospirillum sp. Group II '5-way CG']
          Length = 118

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 87/118 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G +  A+ KK++  AKGF+G R    R+A+  V++   YAYRDR+VKKR+FRSL
Sbjct: 1   MSRVKGGTIHKARRKKIMDLAKGFWGGRSRLYRSARHTVEKGLTYAYRDRKVKKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R+  +NYS+F+ GL K GI LDRK+L+DLA+ Q ++F+++ + ++  + 
Sbjct: 61  WIQRINAACRMESINYSRFMAGLRKLGIALDRKILADLALNQPETFRELTQKAKQAIS 118


>gi|254796601|ref|YP_003081437.1| ribosomal protein L20 [Neorickettsia risticii str. Illinois]
 gi|254589848|gb|ACT69210.1| ribosomal protein L20 [Neorickettsia risticii str. Illinois]
          Length = 117

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 70/117 (59%), Positives = 90/117 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV    +HKKV+K AKGF+GR KN  R A   +++S QYAYRDR+V+KRDFRSL
Sbjct: 1   MARVKRGVQVRQRHKKVIKQAKGFHGRSKNCYRIALRRLEKSWQYAYRDRKVRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS F+ GL  AGI ++RKVLS+LAI+Q  +F +IV+ +++ L
Sbjct: 61  WIQRINAAVRSFGLVYSVFMKGLKAAGIDVNRKVLSELAISQPSAFGEIVDKAKAAL 117


>gi|325962865|ref|YP_004240771.1| 50S ribosomal protein L20P [Arthrobacter phenanthrenivorans Sphe3]
 gi|323468952|gb|ADX72637.1| LSU ribosomal protein L20P [Arthrobacter phenanthrenivorans Sphe3]
          Length = 128

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 79/123 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ AKG+ G+R    R AK  +  S  Y+Y DR+ KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAKGYRGQRSRLYRKAKEQLLHSFVYSYGDRKKKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL  A + +DR++L++LA++  ++F  +V++++  L  D
Sbjct: 61  WIQRINAASRANGLTYNRLIQGLKAAEVEVDRRMLAELAVSDANAFAALVKVAKDSLPAD 120

Query: 121 VAS 123
            ++
Sbjct: 121 TSA 123


>gi|303325496|ref|ZP_07355939.1| ribosomal protein L20 [Desulfovibrio sp. 3_1_syn3]
 gi|302863412|gb|EFL86343.1| ribosomal protein L20 [Desulfovibrio sp. 3_1_syn3]
          Length = 117

 Score =  145 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 64/115 (55%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ S  +HKK L +AKGF G R    R A+ AV+RS QYA+  R+ +KRDFR+LWI
Sbjct: 2   RVKRGLASHRRHKKYLSAAKGFRGGRSRLYRTAREAVERSLQYAFVGRKNRKRDFRTLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R+  L+YS+F++GL  AGI L+RKVL+DLA+ Q D F K+VEL+++ L
Sbjct: 62  LRINAGARLSGLSYSRFMHGLKLAGIELNRKVLADLAVYQKDDFAKVVELAKAAL 116


>gi|269101071|ref|YP_003289219.1| 50S ribosomal protein L20 [Ectocarpus siliculosus]
 gi|266631579|emb|CAV31250.1| Chloroplast 50S ribosomal protein L20 [Ectocarpus siliculosus]
 gi|270118709|emb|CAT18788.1| Chloroplast 50S ribosomal protein L20 [Ectocarpus siliculosus]
          Length = 114

 Score =  145 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 74/114 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+  +  K+LK AKGF G   +  R A   V +S  YAY  R+ KKR FR L
Sbjct: 1   MVRVKRGNVARKRRNKILKLAKGFCGSHSSLFRIANQQVIKSLLYAYSGRKKKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAAV+ Y+L Y++FI+ L K+ I+L+RK+LS LAI    +F  +V  ++
Sbjct: 61  WITRINAAVKHYNLKYNEFIHNLKKSKIILNRKMLSQLAILDPPAFSALVFATK 114


>gi|258404184|ref|YP_003196926.1| 50S ribosomal protein L20 [Desulfohalobium retbaense DSM 5692]
 gi|257796411|gb|ACV67348.1| ribosomal protein L20 [Desulfohalobium retbaense DSM 5692]
          Length = 117

 Score =  145 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/114 (56%), Positives = 83/114 (72%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRGV +  +HKK LK AKGF G R    R A+ AV++S  YAYRDRR KKRDFR LWI
Sbjct: 2   RVKRGVTARRRHKKYLKMAKGFRGSRSRLYRTAREAVEKSLCYAYRDRRQKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           QRINAA R   ++YS+F++GL K+G+ L+RKVL+DLA+     F K+ EL++ +
Sbjct: 62  QRINAAARENGMSYSRFMSGLKKSGVELNRKVLADLAVKDKHGFSKVAELAKEK 115


>gi|121634520|ref|YP_974765.1| 50S ribosomal protein L20 [Neisseria meningitidis FAM18]
 gi|166219668|sp|A1KSY5|RL20_NEIMF RecName: Full=50S ribosomal protein L20
 gi|120866226|emb|CAM09966.1| putative 50S ribosomal protein L20 [Neisseria meningitidis FAM18]
 gi|325129872|gb|EGC52676.1| ribosomal protein L20 [Neisseria meningitidis OX99.30304]
 gi|325131824|gb|EGC54524.1| ribosomal protein L20 [Neisseria meningitidis M6190]
 gi|325137874|gb|EGC60449.1| ribosomal protein L20 [Neisseria meningitidis ES14902]
          Length = 119

 Score =  145 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/119 (54%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE ++S L  
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKAAFAQLVEKAKSALAA 119


>gi|289523101|ref|ZP_06439955.1| ribosomal protein L20 [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
 gi|289503644|gb|EFD24808.1| ribosomal protein L20 [Anaerobaculum hydrogeniformans ATCC
           BAA-1850]
          Length = 119

 Score =  145 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/118 (50%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G  +  K  K+ K  KG+YGRRKN  + A+ A+ RS  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKGGTATKNKRAKLFKLTKGYYGRRKNVFKRAREAMLRSLSYAYRDRRNRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA   VY +NYS FI+GL K+GI ++RK+L++LA++ +++F ++VE ++  L+
Sbjct: 61  WIMRINAGAHVYGMNYSTFISGLRKSGIEINRKMLAELAVSDIEAFGQLVEKAKEALV 118


>gi|317047871|ref|YP_004115519.1| 50S ribosomal protein L20 [Pantoea sp. At-9b]
 gi|316949488|gb|ADU68963.1| ribosomal protein L20 [Pantoea sp. At-9b]
          Length = 118

 Score =  145 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++S L 
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASIEIDRKILADIAVFDKVTFTALVEKAKSALA 118


>gi|297626568|ref|YP_003688331.1| 50S ribosomal protein L20 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296922333|emb|CBL56905.1| 50S ribosomal protein L20 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 123

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/123 (45%), Positives = 80/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +++L SA G+ G+R    R AK  V  S  Y++RDR+ +K DFRSL
Sbjct: 1   MARVKRAVNAHKKRREILDSASGYRGQRSRLYRKAKEQVLHSATYSFRDRKARKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FINGL  AG+  DRK+L+DLA+   D+F  +V++++      
Sbjct: 61  WIQRINAACRAEGMTYNRFINGLKNAGVGADRKMLADLAVFDSDAFAALVKVAKDNQPAA 120

Query: 121 VAS 123
            A+
Sbjct: 121 KAA 123


>gi|238922261|ref|YP_002935775.1| large subunit ribosomal protein L20 [Eubacterium eligens ATCC
           27750]
 gi|238873933|gb|ACR73641.1| large subunit ribosomal protein L20 [Eubacterium eligens ATCC
           27750]
          Length = 118

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 79/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y+ R+ KKR FR L
Sbjct: 1   MARIKGGLNAKKKHNRVLKLAKGYRGARSKQYRVAKQSVMRALTESYKGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  A I L+RKVLS++A+   + F K+ E+++S+L 
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLANIDLNRKVLSEMAVNDAEGFAKLAEVAKSKLA 118


>gi|226227282|ref|YP_002761388.1| 50S ribosomal protein L20 [Gemmatimonas aurantiaca T-27]
 gi|259646186|sp|C1A493|RL20_GEMAT RecName: Full=50S ribosomal protein L20
 gi|226090473|dbj|BAH38918.1| 50S ribosomal protein L20 [Gemmatimonas aurantiaca T-27]
          Length = 124

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/123 (52%), Positives = 87/123 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  VV   + K++LK AKG +G R    +AAK  V+R  +YAYRDR+ KKRDFR L
Sbjct: 1   MPRVKSNVVRLKRKKQILKHAKGAFGGRSKLWKAAKETVERGWRYAYRDRKNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R++D++Y+ FINGLH +GI +DRKVL+DLA+ + ++F  I E ++  L   
Sbjct: 61  WIVRINAAARLHDMSYNAFINGLHASGIEVDRKVLADLAVREPEAFAAIAEQAKKALDAK 120

Query: 121 VAS 123
           VA+
Sbjct: 121 VAA 123


>gi|251795322|ref|YP_003010053.1| ribosomal protein L20 [Paenibacillus sp. JDR-2]
 gi|247542948|gb|ACS99966.1| ribosomal protein L20 [Paenibacillus sp. JDR-2]
          Length = 119

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/119 (44%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V + + K++LK AKG++G +    + AK  V +S  YAYRDRR  KR+FR L
Sbjct: 1   MARVKGGFVRARRRKRILKLAKGYFGSKHRLFKTAKEQVGKSLLYAYRDRRQNKREFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+Y++F+ GL  AGI ++RK+L+DLA+  ++SF  +  +++ ++  
Sbjct: 61  WIVRINAAARQNGLSYNKFMYGLKLAGIEVNRKMLADLAVNDINSFNSLAGVAKEKINA 119


>gi|302386670|ref|YP_003822492.1| ribosomal protein L20 [Clostridium saccharolyticum WM1]
 gi|302197298|gb|ADL04869.1| ribosomal protein L20 [Clostridium saccharolyticum WM1]
          Length = 118

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 79/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGMNAKKKHNRVLKMAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  ++YS F++GL  AG+ L+RKVL+D+A+   + F K+ EL++S++ 
Sbjct: 61  WIARINAAARINGVSYSVFMHGLKLAGVDLNRKVLADMAVNDAEGFTKLAELAKSKVA 118


>gi|304404964|ref|ZP_07386624.1| ribosomal protein L20 [Paenibacillus curdlanolyticus YK9]
 gi|304345843|gb|EFM11677.1| ribosomal protein L20 [Paenibacillus curdlanolyticus YK9]
          Length = 119

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/119 (44%), Positives = 81/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V + + K++LK AKG++G +    + AK  V +S  YAYRDRR  KRDFR L
Sbjct: 1   MARVKGGFVRARRRKRILKLAKGYFGSKHRLFKTAKEQVMKSLLYAYRDRRQVKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+Y++F+ GL  AGI ++RK+L+DLA+  +++F  +  +++ ++  
Sbjct: 61  WIVRINAAARLNGLSYNKFMYGLKLAGIEVNRKILADLAVNDINAFNSLAGVAKQKINA 119


>gi|15676621|ref|NP_273765.1| 50S ribosomal protein L20 [Neisseria meningitidis MC58]
 gi|296314676|ref|ZP_06864617.1| ribosomal protein L20 [Neisseria polysaccharea ATCC 43768]
 gi|14195131|sp|Q9K093|RL20_NEIMB RecName: Full=50S ribosomal protein L20
 gi|7225950|gb|AAF41136.1| 50S ribosomal protein L20 [Neisseria meningitidis MC58]
 gi|296838505|gb|EFH22443.1| ribosomal protein L20 [Neisseria polysaccharea ATCC 43768]
 gi|316983704|gb|EFV62685.1| ribosomal protein L20 [Neisseria meningitidis H44/76]
 gi|325140122|gb|EGC62651.1| ribosomal protein L20 [Neisseria meningitidis CU385]
 gi|325141983|gb|EGC64420.1| ribosomal protein L20 [Neisseria meningitidis 961-5945]
 gi|325197942|gb|ADY93398.1| ribosomal protein L20 [Neisseria meningitidis G2136]
 gi|325200593|gb|ADY96048.1| ribosomal protein L20 [Neisseria meningitidis H44/76]
          Length = 119

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE +++ L  
Sbjct: 61  WIVRINAGTRENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKAAFAQLVEKAKAALAA 119


>gi|325919875|ref|ZP_08181865.1| LSU ribosomal protein L20P [Xanthomonas gardneri ATCC 19865]
 gi|325549659|gb|EGD20523.1| LSU ribosomal protein L20P [Xanthomonas gardneri ATCC 19865]
          Length = 119

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 62/119 (52%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+Y  R+   R AK AV ++QQYAY  R+ KKR FR+L
Sbjct: 1   MARVKRGVQARRRHKKILNLAKGYYNARRKVFRVAKQAVIKAQQYAYIGRKQKKRVFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+ KAGI LDRKVL+D+A+     F  + E ++  L  
Sbjct: 61  WITRINAAARINGLSYSRFMNGMLKAGITLDRKVLADIAVHDAAGFAALAEKAKGALAA 119


>gi|289427781|ref|ZP_06429492.1| ribosomal protein L20 [Propionibacterium acnes J165]
 gi|289159045|gb|EFD07238.1| ribosomal protein L20 [Propionibacterium acnes J165]
          Length = 123

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 83/123 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL  A G+ G+R    R AK     S  Y++RDRR KK DFRSL
Sbjct: 1   MARVKRSVNAKKKRREVLDQASGYRGQRSRLYRKAKEQTLHSATYSFRDRRAKKGDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++F+NGL  AG+ +DRK+L++LA++ +++F  +VE++++    +
Sbjct: 61  WIQRINAASRAQGMTYNRFVNGLKNAGVEVDRKMLAELAVSDINAFNSLVEVAKASQPQN 120

Query: 121 VAS 123
            A+
Sbjct: 121 AAA 123


>gi|172040801|ref|YP_001800515.1| 50S ribosomal protein L20 [Corynebacterium urealyticum DSM 7109]
 gi|226730380|sp|B1VH40|RL20_CORU7 RecName: Full=50S ribosomal protein L20
 gi|171852105|emb|CAQ05081.1| 50S ribosomal protein L20 [Corynebacterium urealyticum DSM 7109]
          Length = 127

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 81/123 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VL SAKG+ G+R    R AK  +  S+ YA+RDRR +K +FR L
Sbjct: 1   MARVKRSVNAKKKRREVLNSAKGYRGQRSRLYRKAKEQMLHSKTYAFRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R  D+ Y++ I GL  A I +DRKVL++LA++   +F  + E +++ L  D
Sbjct: 61  WIQRINAAARQNDMTYNRLIQGLKLAEIEVDRKVLAELAVSDAAAFTALCEAAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|226306780|ref|YP_002766740.1| 50S ribosomal protein L20 [Rhodococcus erythropolis PR4]
 gi|259646196|sp|C1A066|RL20_RHOE4 RecName: Full=50S ribosomal protein L20
 gi|226185897|dbj|BAH34001.1| 50S ribosomal protein L20 [Rhodococcus erythropolis PR4]
          Length = 129

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L ++ G+ G+R      AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAQKKRRSILAASSGYRGQRSRLYTKAKEQQLHSLTYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  A + +DRK+L++LA++  ++F  +V L+++ L  D
Sbjct: 61  WITRINAAARANDITYNRLIQGLRLAEVEVDRKILAELAVSDAEAFAGLVALAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|324998027|ref|ZP_08119139.1| 50S ribosomal protein L20 [Pseudonocardia sp. P1]
          Length = 127

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 76/121 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+SA G+ G+R    R AK  +  S  Y+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTTLESAAGYRGQRSRLYRKAKEQMLHSMTYSYRDRRQRKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++F+ GL  AG+ +DRK L+++A++   +F  +V++++  L   
Sbjct: 61  WITRINAAARANDMTYNRFVQGLKAAGVEVDRKNLAEIAVSDPAAFAALVKVAKENLPAG 120

Query: 121 V 121
            
Sbjct: 121 T 121


>gi|323484402|ref|ZP_08089768.1| 50S ribosomal protein L20 [Clostridium symbiosum WAL-14163]
 gi|323692413|ref|ZP_08106649.1| 50S ribosomal protein L20 [Clostridium symbiosum WAL-14673]
 gi|323402180|gb|EGA94512.1| 50S ribosomal protein L20 [Clostridium symbiosum WAL-14163]
 gi|323503553|gb|EGB19379.1| 50S ribosomal protein L20 [Clostridium symbiosum WAL-14673]
          Length = 118

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 80/118 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  +H +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARVKGGLNAKKRHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  AG+ ++RKVLSD+AI+  + F K+ EL++++L 
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLAGVEMNRKVLSDMAISDAEGFAKLAELAKAKLS 118


>gi|330994702|ref|ZP_08318625.1| 50S ribosomal protein L20 [Gluconacetobacter sp. SXCC-1]
 gi|329758343|gb|EGG74864.1| 50S ribosomal protein L20 [Gluconacetobacter sp. SXCC-1]
          Length = 115

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/114 (56%), Positives = 84/114 (73%)

Query: 5   KRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQR 64
           KRGV + A+HKKVL+ +KGF GR     R A   +++S QYAYRDRR KKR+FR+LWIQR
Sbjct: 2   KRGVTTHARHKKVLELSKGFRGRSSTNYRIALERLEKSLQYAYRDRRNKKREFRALWIQR 61

Query: 65  INAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           INAAVR + L YS+FINGL KAGI +DRKVL+ +A     +F +IV+ +++ L 
Sbjct: 62  INAAVREHGLTYSRFINGLDKAGIEIDRKVLAAIAYDDAATFAEIVKKAQAALA 115


>gi|157828789|ref|YP_001495031.1| 50S ribosomal protein L20 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933517|ref|YP_001650306.1| 50S ribosomal protein L20 [Rickettsia rickettsii str. Iowa]
 gi|166220739|sp|A8GSZ8|RL20_RICRS RecName: Full=50S ribosomal protein L20
 gi|189041879|sp|B0BUJ0|RL20_RICRO RecName: Full=50S ribosomal protein L20
 gi|157801270|gb|ABV76523.1| 50S ribosomal protein L20 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908604|gb|ABY72900.1| LSU ribosomal protein L20P [Rickettsia rickettsii str. Iowa]
          Length = 117

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 63/117 (53%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A   V+++ QYAYRDRR +KRDFR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIEKVEKALQYAYRDRRNRKRDFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L K  I +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVREHGLVYSQFMGALKKTEIAIDRKVLAELAVNNSDGFVSIVEKAKAHI 117


>gi|290890819|ref|ZP_06553886.1| hypothetical protein AWRIB429_1276 [Oenococcus oeni AWRIB429]
 gi|290479591|gb|EFD88248.1| hypothetical protein AWRIB429_1276 [Oenococcus oeni AWRIB429]
          Length = 196

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/117 (43%), Positives = 78/117 (66%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK   V+  + KK++K AKG+ G+R    + AK  V +S  YAYRDR+  KRD+R LWI
Sbjct: 2   RVKGTNVTRIRRKKMIKLAKGYRGQRHINFKVAKQQVWKSYLYAYRDRKNVKRDYRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
            RINAA R+  ++YSQ ++G   AGI L+RK+L++LA++   +F K+ E ++ ++  
Sbjct: 62  ARINAASRMNGISYSQLMHGFKVAGIDLNRKMLAELAVSDFATFSKLAETAKKQVSA 118


>gi|209695236|ref|YP_002263165.1| 50S ribosomal protein L20 [Aliivibrio salmonicida LFI1238]
 gi|226730347|sp|B6EN31|RL20_ALISL RecName: Full=50S ribosomal protein L20
 gi|208009188|emb|CAQ79442.1| 50S ribosomal protein L20 [Aliivibrio salmonicida LFI1238]
          Length = 117

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/106 (60%), Positives = 77/106 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR KKR FR L
Sbjct: 1   MPRVKRGVQARARHKKVLKQAKGYYGARSRVYRVAFQAVTKAGQYAYRDRRNKKRVFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVAF 106


>gi|312195569|ref|YP_004015630.1| ribosomal protein L20 [Frankia sp. EuI1c]
 gi|311226905|gb|ADP79760.1| ribosomal protein L20 [Frankia sp. EuI1c]
          Length = 127

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 75/118 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  +  S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTTLEQASGYRGQRSRLYRKAKEQMLHSMNYAYRDRRARKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   + Y++FI GL  AG+ +DRK+L+DLA+    +F  +VE++R+ + 
Sbjct: 61  WITRINAAARANGMTYNRFIQGLKVAGVEVDRKILADLAVNDAAAFTALVEVARAAVP 118


>gi|59800746|ref|YP_207458.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA 1090]
 gi|161869665|ref|YP_001598832.1| 50S ribosomal protein L20 [Neisseria meningitidis 053442]
 gi|194098023|ref|YP_002001071.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae NCCP11945]
 gi|218767845|ref|YP_002342357.1| 50S ribosomal protein L20 [Neisseria meningitidis Z2491]
 gi|239998487|ref|ZP_04718411.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 35/02]
 gi|240013612|ref|ZP_04720525.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae DGI18]
 gi|240016051|ref|ZP_04722591.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA6140]
 gi|240080193|ref|ZP_04724736.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA19]
 gi|240112406|ref|ZP_04726896.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae MS11]
 gi|240115146|ref|ZP_04729208.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID18]
 gi|240117430|ref|ZP_04731492.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID1]
 gi|240120682|ref|ZP_04733644.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID24-1]
 gi|240122986|ref|ZP_04735942.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID332]
 gi|240125238|ref|ZP_04738124.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-92-679]
 gi|240127692|ref|ZP_04740353.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-93-1035]
 gi|254493206|ref|ZP_05106377.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 1291]
 gi|254804604|ref|YP_003082825.1| 50S ribosomal protein L20 [Neisseria meningitidis alpha14]
 gi|255066460|ref|ZP_05318315.1| ribosomal protein L20 [Neisseria sicca ATCC 29256]
 gi|260441036|ref|ZP_05794852.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae DGI2]
 gi|261365584|ref|ZP_05978467.1| ribosomal protein L20 [Neisseria mucosa ATCC 25996]
 gi|268594346|ref|ZP_06128513.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 35/02]
 gi|268596342|ref|ZP_06130509.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA19]
 gi|268598469|ref|ZP_06132636.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae MS11]
 gi|268600822|ref|ZP_06134989.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID18]
 gi|268603127|ref|ZP_06137294.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID1]
 gi|268681608|ref|ZP_06148470.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID332]
 gi|268683836|ref|ZP_06150698.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-92-679]
 gi|268686077|ref|ZP_06152939.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-93-1035]
 gi|291044368|ref|ZP_06570077.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae DGI2]
 gi|293399554|ref|ZP_06643707.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae F62]
 gi|294670483|ref|ZP_06735363.1| hypothetical protein NEIELOOT_02201 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|304387975|ref|ZP_07370147.1| 50S ribosomal protein L20 [Neisseria meningitidis ATCC 13091]
 gi|14195130|sp|Q9JVA1|RL20_NEIMA RecName: Full=50S ribosomal protein L20
 gi|81311240|sp|Q5F9U1|RL20_NEIG1 RecName: Full=50S ribosomal protein L20
 gi|189041872|sp|A9M378|RL20_NEIM0 RecName: Full=50S ribosomal protein L20
 gi|226730427|sp|B4RJY6|RL20_NEIG2 RecName: Full=50S ribosomal protein L20
 gi|59717641|gb|AAW89046.1| putative 50S ribosomal protein L20 [Neisseria gonorrhoeae FA 1090]
 gi|121051853|emb|CAM08159.1| putative 50S ribosomal protein L20 [Neisseria meningitidis Z2491]
 gi|161595218|gb|ABX72878.1| 50S ribosomal protein L20 [Neisseria meningitidis 053442]
 gi|193933313|gb|ACF29137.1| putative 50S ribosomal protein L20 [Neisseria gonorrhoeae
           NCCP11945]
 gi|226512246|gb|EEH61591.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 1291]
 gi|254668146|emb|CBA04777.1| 50S ribosomal protein L20 [Neisseria meningitidis alpha14]
 gi|254671881|emb|CBA04129.1| 50S ribosomal protein L20 [Neisseria meningitidis alpha275]
 gi|255049340|gb|EET44804.1| ribosomal protein L20 [Neisseria sicca ATCC 29256]
 gi|261392908|emb|CAX50489.1| 50S ribosomal protein L20 [Neisseria meningitidis 8013]
 gi|268547735|gb|EEZ43153.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae 35/02]
 gi|268550130|gb|EEZ45149.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae FA19]
 gi|268582600|gb|EEZ47276.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae MS11]
 gi|268584953|gb|EEZ49629.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID18]
 gi|268587258|gb|EEZ51934.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID1]
 gi|268621892|gb|EEZ54292.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae PID332]
 gi|268624120|gb|EEZ56520.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-92-679]
 gi|268626361|gb|EEZ58761.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae SK-93-1035]
 gi|288565908|gb|EFC87468.1| ribosomal protein L20 [Neisseria mucosa ATCC 25996]
 gi|291011262|gb|EFE03258.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae DGI2]
 gi|291307762|gb|EFE49005.1| hypothetical protein NEIELOOT_02201 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291610123|gb|EFF39245.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae F62]
 gi|304337974|gb|EFM04112.1| 50S ribosomal protein L20 [Neisseria meningitidis ATCC 13091]
 gi|308388912|gb|ADO31232.1| putative 50S ribosomal protein L20 [Neisseria meningitidis
           alpha710]
 gi|317163765|gb|ADV07306.1| 50S ribosomal protein L20 [Neisseria gonorrhoeae TCDC-NG08107]
 gi|319410092|emb|CBY90428.1| 50S ribosomal protein L20 [Neisseria meningitidis WUE 2594]
 gi|325127771|gb|EGC50679.1| ribosomal protein L20 [Neisseria meningitidis N1568]
 gi|325133763|gb|EGC56419.1| ribosomal protein L20 [Neisseria meningitidis M13399]
 gi|325136054|gb|EGC58664.1| ribosomal protein L20 [Neisseria meningitidis M0579]
 gi|325144074|gb|EGC66382.1| ribosomal protein L20 [Neisseria meningitidis M01-240013]
 gi|325202481|gb|ADY97935.1| ribosomal protein L20 [Neisseria meningitidis M01-240149]
 gi|325203810|gb|ADY99263.1| ribosomal protein L20 [Neisseria meningitidis M01-240355]
 gi|325206435|gb|ADZ01888.1| ribosomal protein L20 [Neisseria meningitidis M04-240196]
 gi|325207767|gb|ADZ03219.1| ribosomal protein L20 [Neisseria meningitidis NZ-05/33]
          Length = 119

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/119 (53%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+K+   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKIFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE +++ L  
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRASIEIDRKVLADLAVFDKAAFAQLVEKAKAALAA 119


>gi|283794891|ref|YP_003359244.1| ribosomal protein L20 [Cryptomonas paramecium]
 gi|253981863|gb|ACT46780.1| ribosomal protein L20 [Cryptomonas paramecium]
          Length = 115

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/114 (44%), Positives = 72/114 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR KRG ++  + K +L +AKGF G      R A   V +S QY+Y  R+ +KR+FRSL
Sbjct: 1   MTRTKRGNIARKRRKSILTAAKGFRGSHSKLFRIANQQVMKSLQYSYIGRKRRKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAAVR + L YS FI+ L    I L+RK+L  +AI   + F K++ +++
Sbjct: 61  WITRINAAVRNHGLTYSSFISELKNHNIGLNRKMLCQMAIKDSEGFNKLIHITK 114


>gi|84496736|ref|ZP_00995590.1| 50S ribosomal protein L20 [Janibacter sp. HTCC2649]
 gi|84383504|gb|EAP99385.1| 50S ribosomal protein L20 [Janibacter sp. HTCC2649]
          Length = 128

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/120 (44%), Positives = 75/120 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRVVLERASGYRGQRSRLYRKAKEQVTHSLGYAYRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  A I +DR++L++LA+    +F  +VE++++ +   
Sbjct: 61  WIQRINAAARANGMTYNRLIQGLKVAEIEVDRRMLAELAVNDAAAFTALVEIAKANVPAQ 120


>gi|255035017|ref|YP_003085638.1| 50S ribosomal protein L20 [Dyadobacter fermentans DSM 18053]
 gi|254947773|gb|ACT92473.1| ribosomal protein L20 [Dyadobacter fermentans DSM 18053]
          Length = 114

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 78/114 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK AKG++GRRKN    AK AV+R   YAY  R+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKVLKLAKGYFGRRKNVWTVAKNAVERGLAYAYEGRKQKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R + L+YS FI  L+  GI L+RKVL+DLA+   D+FK IV+  +
Sbjct: 61  WIQRINAGTRQHGLSYSAFIGKLNAKGIELNRKVLADLAMNHPDAFKAIVDQVK 114


>gi|225574526|ref|ZP_03783136.1| hypothetical protein RUMHYD_02603 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038257|gb|EEG48503.1| hypothetical protein RUMHYD_02603 [Blautia hydrogenotrophica DSM
           10507]
          Length = 118

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/118 (40%), Positives = 76/118 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH + LK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKKHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  A + ++RK+L+++A+   + FK + E+++ +L 
Sbjct: 61  WIARINAAARMNGLSYSRFMYGLKLAEVNMNRKMLAEMAVNDPEGFKTLAEVAKGKLA 118


>gi|158523051|ref|YP_001530921.1| ribosomal protein L20 [Desulfococcus oleovorans Hxd3]
 gi|215274796|sp|A8ZZ71|RL20_DESOH RecName: Full=50S ribosomal protein L20
 gi|158511877|gb|ABW68844.1| ribosomal protein L20 [Desulfococcus oleovorans Hxd3]
          Length = 116

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 59/111 (53%), Positives = 81/111 (72%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+KRG  +  + KK+LK AKGF G      + AK  VD++  YAYRDR+ +KRDFR LWI
Sbjct: 2   RIKRGFKARHRRKKILKLAKGFRGGHSKLFKTAKNTVDKALGYAYRDRKQRKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
            RINAAVR++ L+YS+F++GL KAG+ LDRKVL++LAI+    F K+V ++
Sbjct: 62  ARINAAVRMHSLSYSRFMHGLKKAGVELDRKVLAELAISDPSGFSKVVAVA 112


>gi|312877040|ref|ZP_07737013.1| ribosomal protein L20 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796181|gb|EFR12537.1| ribosomal protein L20 [Caldicellulosiruptor lactoaceticus 6A]
          Length = 119

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 59/118 (50%), Positives = 82/118 (69%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+K  V +  +HKK LK AKG++G +    + A  AV RS +YAY  RR+KKRDFR LWI
Sbjct: 2   RIKNSVWARKRHKKWLKLAKGYFGAKSKIFKQAHVAVMRSLRYAYIGRRLKKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R   L+YS+FINGL KAGI L+RKVL+D+A+    +F ++VE+++ ++   
Sbjct: 62  TRINAAARQNGLSYSKFINGLKKAGISLNRKVLADMAVNDQKAFAELVEIAKKQINAQ 119


>gi|229492677|ref|ZP_04386478.1| ribosomal protein L20 [Rhodococcus erythropolis SK121]
 gi|229320336|gb|EEN86156.1| ribosomal protein L20 [Rhodococcus erythropolis SK121]
          Length = 129

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/123 (41%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L ++ G+ G+R      AK     S  YAYRDRR +K +FR L
Sbjct: 1   MARVKRAVNAQKKRRSILAASSGYRGQRSRLYTKAKEQQLHSLTYAYRDRRARKGEFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  A + +DRK+L++LA++  ++F  +V L+++ L  D
Sbjct: 61  WITRINAAARANDITYNRLIQGLRLAEVDVDRKILAELAVSDAEAFAGLVALAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|111017975|ref|YP_700947.1| 50S ribosomal protein L20 [Rhodococcus jostii RHA1]
 gi|226360106|ref|YP_002777884.1| 50S ribosomal protein L20 [Rhodococcus opacus B4]
 gi|123046652|sp|Q0SI47|RL20_RHOSR RecName: Full=50S ribosomal protein L20
 gi|254800335|sp|C1AT07|RL20_RHOOB RecName: Full=50S ribosomal protein L20
 gi|110817505|gb|ABG92789.1| 50S ribosomal protein L20 [Rhodococcus jostii RHA1]
 gi|226238591|dbj|BAH48939.1| 50S ribosomal protein L20 [Rhodococcus opacus B4]
          Length = 129

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/123 (43%), Positives = 77/123 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+++ G+ G+R    R AK     S  YAYRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSILEASSGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  A I +DRK L++LA++   +F  +V L+++ L  D
Sbjct: 61  WITRINAAARANDITYNRLIQGLRLAEIEVDRKNLAELAVSDAAAFAGLVALAKAALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|84514588|ref|ZP_01001952.1| 50S ribosomal protein L20 [Loktanella vestfoldensis SKA53]
 gi|84511639|gb|EAQ08092.1| 50S ribosomal protein L20 [Loktanella vestfoldensis SKA53]
          Length = 119

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 87/118 (73%), Gaps = 2/118 (1%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVL +AKG+Y RR  T + AK AVD++ QYA RDR  +KR+FR+LWI
Sbjct: 2   RVKGGTVTHRRHKKVLDAAKGYYDRRSKTFKVAKQAVDKANQYATRDRHNRKRNFRALWI 61

Query: 63  QRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           QRINA VR  D  LNYS+FINGL  AGI +DRKVL+DLA+ + ++F  IV  +++ + 
Sbjct: 62  QRINAGVRSVDETLNYSKFINGLALAGIEVDRKVLADLAVNEPEAFATIVGQAKAAMA 119


>gi|260589749|ref|ZP_05855662.1| ribosomal protein L20 [Blautia hansenii DSM 20583]
 gi|331083180|ref|ZP_08332296.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|260539989|gb|EEX20558.1| ribosomal protein L20 [Blautia hansenii DSM 20583]
 gi|330404569|gb|EGG84109.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 118

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 76/118 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  +H +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKRHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  A + L+RKVL+D+AI     F  + EL++S+L 
Sbjct: 61  WIARINAAARMNGLSYSKFMYGLKLANVDLNRKVLADMAINDAAGFATLAELAKSKLA 118


>gi|187931724|ref|YP_001891709.1| 50S ribosomal protein L20 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|226730402|sp|B2SGS0|RL20_FRATM RecName: Full=50S ribosomal protein L20
 gi|187712633|gb|ACD30930.1| 50S ribosomal protein L20 [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 121

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 83/106 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KAG+ LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKAGVELDRKALAELAVYNKDAF 106


>gi|282881466|ref|ZP_06290140.1| putative ribosomal protein L20 [Prevotella timonensis CRIS 5C-B1]
 gi|281304692|gb|EFA96778.1| putative ribosomal protein L20 [Prevotella timonensis CRIS 5C-B1]
          Length = 114

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 77/114 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG++G RKN    AK   ++   YAYRDRR KKR+FRSL
Sbjct: 1   MPRSVNHVASKAKRTRILKQTKGYFGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+  ++YS  +  L+KAGI ++RKVL+DLA+   ++FK IV+  +
Sbjct: 61  WIQRINAAARLEGMSYSVLMGALNKAGIEINRKVLADLAVNNPEAFKAIVDKVK 114


>gi|227530474|ref|ZP_03960523.1| ribosomal protein L20 [Lactobacillus vaginalis ATCC 49540]
 gi|227349579|gb|EEJ39870.1| ribosomal protein L20 [Lactobacillus vaginalis ATCC 49540]
          Length = 117

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 80/115 (69%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ K+++K AKG+ G +    + AK  V +S  YA+RDR+V KR FR LWI
Sbjct: 2   RVKGGTVTRARRKRIMKLAKGYRGSKHRLFKTAKDQVMKSYTYAFRDRKVNKRKFRELWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D++YS+ ++GL  A I ++RK+L+DLA+   ++FK IV+ ++  L
Sbjct: 62  ARINAAARMNDISYSKLMHGLKLANIDINRKMLADLAVNDAEAFKAIVDEAKKAL 116


>gi|226941670|ref|YP_002796744.1| 50S ribosomal protein L20 [Laribacter hongkongensis HLHK9]
 gi|254800326|sp|C1DDA3|RL20_LARHH RecName: Full=50S ribosomal protein L20
 gi|226716597|gb|ACO75735.1| RplT [Laribacter hongkongensis HLHK9]
          Length = 119

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 69/119 (57%), Positives = 87/119 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHKKVLALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+F+NGL KA I +DRKVL+DLA+ +   F ++VE +++ L  
Sbjct: 61  WIARINAAARECGLSYSKFMNGLKKASIEIDRKVLADLAVFEKAVFAQLVEKAKASLAA 119


>gi|255579823|ref|XP_002530749.1| 50S ribosomal protein L20, putative [Ricinus communis]
 gi|223529713|gb|EEF31655.1| 50S ribosomal protein L20, putative [Ricinus communis]
          Length = 224

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 56/102 (54%), Positives = 76/102 (74%)

Query: 14  HKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYD 73
            K++ K AKGF GR KN IR A+  V+++ QY+YRDRR KKRD RSLWIQRINA  R + 
Sbjct: 3   KKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHG 62

Query: 74  LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           +NY  F++GL K  I L+RKVLS+L++ +  SFK +V++SR+
Sbjct: 63  VNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRN 104


>gi|329296186|ref|ZP_08253522.1| 50S ribosomal protein L20 [Plautia stali symbiont]
          Length = 118

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++S L 
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASIEIDRKILADIAVFDKVAFTALVEKAKSALA 118


>gi|268608875|ref|ZP_06142602.1| 50S ribosomal protein L20 [Ruminococcus flavefaciens FD-1]
          Length = 117

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/117 (46%), Positives = 77/117 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K  +++  +  K LK AKG++G +    + AK AV +S QYAY  R+ KKR FR L
Sbjct: 1   MARIKGAMMTRKRRNKTLKLAKGYWGAKSKHFKMAKQAVMKSGQYAYIGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RI+AA ++  +NYS F+NG  KAGI L+RK+LS++AI     F  IVE +++ L
Sbjct: 61  WIARISAAAKLNGMNYSTFMNGCKKAGISLNRKMLSEIAINDAAGFTAIVEKAKAAL 117


>gi|210623618|ref|ZP_03293944.1| hypothetical protein CLOHIR_01894 [Clostridium hiranonis DSM 13275]
 gi|210153488|gb|EEA84494.1| hypothetical protein CLOHIR_01894 [Clostridium hiranonis DSM 13275]
          Length = 118

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK+G+ +  KHKKVLK AKGF G R    R A A V ++ + AY  R++KKRD+R L
Sbjct: 1   MARVKKGMNARKKHKKVLKLAKGFRGSRSKLFRPANAFVMKALRNAYIGRKLKKRDYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAA R+  ++YS+ +NGL  AG+ ++RK+LS++AI     F K+VE+++++L 
Sbjct: 61  WIQRINAAARMNGISYSRLMNGLKLAGVEVNRKMLSEMAIADPAGFAKLVEVAKAKLA 118


>gi|220903765|ref|YP_002479077.1| 50S ribosomal protein L20 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254800317|sp|B8J4E1|RL20_DESDA RecName: Full=50S ribosomal protein L20
 gi|219868064|gb|ACL48399.1| ribosomal protein L20 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 118

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 62/115 (53%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+    +HKK L +AKGF G R    R A+ AV+RS QYAY  R+++KRDFR+LWI
Sbjct: 2   RVKRGLSGHRRHKKYLTAAKGFRGGRSRLYRTAREAVERSLQYAYVGRKLRKRDFRTLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R+  L+YS+F++GL  AGI L+RKVL+DLA+ + D F KIV+++++ L
Sbjct: 62  LRINAGARLSGLSYSRFMHGLKLAGIELNRKVLADLAVYKKDDFAKIVDMAKAAL 116


>gi|60117172|ref|YP_209506.1| ribosomal protein L20 [Huperzia lucidula]
 gi|68053059|sp|Q5SD32|RK20_HUPLU RecName: Full=50S ribosomal protein L20, chloroplastic
 gi|50659980|gb|AAT80702.1| ribosomal protein L20 [Huperzia lucidula]
          Length = 136

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 68/112 (60%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  + K +LK A GF G      R     + ++   +YRDR  +KRDFR L
Sbjct: 1   MTRVKRGSVARKRRKNILKLASGFQGAHSTIFRTGNQQIIKALASSYRDRGKRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVEL 112
           WI RINAA R   ++Y++FI  L+K  +  +RKVL+ +AI   +SF  I++ 
Sbjct: 61  WITRINAAARNNGVSYTKFIRHLYKNQVSSNRKVLAQIAIFDTNSFSTILKK 112


>gi|269978177|ref|ZP_06185127.1| ribosomal protein L20 [Mobiluncus mulieris 28-1]
 gi|307701005|ref|ZP_07638030.1| ribosomal protein L20 [Mobiluncus mulieris FB024-16]
 gi|269933686|gb|EEZ90270.1| ribosomal protein L20 [Mobiluncus mulieris 28-1]
 gi|307614000|gb|EFN93244.1| ribosomal protein L20 [Mobiluncus mulieris FB024-16]
          Length = 126

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 76/122 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  Y YRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTTLERASGYRGQRSRLYRKAKEQVTHSFVYNYRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R   + Y++FI GL  A + +DR++L++LA++ + +F  +V++++  L  D
Sbjct: 61  WIARINAACRAEGMTYNRFIQGLRLAEVEVDRRMLAELAVSDITAFNALVKVAKDALPKD 120

Query: 121 VA 122
           V 
Sbjct: 121 VN 122


>gi|254491408|ref|ZP_05104587.1| ribosomal protein L20 [Methylophaga thiooxidans DMS010]
 gi|224462886|gb|EEF79156.1| ribosomal protein L20 [Methylophaga thiooxydans DMS010]
          Length = 119

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/102 (62%), Positives = 78/102 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+YGRRKN  R A  AV ++ QYAYRDRR KKR+FR+L
Sbjct: 1   MPRVKRGVTAHARHKKVLDQAKGYYGRRKNVYRVAVQAVTKAGQYAYRDRRQKKRNFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R   L+YS+ I+GL KA I +DRKVL+D+A+  
Sbjct: 61  WIARINAAARECGLSYSRLIDGLKKASIEIDRKVLADIAVHD 102


>gi|323704473|ref|ZP_08116051.1| ribosomal protein L20 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535935|gb|EGB25708.1| ribosomal protein L20 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 119

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 83/119 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+  +HKK+LK AKG+YG +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MSRVKSGKVTRKRHKKILKLAKGYYGAKSKLFRVANQAVMKSLNYAYIGRKLRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   ++YS+FINGL KA I ++RK+LS++AI    +F ++V +++ +L  
Sbjct: 61  WIARINAAARANGISYSRFINGLKKANIEINRKMLSEMAIHDNKAFAELVNIAKQQLNA 119


>gi|170749558|ref|YP_001755818.1| ribosomal protein L20 [Methylobacterium radiotolerans JCM 2831]
 gi|226730420|sp|B1M6P4|RL20_METRJ RecName: Full=50S ribosomal protein L20
 gi|170656080|gb|ACB25135.1| ribosomal protein L20 [Methylobacterium radiotolerans JCM 2831]
          Length = 125

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 79/122 (64%), Positives = 98/122 (80%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV S AKHKKVLK+AKG+YGRRKNTIR AK AV++  QYAYRDR+ KKR FR+L
Sbjct: 1   MARVKRGVTSHAKHKKVLKAAKGYYGRRKNTIRIAKQAVEKGMQYAYRDRKNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQR+NAAVR + L YS+FI+GL K+GIV+DRK LS+LAI +  SF  +VE +++ L  +
Sbjct: 61  WIQRLNAAVREHGLTYSRFIDGLAKSGIVVDRKALSELAIHEPASFAAVVEKAKAALPQN 120

Query: 121 VA 122
            A
Sbjct: 121 TA 122


>gi|320528353|ref|ZP_08029515.1| ribosomal protein L20 [Solobacterium moorei F0204]
 gi|320131267|gb|EFW23835.1| ribosomal protein L20 [Solobacterium moorei F0204]
          Length = 118

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/116 (46%), Positives = 75/116 (64%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK    +  + KKVLK AKG++G +    R A   V RS +YAY  RR  KR+ R LWI
Sbjct: 2   RVKGSTPTRNRRKKVLKLAKGYFGSKHLLYRTAHEQVMRSLRYAYIGRRQTKREMRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
            RINAA R YDL+YSQF++GL  A I ++RK+LS++AI     F+ +V+ ++  L+
Sbjct: 62  ARINAATRQYDLSYSQFMHGLKLAEINVNRKMLSEIAIHDEKGFEALVDAAKKALV 117


>gi|157163866|ref|YP_001465938.1| 50S ribosomal protein L20 [Campylobacter concisus 13826]
 gi|166219623|sp|A7ZAY0|RL20_CAMC1 RecName: Full=50S ribosomal protein L20
 gi|112801829|gb|EAT99173.1| ribosomal protein L20 [Campylobacter concisus 13826]
          Length = 118

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 83/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GF+  R    R AK  ++RS  YAYRDRR KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFFSARHKHFRKAKEQLERSLVYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D++YS+FINGL+KA I LDRK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIVRINAACRLNDISYSRFINGLNKANIELDRKILADLAMNDAKAFAALAKQAKDAL 117


>gi|15807000|ref|NP_295727.1| 50S ribosomal protein L20 [Deinococcus radiodurans R1]
 gi|14195154|sp|Q9RSW7|RL20_DEIRA RecName: Full=50S ribosomal protein L20
 gi|28948934|pdb|1NKW|O Chain O, Crystal Structure Of The Large Ribosomal Subunit From
           Deinococcus Radiodurans
 gi|29726802|pdb|1NWX|O Chain O, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Abt-773
 gi|29726833|pdb|1NWY|O Chain O, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Azithromycin
 gi|51247387|pdb|1SM1|O Chain O, Complex Of The Large Ribosomal Subunit From Deinococcus
           Radiodurans With Quinupristin And Dalfopristin
 gi|61680350|pdb|1XBP|O Chain O, Inhibition Of Peptide Bond Formation By Pleuromutilins:
           The Structure Of The 50s Ribosomal Subunit From
           Deinococcus Radiodurans In Complex With Tiamulin
 gi|66361042|pdb|1YL3|1 Chain 1, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. Large Subunit. The Coordinates For The Small
           Subunit Are In The Pdb Entry 1yl4.
 gi|88192277|pdb|2B66|U Chain U, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf1, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400
 gi|88192340|pdb|2B9N|U Chain U, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf2, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400.
 gi|88192395|pdb|2B9P|U Chain U, 50s Ribosomal Subunit From A Crystal Structure Of The
           Ribosome In Complex With Trnas And Mrna With A Stop
           Codon In The A-Site. This File Contains The 50s Subunit
           From A Crystal Structure Of The Ribosome In Complex With
           Trnas And Mrna With A Stop Codon In The A-Site And Is
           Described In Remark 400.
 gi|190613503|pdb|2ZJP|N Chain N, Thiopeptide Antibiotic Nosiheptide Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 gi|190613533|pdb|2ZJQ|N Chain N, Interaction Of L7 With L11 Induced By Microccocin Binding
           To The Deinococcus Radiodurans 50s Subunit
 gi|190613564|pdb|2ZJR|N Chain N, Refined Native Structure Of The Large Ribosomal Subunit
           (50s) From Deinococcus Radiodurans
 gi|190613671|pdb|3CF5|N Chain N, Thiopeptide Antibiotic Thiostrepton Bound To The Large
           Ribosomal Subunit Of Deinococcus Radiodurans
 gi|203282470|pdb|3DLL|N Chain N, The Oxazolidinone Antibiotics Perturb The Ribosomal
           Peptidyl-Transferase Center And Effect Trna Positioning
 gi|323714554|pdb|3PIO|N Chain N, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
 gi|323714584|pdb|3PIP|N Chain N, Crystal Structure Of The Synergistic Antibiotic Pair
           Lankamycin And Lankacidin In Complex With The Large
           Ribosomal Subunit
 gi|6459792|gb|AAF11553.1|AE002038_2 ribosomal protein L20 [Deinococcus radiodurans R1]
          Length = 118

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 80/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G+V   +HKKVLK AKGF+G R    R A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MPRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WIQRINA  R++ +NYS FINGL +A I L+RKVL+D+A  + ++FK +V+ SR+ 
Sbjct: 61  WIQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAREPEAFKALVDASRNA 116


>gi|313884938|ref|ZP_07818690.1| ribosomal protein L20 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619629|gb|EFR31066.1| ribosomal protein L20 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 118

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 52/116 (44%), Positives = 81/116 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+ +K AKG+YG +  + + AK  V +S+ YA+RDR+  KR+FR L
Sbjct: 1   MARVKGGYVTRQRRKRTIKLAKGYYGAKSISFKMAKQQVMKSRMYAFRDRKQTKRNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R + ++YS  +NGL KAGI ++RK+L+DLA+    +F+ +V+ +++ 
Sbjct: 61  WITRINAAARQHGVSYSVLMNGLKKAGIEMNRKMLADLAVNDAKAFEALVDQAKAA 116


>gi|254446938|ref|ZP_05060405.1| ribosomal protein L20 [gamma proteobacterium HTCC5015]
 gi|198263077|gb|EDY87355.1| ribosomal protein L20 [gamma proteobacterium HTCC5015]
          Length = 119

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QY+YRDRR +KR FR L
Sbjct: 1   MARVKRGVTARARHKKVLAKAKGYYGARSRVYRVAKQAVIKAGQYSYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YSQF+NGL KA I LDRKVL+DLA+    +F ++VE ++S L  
Sbjct: 61  WIVRINAGARSNGLSYSQFMNGLKKAEIALDRKVLADLAVNDKATFTQLVEKAKSSLAA 119


>gi|24112888|ref|NP_707398.1| 50S ribosomal protein L20 [Shigella flexneri 2a str. 301]
 gi|30063017|ref|NP_837188.1| 50S ribosomal protein L20 [Shigella flexneri 2a str. 2457T]
 gi|110805474|ref|YP_688994.1| 50S ribosomal protein L20 [Shigella flexneri 5 str. 8401]
 gi|39931919|sp|Q83RG1|RL20_SHIFL RecName: Full=50S ribosomal protein L20
 gi|123147025|sp|Q0T4S6|RL20_SHIF8 RecName: Full=50S ribosomal protein L20
 gi|24051832|gb|AAN43105.1| 50S ribosomal subunit protein L20/regulator [Shigella flexneri 2a
           str. 301]
 gi|30041266|gb|AAP16995.1| 50S ribosomal subunit protein L20/regulator [Shigella flexneri 2a
           str. 2457T]
 gi|110615022|gb|ABF03689.1| 50S ribosomal subunit protein L20, and regulator [Shigella flexneri
           5 str. 8401]
 gi|281600920|gb|ADA73904.1| 50S ribosomal protein L20 [Shigella flexneri 2002017]
 gi|313649263|gb|EFS13697.1| ribosomal protein L20 [Shigella flexneri 2a str. 2457T]
 gi|332758692|gb|EGJ89011.1| ribosomal protein L20 [Shigella flexneri 2747-71]
 gi|332759230|gb|EGJ89539.1| ribosomal protein L20 [Shigella flexneri K-671]
 gi|332762544|gb|EGJ92809.1| ribosomal protein L20 [Shigella flexneri 4343-70]
 gi|332767221|gb|EGJ97416.1| ribosomal protein L20 [Shigella flexneri 2930-71]
 gi|333004213|gb|EGK23744.1| ribosomal protein L20 [Shigella flexneri K-218]
 gi|333018244|gb|EGK37546.1| ribosomal protein L20 [Shigella flexneri K-304]
          Length = 118

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTTLVEKAKAALA 118


>gi|117928474|ref|YP_873025.1| 50S ribosomal protein L20 [Acidothermus cellulolyticus 11B]
 gi|166219598|sp|A0LUC9|RL20_ACIC1 RecName: Full=50S ribosomal protein L20
 gi|117648937|gb|ABK53039.1| LSU ribosomal protein L20P [Acidothermus cellulolyticus 11B]
          Length = 124

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 74/119 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  V  S  Y+YRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRVILEQASGYRGQRSRLYRKAKEQVLHSMAYSYRDRKARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAA R   + Y++ I GL  AG+ +DRK+L+DLA+    +F  +V  +R  L V
Sbjct: 61  WIQRINAAARAQGITYNRLIQGLKLAGVDVDRKMLADLAVRDEATFAALVGTARDALSV 119


>gi|312898391|ref|ZP_07757781.1| ribosomal protein L20 [Megasphaera micronuciformis F0359]
 gi|310620310|gb|EFQ03880.1| ribosomal protein L20 [Megasphaera micronuciformis F0359]
          Length = 116

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 84/116 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K GV + A+HKK++K AKG+ G R    + A  +V ++  YA RDRR KKR+FR L
Sbjct: 1   MARIKVGVTAHARHKKIIKMAKGYRGTRSRLFKKANESVMKALFYARRDRRQKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   ++YS+FINGL KAG+ ++RK+L+DLA+    +F K+VE+++++
Sbjct: 61  WIARINAATRANGMSYSRFINGLTKAGVEVNRKMLADLAVNDAAAFAKLVEVAKAQ 116


>gi|312868751|ref|ZP_07728943.1| ribosomal protein L20 [Lactobacillus oris PB013-T2-3]
 gi|311095737|gb|EFQ53989.1| ribosomal protein L20 [Lactobacillus oris PB013-T2-3]
          Length = 117

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 77/115 (66%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ K+V+K AKG+ G +    + AK  V +S  YA+RDR+V KR FR LWI
Sbjct: 2   RVKGGTVTRARRKRVMKLAKGYRGAKSRLFKTAKDQVMKSYVYAFRDRKVNKRKFRELWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ +++YS+ ++GL  A I ++RK+L+DLA+    +F  I + ++  L
Sbjct: 62  ARINAAARMNNISYSKLMHGLKLANIDINRKMLADLAVNDPKAFAAIADQAKQAL 116


>gi|288801331|ref|ZP_06406785.1| ribosomal protein L20 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288331714|gb|EFC70198.1| ribosomal protein L20 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 114

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 77/114 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+  ++LK  KG++G RKN    AK   ++   YAYRDRR KKR+FRSL
Sbjct: 1   MPRSVNHVASKARRTRILKLTKGYFGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+ ++ YS  +  LHKAGI ++RKVL+DLA+   ++FK IV+  +
Sbjct: 61  WIQRINAAARLENMTYSTLMGALHKAGIEINRKVLADLAVNNPEAFKAIVDKVK 114


>gi|325298800|ref|YP_004258717.1| 50S ribosomal protein L20 [Bacteroides salanitronis DSM 18170]
 gi|324318353|gb|ADY36244.1| 50S ribosomal protein L20 [Bacteroides salanitronis DSM 18170]
          Length = 116

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/116 (49%), Positives = 79/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+LK  +G++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKILKLTRGYFGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WIQRINAA R+  ++YSQ +  LHKAGI ++RKVL+DLA+   ++FK +VE  +  
Sbjct: 61  WIQRINAAARLEGMSYSQLMGALHKAGIEINRKVLADLAMNHPEAFKAVVEKVKVA 116


>gi|294155485|ref|YP_003559869.1| 50S ribosomal protein L20 [Mycoplasma crocodyli MP145]
 gi|291600418|gb|ADE19914.1| 50S ribosomal protein L20 [Mycoplasma crocodyli MP145]
          Length = 117

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 84/116 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KK LK AKG++G +    + AK AV +S  YA+RDR+  KR+FR L
Sbjct: 1   MARVKGGTVTRARRKKWLKLAKGYFGHKSVGYKVAKQAVVKSWTYAFRDRKQVKRNFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R +D++YS+FINGL +A I+++RK+LS+LAI +  +F  ++EL+R  
Sbjct: 61  WIARINAATRAHDMSYSRFINGLKRANILINRKMLSELAINEPKTFATLIELARDA 116


>gi|255659701|ref|ZP_05405110.1| ribosomal protein L20 [Mitsuokella multacida DSM 20544]
 gi|260848275|gb|EEX68282.1| ribosomal protein L20 [Mitsuokella multacida DSM 20544]
          Length = 117

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 54/116 (46%), Positives = 78/116 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GV +  +HKK+LK AKG+ G +    + A   V ++  YA RDRR KK +FR L
Sbjct: 1   MPRVKVGVTAHRRHKKILKLAKGYKGSKSKQFKKANETVMKALYYARRDRRAKKGNFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   ++YS+ INGL KAG+ ++RK+L+DLAI+   +F ++V +++  
Sbjct: 61  WIARINAAARTNGISYSKLINGLTKAGVEVNRKMLADLAISDEKAFAQLVAVAKEN 116


>gi|293396367|ref|ZP_06640645.1| inorganic diphosphatase [Serratia odorifera DSM 4582]
 gi|291421156|gb|EFE94407.1| inorganic diphosphatase [Serratia odorifera DSM 4582]
          Length = 118

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASIEIDRKILADIAVFDKVAFGALVEKAKAALA 118


>gi|269991261|emb|CAX12439.1| 50S ribosomal protein L20 [Fucus vesiculosus]
          Length = 114

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/114 (44%), Positives = 75/114 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+  +  K+LK AKGF G + +  R A   V +S  Y+Y  R+ KKR FR L
Sbjct: 1   MVRVKRGNVARKRRNKILKLAKGFNGAQSSLFRIANQQVIKSLVYSYIGRKEKKRIFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RIN++ R Y++ Y++FI  L ++ I+L+RK+LS LAI    +F  I+E+++
Sbjct: 61  WITRINSSTRQYNIKYNRFIYKLKQSKILLNRKMLSQLAILDPLAFSNIIEITK 114


>gi|297569213|ref|YP_003690557.1| ribosomal protein L20 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925128|gb|ADH85938.1| ribosomal protein L20 [Desulfurivibrio alkaliphilus AHT2]
          Length = 116

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 74/116 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R  RG  +  + KKVLK A G+ G R    R+A  AVDR+  YAYRDRR KKRDFRSL
Sbjct: 1   MPRAARGFKARRRRKKVLKQASGYVGGRHRLYRSATEAVDRALNYAYRDRRQKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RI AA   +   YS+ + GL KAG+ LDRKVL++LAI     F  +V+ S+S 
Sbjct: 61  WIVRIGAAAHEHGTTYSRLMGGLKKAGVDLDRKVLANLAIMDPAGFAAVVQTSQSN 116


>gi|51209962|ref|YP_063626.1| ribosomal protein L20 [Gracilaria tenuistipitata var. liui]
 gi|68053112|sp|Q6B8T4|RK20_GRATL RecName: Full=50S ribosomal protein L20, chloroplastic
 gi|50657716|gb|AAT79701.1| 50S ribosomal protein L20 [Gracilaria tenuistipitata var. liui]
          Length = 118

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 57/111 (51%), Positives = 74/111 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  + KKVLK AKGF G      R AK  V ++ +YAY  R+ +KR++RSL
Sbjct: 1   MTRVKRGNVARKRRKKVLKLAKGFRGSHAILFRTAKQQVLKALKYAYIGRKNRKRNYRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAAVR Y + Y++FI  L  + I L+RK+LS LAI     FK I++
Sbjct: 61  WIVRINAAVRPYGITYNEFIKQLKNSSIALNRKMLSQLAILDHSVFKTILD 111


>gi|291563632|emb|CBL42448.1| LSU ribosomal protein L20P [butyrate-producing bacterium SS3/4]
          Length = 118

 Score =  144 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 81/118 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  +H +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKRHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL +AG+V++RKVLSD+AI   + F K+ EL++++L 
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKQAGVVMNRKVLSDMAINDAEGFAKLAELAKTKLA 118


>gi|85858500|ref|YP_460702.1| 50S ribosomal protein L20 [Syntrophus aciditrophicus SB]
 gi|109893159|sp|Q2LR24|RL20_SYNAS RecName: Full=50S ribosomal protein L20
 gi|85721591|gb|ABC76534.1| LSU ribosomal protein L20P [Syntrophus aciditrophicus SB]
          Length = 119

 Score =  144 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 80/114 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKR V +  K +K+ K AKGF+G R   +R A  AV+R+  YA+RDRRV+KR+FR L
Sbjct: 1   MSRVKRSVTAKKKRRKIFKLAKGFFGARSRLLRTATEAVNRALNYAFRDRRVRKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R   L YS+ I+GL K+ + +DRKVL+D+A+     F +IV L++
Sbjct: 61  WIARINAASRAQGLTYSRLIDGLRKSHVEIDRKVLADIAVNDPRGFSEIVLLAK 114


>gi|300726432|ref|ZP_07059880.1| ribosomal protein L20 [Prevotella bryantii B14]
 gi|299776280|gb|EFI72842.1| ribosomal protein L20 [Prevotella bryantii B14]
          Length = 114

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 61/114 (53%), Positives = 79/114 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K +LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKNILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+ +++YSQ +  LHKAGI ++RKVL+DLA+   ++FK IVE  +
Sbjct: 61  WIQRINAAARLENMSYSQLMGALHKAGIEINRKVLADLAMNNPEAFKAIVEKVK 114


>gi|251789561|ref|YP_003004282.1| 50S ribosomal protein L20 [Dickeya zeae Ech1591]
 gi|271500483|ref|YP_003333508.1| 50S ribosomal protein L20 [Dickeya dadantii Ech586]
 gi|307131174|ref|YP_003883190.1| 50S ribosomal subunit protein L20 [Dickeya dadantii 3937]
 gi|247538182|gb|ACT06803.1| ribosomal protein L20 [Dickeya zeae Ech1591]
 gi|270344038|gb|ACZ76803.1| ribosomal protein L20 [Dickeya dadantii Ech586]
 gi|306528703|gb|ADM98633.1| 50S ribosomal subunit protein L20 [Dickeya dadantii 3937]
          Length = 118

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L 
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKSALA 118


>gi|313905723|ref|ZP_07839083.1| ribosomal protein L20 [Eubacterium cellulosolvens 6]
 gi|313469430|gb|EFR64772.1| ribosomal protein L20 [Eubacterium cellulosolvens 6]
          Length = 117

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 53/116 (45%), Positives = 79/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKKHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  L+YS+F+ GL KAG+ L+RKVL+D+A+T  + F ++ E++++ 
Sbjct: 61  WIARINAAARLNGLSYSKFMYGLKKAGVDLNRKVLADMAVTDKEGFAQLAEVAKNN 116


>gi|15802128|ref|NP_288150.1| 50S ribosomal protein L20 [Escherichia coli O157:H7 EDL933]
 gi|15831677|ref|NP_310450.1| 50S ribosomal protein L20 [Escherichia coli O157:H7 str. Sakai]
 gi|16129672|ref|NP_416231.1| 50S ribosomal subunit protein L20 [Escherichia coli str. K-12
           substr. MG1655]
 gi|16760559|ref|NP_456176.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16764687|ref|NP_460302.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|26247967|ref|NP_754007.1| 50S ribosomal protein L20 [Escherichia coli CFT073]
 gi|29141680|ref|NP_805022.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413677|ref|YP_150752.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62179925|ref|YP_216342.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|74311964|ref|YP_310383.1| 50S ribosomal protein L20 [Shigella sonnei Ss046]
 gi|89108556|ref|AP_002336.1| 50S ribosomal subunit protein L20 [Escherichia coli str. K-12
           substr. W3110]
 gi|91210930|ref|YP_540916.1| 50S ribosomal protein L20 [Escherichia coli UTI89]
 gi|110641837|ref|YP_669567.1| 50S ribosomal protein L20 [Escherichia coli 536]
 gi|117623891|ref|YP_852804.1| 50S ribosomal protein L20 [Escherichia coli APEC O1]
 gi|152970726|ref|YP_001335835.1| 50S ribosomal protein L20 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|157145988|ref|YP_001453307.1| 50S ribosomal protein L20 [Citrobacter koseri ATCC BAA-895]
 gi|157155376|ref|YP_001463013.1| 50S ribosomal protein L20 [Escherichia coli E24377A]
 gi|157161178|ref|YP_001458496.1| 50S ribosomal protein L20 [Escherichia coli HS]
 gi|161614257|ref|YP_001588222.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168263844|ref|ZP_02685817.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168463264|ref|ZP_02697195.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|168749467|ref|ZP_02774489.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4113]
 gi|168756717|ref|ZP_02781724.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4401]
 gi|168762220|ref|ZP_02787227.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4501]
 gi|168770477|ref|ZP_02795484.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4486]
 gi|168774983|ref|ZP_02799990.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4196]
 gi|168782131|ref|ZP_02807138.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4076]
 gi|168788112|ref|ZP_02813119.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC869]
 gi|168800103|ref|ZP_02825110.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC508]
 gi|170019935|ref|YP_001724889.1| 50S ribosomal protein L20 [Escherichia coli ATCC 8739]
 gi|170081375|ref|YP_001730695.1| 50S ribosomal subunit protein L20 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170681717|ref|YP_001743533.1| 50S ribosomal protein L20 [Escherichia coli SMS-3-5]
 gi|187731221|ref|YP_001880506.1| 50S ribosomal protein L20 [Shigella boydii CDC 3083-94]
 gi|188492066|ref|ZP_02999336.1| ribosomal protein L20 [Escherichia coli 53638]
 gi|191167854|ref|ZP_03029659.1| ribosomal protein L20 [Escherichia coli B7A]
 gi|191171713|ref|ZP_03033260.1| ribosomal protein L20 [Escherichia coli F11]
 gi|193068881|ref|ZP_03049840.1| ribosomal protein L20 [Escherichia coli E110019]
 gi|194428567|ref|ZP_03061106.1| ribosomal protein L20 [Escherichia coli B171]
 gi|194435141|ref|ZP_03067375.1| ribosomal protein L20 [Shigella dysenteriae 1012]
 gi|194438518|ref|ZP_03070607.1| ribosomal protein L20 [Escherichia coli 101-1]
 gi|194444710|ref|YP_002040593.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194447640|ref|YP_002045343.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472880|ref|ZP_03078864.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194733911|ref|YP_002114353.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195937400|ref|ZP_03082782.1| 50S ribosomal protein L20 [Escherichia coli O157:H7 str. EC4024]
 gi|197250609|ref|YP_002146701.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197263309|ref|ZP_03163383.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197362601|ref|YP_002142238.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198242540|ref|YP_002215790.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200390675|ref|ZP_03217286.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204927507|ref|ZP_03218708.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205352941|ref|YP_002226742.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206580211|ref|YP_002237977.1| ribosomal protein L20 [Klebsiella pneumoniae 342]
 gi|207857157|ref|YP_002243808.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|208810682|ref|ZP_03252558.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4206]
 gi|208816652|ref|ZP_03257772.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4045]
 gi|208820605|ref|ZP_03260925.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4042]
 gi|209396995|ref|YP_002270786.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4115]
 gi|209919075|ref|YP_002293159.1| 50S ribosomal protein L20 [Escherichia coli SE11]
 gi|213161898|ref|ZP_03347608.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213423448|ref|ZP_03356431.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213426329|ref|ZP_03359079.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213582475|ref|ZP_03364301.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213650868|ref|ZP_03380921.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213852221|ref|ZP_03381753.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|215486935|ref|YP_002329366.1| 50S ribosomal protein L20 [Escherichia coli O127:H6 str. E2348/69]
 gi|217328636|ref|ZP_03444717.1| ribosomal protein L20 [Escherichia coli O157:H7 str. TW14588]
 gi|218548712|ref|YP_002382503.1| 50S ribosomal protein L20 [Escherichia fergusonii ATCC 35469]
 gi|218554284|ref|YP_002387197.1| 50S ribosomal protein L20 [Escherichia coli IAI1]
 gi|218558586|ref|YP_002391499.1| 50S ribosomal protein L20 [Escherichia coli S88]
 gi|218689661|ref|YP_002397873.1| 50S ribosomal protein L20 [Escherichia coli ED1a]
 gi|218695278|ref|YP_002402945.1| 50S ribosomal protein L20 [Escherichia coli 55989]
 gi|218699716|ref|YP_002407345.1| 50S ribosomal protein L20 [Escherichia coli IAI39]
 gi|218705216|ref|YP_002412735.1| 50S ribosomal protein L20 [Escherichia coli UMN026]
 gi|224584153|ref|YP_002637951.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|227885862|ref|ZP_04003667.1| 50S ribosomal protein L20 [Escherichia coli 83972]
 gi|237705665|ref|ZP_04536146.1| 50S ribosomal subunit protein L20 [Escherichia sp. 3_2_53FAA]
 gi|238895232|ref|YP_002919967.1| 50S ribosomal protein L20 [Klebsiella pneumoniae NTUH-K2044]
 gi|238900931|ref|YP_002926727.1| 50S ribosomal subunit protein L20 [Escherichia coli BW2952]
 gi|238910848|ref|ZP_04654685.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|253773329|ref|YP_003036160.1| 50S ribosomal protein L20 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254161776|ref|YP_003044884.1| 50S ribosomal protein L20 [Escherichia coli B str. REL606]
 gi|254793333|ref|YP_003078170.1| 50S ribosomal protein L20 [Escherichia coli O157:H7 str. TW14359]
 gi|256018091|ref|ZP_05431956.1| 50S ribosomal protein L20 [Shigella sp. D9]
 gi|256022620|ref|ZP_05436485.1| 50S ribosomal protein L20 [Escherichia sp. 4_1_40B]
 gi|260844068|ref|YP_003221846.1| 50S ribosomal subunit protein L20 [Escherichia coli O103:H2 str.
           12009]
 gi|260855582|ref|YP_003229473.1| 50S ribosomal subunit protein L20 [Escherichia coli O26:H11 str.
           11368]
 gi|260868243|ref|YP_003234645.1| 50S ribosomal subunit protein L20 [Escherichia coli O111:H- str.
           11128]
 gi|261227792|ref|ZP_05942073.1| 50S ribosomal subunit protein L20 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261258043|ref|ZP_05950576.1| 50S ribosomal subunit protein L20 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|261339518|ref|ZP_05967376.1| ribosomal protein L20 [Enterobacter cancerogenus ATCC 35316]
 gi|262044124|ref|ZP_06017199.1| inorganic diphosphatase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|283785060|ref|YP_003364925.1| 50S ribosomal subunit protein L20 [Citrobacter rodentium ICC168]
 gi|288934887|ref|YP_003438946.1| ribosomal protein L20 [Klebsiella variicola At-22]
 gi|289826213|ref|ZP_06545325.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|290509029|ref|ZP_06548400.1| 50S ribosomal protein L20 [Klebsiella sp. 1_1_55]
 gi|291282896|ref|YP_003499714.1| 50S ribosomal protein L20 [Escherichia coli O55:H7 str. CB9615]
 gi|293405215|ref|ZP_06649207.1| 50S ribosomal protein L20 [Escherichia coli FVEC1412]
 gi|293410032|ref|ZP_06653608.1| 50S ribosomal protein L20 [Escherichia coli B354]
 gi|293415034|ref|ZP_06657677.1| 50S ribosomal protein L20 [Escherichia coli B185]
 gi|293446090|ref|ZP_06662512.1| 50S ribosomal protein L20 [Escherichia coli B088]
 gi|296102763|ref|YP_003612909.1| 50S ribosomal protein L20 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|297518983|ref|ZP_06937369.1| 50S ribosomal protein L20 [Escherichia coli OP50]
 gi|298380858|ref|ZP_06990457.1| 50S ribosomal protein L20 [Escherichia coli FVEC1302]
 gi|300818355|ref|ZP_07098565.1| ribosomal protein L20 [Escherichia coli MS 107-1]
 gi|300821410|ref|ZP_07101557.1| ribosomal protein L20 [Escherichia coli MS 119-7]
 gi|300898496|ref|ZP_07116833.1| ribosomal protein L20 [Escherichia coli MS 198-1]
 gi|300904572|ref|ZP_07122409.1| ribosomal protein L20 [Escherichia coli MS 84-1]
 gi|300917722|ref|ZP_07134371.1| ribosomal protein L20 [Escherichia coli MS 115-1]
 gi|300924758|ref|ZP_07140700.1| ribosomal protein L20 [Escherichia coli MS 182-1]
 gi|300930808|ref|ZP_07146180.1| ribosomal protein L20 [Escherichia coli MS 187-1]
 gi|300938950|ref|ZP_07153651.1| ribosomal protein L20 [Escherichia coli MS 21-1]
 gi|300951316|ref|ZP_07165160.1| ribosomal protein L20 [Escherichia coli MS 116-1]
 gi|300958605|ref|ZP_07170730.1| ribosomal protein L20 [Escherichia coli MS 175-1]
 gi|300987617|ref|ZP_07178289.1| ribosomal protein L20 [Escherichia coli MS 200-1]
 gi|300994421|ref|ZP_07180926.1| ribosomal protein L20 [Escherichia coli MS 45-1]
 gi|301017725|ref|ZP_07182380.1| ribosomal protein L20 [Escherichia coli MS 69-1]
 gi|301025267|ref|ZP_07188832.1| ribosomal protein L20 [Escherichia coli MS 196-1]
 gi|301050947|ref|ZP_07197796.1| ribosomal protein L20 [Escherichia coli MS 185-1]
 gi|301303996|ref|ZP_07210114.1| ribosomal protein L20 [Escherichia coli MS 124-1]
 gi|301327446|ref|ZP_07220681.1| ribosomal protein L20 [Escherichia coli MS 78-1]
 gi|301647907|ref|ZP_07247684.1| ribosomal protein L20 [Escherichia coli MS 146-1]
 gi|306815031|ref|ZP_07449187.1| 50S ribosomal protein L20 [Escherichia coli NC101]
 gi|307138375|ref|ZP_07497731.1| 50S ribosomal protein L20 [Escherichia coli H736]
 gi|307310714|ref|ZP_07590360.1| ribosomal protein L20 [Escherichia coli W]
 gi|309793486|ref|ZP_07687913.1| ribosomal protein L20 [Escherichia coli MS 145-7]
 gi|312966918|ref|ZP_07781136.1| ribosomal protein L20 [Escherichia coli 2362-75]
 gi|312969744|ref|ZP_07783927.1| ribosomal protein L20 [Escherichia coli 1827-70]
 gi|330009683|ref|ZP_08306557.1| ribosomal protein L20 [Klebsiella sp. MS 92-3]
 gi|331642313|ref|ZP_08343448.1| ribosomal protein L20 [Escherichia coli H736]
 gi|331647207|ref|ZP_08348301.1| ribosomal protein L20 [Escherichia coli M605]
 gi|331653116|ref|ZP_08354121.1| ribosomal protein L20 [Escherichia coli M718]
 gi|331657696|ref|ZP_08358658.1| ribosomal protein L20 [Escherichia coli TA206]
 gi|331663195|ref|ZP_08364105.1| ribosomal protein L20 [Escherichia coli TA143]
 gi|331668401|ref|ZP_08369249.1| ribosomal protein L20 [Escherichia coli TA271]
 gi|331673267|ref|ZP_08374035.1| ribosomal protein L20 [Escherichia coli TA280]
 gi|331677589|ref|ZP_08378264.1| ribosomal protein L20 [Escherichia coli H591]
 gi|331683222|ref|ZP_08383823.1| ribosomal protein L20 [Escherichia coli H299]
 gi|332279133|ref|ZP_08391546.1| 50S ribosomal subunit protein L20 [Shigella sp. D9]
 gi|67472005|sp|P0A7L3|RL20_ECOLI RecName: Full=50S ribosomal protein L20
 gi|67472006|sp|P0A7L4|RL20_ECOL6 RecName: Full=50S ribosomal protein L20
 gi|67472007|sp|P0A7L5|RL20_ECO57 RecName: Full=50S ribosomal protein L20
 gi|67472008|sp|P0A7L6|RL20_SALTY RecName: Full=50S ribosomal protein L20
 gi|67472009|sp|P0A7L7|RL20_SALTI RecName: Full=50S ribosomal protein L20
 gi|81309705|sp|Q57PV0|RL20_SALCH RecName: Full=50S ribosomal protein L20
 gi|81821449|sp|Q5PH91|RL20_SALPA RecName: Full=50S ribosomal protein L20
 gi|109893153|sp|Q3Z264|RL20_SHISS RecName: Full=50S ribosomal protein L20
 gi|122423612|sp|Q1RB79|RL20_ECOUT RecName: Full=50S ribosomal protein L20
 gi|122958310|sp|Q0THB3|RL20_ECOL5 RecName: Full=50S ribosomal protein L20
 gi|166219630|sp|A8AHA8|RL20_CITK8 RecName: Full=50S ribosomal protein L20
 gi|166219641|sp|A1ABQ0|RL20_ECOK1 RecName: Full=50S ribosomal protein L20
 gi|166219654|sp|A6TAI4|RL20_KLEP7 RecName: Full=50S ribosomal protein L20
 gi|166984689|sp|A7ZMI4|RL20_ECO24 RecName: Full=50S ribosomal protein L20
 gi|166984733|sp|A8A0Q9|RL20_ECOHS RecName: Full=50S ribosomal protein L20
 gi|189041862|sp|B1IPL2|RL20_ECOLC RecName: Full=50S ribosomal protein L20
 gi|189041883|sp|A9N240|RL20_SALPB RecName: Full=50S ribosomal protein L20
 gi|226730390|sp|B7MAS6|RL20_ECO45 RecName: Full=50S ribosomal protein L20
 gi|226730391|sp|B5YQ04|RL20_ECO5E RecName: Full=50S ribosomal protein L20
 gi|226730392|sp|B7NT61|RL20_ECO7I RecName: Full=50S ribosomal protein L20
 gi|226730393|sp|B7M1C4|RL20_ECO8A RecName: Full=50S ribosomal protein L20
 gi|226730394|sp|B1XG23|RL20_ECODH RecName: Full=50S ribosomal protein L20
 gi|226730395|sp|B7N553|RL20_ECOLU RecName: Full=50S ribosomal protein L20
 gi|226730396|sp|B6IBD4|RL20_ECOSE RecName: Full=50S ribosomal protein L20
 gi|226730397|sp|B1LE15|RL20_ECOSM RecName: Full=50S ribosomal protein L20
 gi|226730399|sp|B7LQ74|RL20_ESCF3 RecName: Full=50S ribosomal protein L20
 gi|226730410|sp|B5XQC9|RL20_KLEP3 RecName: Full=50S ribosomal protein L20
 gi|226730445|sp|B5F7F9|RL20_SALA4 RecName: Full=50S ribosomal protein L20
 gi|226730446|sp|B5FJA5|RL20_SALDC RecName: Full=50S ribosomal protein L20
 gi|226730447|sp|B5QVW5|RL20_SALEP RecName: Full=50S ribosomal protein L20
 gi|226730448|sp|B5RAX0|RL20_SALG2 RecName: Full=50S ribosomal protein L20
 gi|226730449|sp|B4TGH4|RL20_SALHS RecName: Full=50S ribosomal protein L20
 gi|226730450|sp|B4T4N1|RL20_SALNS RecName: Full=50S ribosomal protein L20
 gi|226730451|sp|B5BA39|RL20_SALPK RecName: Full=50S ribosomal protein L20
 gi|226730452|sp|B4TUF3|RL20_SALSV RecName: Full=50S ribosomal protein L20
 gi|226730455|sp|B2U394|RL20_SHIB3 RecName: Full=50S ribosomal protein L20
 gi|254800320|sp|B7US99|RL20_ECO27 RecName: Full=50S ribosomal protein L20
 gi|254800321|sp|B7L6I9|RL20_ECO55 RecName: Full=50S ribosomal protein L20
 gi|254800322|sp|B7MVJ4|RL20_ECO81 RecName: Full=50S ribosomal protein L20
 gi|254800337|sp|C0Q644|RL20_SALPC RecName: Full=50S ribosomal protein L20
 gi|259646183|sp|C4ZYH8|RL20_ECOBW RecName: Full=50S ribosomal protein L20
 gi|25295359|pir||AH0705 50S ribosomal chain protein L20 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|116666586|pdb|1VS6|Q Chain Q, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|116666638|pdb|1VS8|Q Chain Q, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|256032382|pdb|3E1B|J Chain J, Structure Of The 50s Subunit Of E. Coli Ribosome In Pre-
           Accommodation State
 gi|256032439|pdb|3E1D|J Chain J, Structure Of The 50s Subunit Of E. Coli Ribosome In Post-
           Accommodation State
 gi|257097358|pdb|3I1N|Q Chain Q, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097410|pdb|3I1P|Q Chain Q, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097464|pdb|3I1R|Q Chain Q, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097518|pdb|3I1T|Q Chain Q, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097573|pdb|3I20|Q Chain Q, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097628|pdb|3I22|Q Chain Q, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|290560348|pdb|3KCR|Q Chain Q, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
           Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kc4
 gi|308198371|pdb|1VT2|Q Chain Q, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 gi|308198745|pdb|3ORB|Q Chain Q, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The First
           70s Ribosome Bound To Cem-101.
 gi|326634226|pdb|3IZT|R Chain R, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon.
 gi|326634259|pdb|3IZU|R Chain R, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A Cognate
           Codon
 gi|12515727|gb|AAG56703.1|AE005394_12 50S ribosomal subunit protein L20, and regulator [Escherichia coli
           O157:H7 str. EDL933]
 gi|26108370|gb|AAN80572.1|AE016761_147 50S ribosomal protein L20 [Escherichia coli CFT073]
 gi|1788009|gb|AAC74786.1| 50S ribosomal subunit protein L20 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13361890|dbj|BAB35846.1| 50S ribosomal subunit protein L20 [Escherichia coli O157:H7 str.
           Sakai]
 gi|16419855|gb|AAL20261.1| 50S ribosomal subunit protein L20 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16502855|emb|CAD02017.1| 50S ribosomal subunit protein L20 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29137308|gb|AAO68871.1| 50S ribosomal subunit protein L20 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56127934|gb|AAV77440.1| 50S ribosomal subunit protein L20 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62127558|gb|AAX65261.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|73855441|gb|AAZ88148.1| 50S ribosomal subunit protein L20 [Shigella sonnei Ss046]
 gi|85675088|dbj|BAA15483.2| 50S ribosomal subunit protein L20 [Escherichia coli str. K12
           substr. W3110]
 gi|91072504|gb|ABE07385.1| 50S ribosomal subunit protein L20 [Escherichia coli UTI89]
 gi|110343429|gb|ABG69666.1| 50S ribosomal protein L20 [Escherichia coli 536]
 gi|115513015|gb|ABJ01090.1| 50S ribosomal subunit protein L20 [Escherichia coli APEC O1]
 gi|150955575|gb|ABR77605.1| 50S ribosomal protein L20 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|157066858|gb|ABV06113.1| ribosomal protein L20 [Escherichia coli HS]
 gi|157077406|gb|ABV17114.1| ribosomal protein L20 [Escherichia coli E24377A]
 gi|157083193|gb|ABV12871.1| hypothetical protein CKO_01742 [Citrobacter koseri ATCC BAA-895]
 gi|161363621|gb|ABX67389.1| hypothetical protein SPAB_02002 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|169754863|gb|ACA77562.1| ribosomal protein L20 [Escherichia coli ATCC 8739]
 gi|169889210|gb|ACB02917.1| 50S ribosomal subunit protein L20 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170519435|gb|ACB17613.1| ribosomal protein L20 [Escherichia coli SMS-3-5]
 gi|187428213|gb|ACD07487.1| ribosomal protein L20 [Shigella boydii CDC 3083-94]
 gi|187769406|gb|EDU33250.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4196]
 gi|188016321|gb|EDU54443.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4113]
 gi|188487265|gb|EDU62368.1| ribosomal protein L20 [Escherichia coli 53638]
 gi|189000277|gb|EDU69263.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4076]
 gi|189356211|gb|EDU74630.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4401]
 gi|189360638|gb|EDU79057.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4486]
 gi|189367439|gb|EDU85855.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4501]
 gi|189372010|gb|EDU90426.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC869]
 gi|189377562|gb|EDU95978.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC508]
 gi|190902113|gb|EDV61857.1| ribosomal protein L20 [Escherichia coli B7A]
 gi|190908043|gb|EDV67635.1| ribosomal protein L20 [Escherichia coli F11]
 gi|192957676|gb|EDV88120.1| ribosomal protein L20 [Escherichia coli E110019]
 gi|194403373|gb|ACF63595.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194405944|gb|ACF66163.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194413445|gb|EDX29728.1| ribosomal protein L20 [Escherichia coli B171]
 gi|194416605|gb|EDX32740.1| ribosomal protein L20 [Shigella dysenteriae 1012]
 gi|194422528|gb|EDX38526.1| ribosomal protein L20 [Escherichia coli 101-1]
 gi|194459244|gb|EDX48083.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194709413|gb|ACF88634.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195182906|dbj|BAG66476.1| 50S ribosomal subunit protein L20 [Escherichia coli O111:H-]
 gi|195634034|gb|EDX52386.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197094078|emb|CAR59578.1| 50S ribosomal subunit protein L20 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197214312|gb|ACH51709.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197241564|gb|EDY24184.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197937056|gb|ACH74389.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|199603120|gb|EDZ01666.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204322849|gb|EDZ08045.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205272722|emb|CAR37638.1| 50S ribosomal subunit protein L20 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205347649|gb|EDZ34280.1| ribosomal protein L20 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206569269|gb|ACI11045.1| ribosomal protein L20 [Klebsiella pneumoniae 342]
 gi|206708960|emb|CAR33290.1| 50S ribosomal subunit protein L20 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|208725198|gb|EDZ74905.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4206]
 gi|208730995|gb|EDZ79684.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4045]
 gi|208740728|gb|EDZ88410.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4042]
 gi|209158395|gb|ACI35828.1| ribosomal protein L20 [Escherichia coli O157:H7 str. EC4115]
 gi|209768858|gb|ACI82741.1| 50S ribosomal subunit protein L20 [Escherichia coli]
 gi|209768860|gb|ACI82742.1| 50S ribosomal subunit protein L20 [Escherichia coli]
 gi|209768862|gb|ACI82743.1| 50S ribosomal subunit protein L20 [Escherichia coli]
 gi|209768864|gb|ACI82744.1| 50S ribosomal subunit protein L20 [Escherichia coli]
 gi|209768866|gb|ACI82745.1| 50S ribosomal subunit protein L20 [Escherichia coli]
 gi|209912334|dbj|BAG77408.1| 50S ribosomal protein L20 [Escherichia coli SE11]
 gi|215265007|emb|CAS09393.1| 50S ribosomal subunit protein L20 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217317983|gb|EEC26410.1| ribosomal protein L20 [Escherichia coli O157:H7 str. TW14588]
 gi|218352010|emb|CAU97742.1| 50S ribosomal subunit protein L20 [Escherichia coli 55989]
 gi|218356253|emb|CAQ88871.1| 50S ribosomal subunit protein L20 [Escherichia fergusonii ATCC
           35469]
 gi|218361052|emb|CAQ98628.1| 50S ribosomal subunit protein L20 [Escherichia coli IAI1]
 gi|218365355|emb|CAR03075.1| 50S ribosomal subunit protein L20 [Escherichia coli S88]
 gi|218369702|emb|CAR17472.1| 50S ribosomal subunit protein L20 [Escherichia coli IAI39]
 gi|218427225|emb|CAR08110.2| 50S ribosomal subunit protein L20 [Escherichia coli ED1a]
 gi|218432313|emb|CAR13202.1| 50S ribosomal subunit protein L20 [Escherichia coli UMN026]
 gi|222033471|emb|CAP76212.1| 50S ribosomal protein L20 [Escherichia coli LF82]
 gi|224468680|gb|ACN46510.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|226900422|gb|EEH86681.1| 50S ribosomal subunit protein L20 [Escherichia sp. 3_2_53FAA]
 gi|227837435|gb|EEJ47901.1| 50S ribosomal protein L20 [Escherichia coli 83972]
 gi|238547549|dbj|BAH63900.1| 50S ribosomal protein L20 [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|238859859|gb|ACR61857.1| 50S ribosomal subunit protein L20 [Escherichia coli BW2952]
 gi|242377439|emb|CAQ32191.1| 50S ribosomal subunit protein L20, subunit of 50S ribosomal subunit
           and ribosome [Escherichia coli BL21(DE3)]
 gi|253324373|gb|ACT28975.1| ribosomal protein L20 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253973677|gb|ACT39348.1| 50S ribosomal protein L20 [Escherichia coli B str. REL606]
 gi|253977871|gb|ACT43541.1| 50S ribosomal protein L20 [Escherichia coli BL21(DE3)]
 gi|254592733|gb|ACT72094.1| 50S ribosomal subunit protein L20 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257754231|dbj|BAI25733.1| 50S ribosomal subunit protein L20 [Escherichia coli O26:H11 str.
           11368]
 gi|257759215|dbj|BAI30712.1| 50S ribosomal subunit protein L20 [Escherichia coli O103:H2 str.
           12009]
 gi|257764599|dbj|BAI36094.1| 50S ribosomal subunit protein L20 [Escherichia coli O111:H- str.
           11128]
 gi|259038523|gb|EEW39719.1| inorganic diphosphatase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|260449161|gb|ACX39583.1| ribosomal protein L20 [Escherichia coli DH1]
 gi|261246545|emb|CBG24355.1| 50S ribosomal subunit protein L20 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267993216|gb|ACY88101.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|281178786|dbj|BAI55116.1| 50S ribosomal protein L20 [Escherichia coli SE15]
 gi|282948514|emb|CBG88103.1| 50S ribosomal subunit protein L20 [Citrobacter rodentium ICC168]
 gi|284921636|emb|CBG34708.1| 50S ribosomal subunit protein L20 [Escherichia coli 042]
 gi|288318331|gb|EFC57269.1| ribosomal protein L20 [Enterobacter cancerogenus ATCC 35316]
 gi|288889596|gb|ADC57914.1| ribosomal protein L20 [Klebsiella variicola At-22]
 gi|289778423|gb|EFD86420.1| 50S ribosomal protein L20 [Klebsiella sp. 1_1_55]
 gi|290762769|gb|ADD56730.1| 50S ribosomal protein L20 [Escherichia coli O55:H7 str. CB9615]
 gi|291322920|gb|EFE62348.1| 50S ribosomal protein L20 [Escherichia coli B088]
 gi|291427423|gb|EFF00450.1| 50S ribosomal protein L20 [Escherichia coli FVEC1412]
 gi|291432682|gb|EFF05661.1| 50S ribosomal protein L20 [Escherichia coli B185]
 gi|291470500|gb|EFF12984.1| 50S ribosomal protein L20 [Escherichia coli B354]
 gi|294492059|gb|ADE90815.1| ribosomal protein L20 [Escherichia coli IHE3034]
 gi|295057222|gb|ADF61960.1| 50S ribosomal protein L20 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295096108|emb|CBK85198.1| LSU ribosomal protein L20P [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
 gi|298278300|gb|EFI19814.1| 50S ribosomal protein L20 [Escherichia coli FVEC1302]
 gi|299880132|gb|EFI88343.1| ribosomal protein L20 [Escherichia coli MS 196-1]
 gi|300297401|gb|EFJ53786.1| ribosomal protein L20 [Escherichia coli MS 185-1]
 gi|300306097|gb|EFJ60617.1| ribosomal protein L20 [Escherichia coli MS 200-1]
 gi|300314730|gb|EFJ64514.1| ribosomal protein L20 [Escherichia coli MS 175-1]
 gi|300357848|gb|EFJ73718.1| ribosomal protein L20 [Escherichia coli MS 198-1]
 gi|300400017|gb|EFJ83555.1| ribosomal protein L20 [Escherichia coli MS 69-1]
 gi|300403485|gb|EFJ87023.1| ribosomal protein L20 [Escherichia coli MS 84-1]
 gi|300406267|gb|EFJ89805.1| ribosomal protein L20 [Escherichia coli MS 45-1]
 gi|300415123|gb|EFJ98433.1| ribosomal protein L20 [Escherichia coli MS 115-1]
 gi|300419046|gb|EFK02357.1| ribosomal protein L20 [Escherichia coli MS 182-1]
 gi|300449413|gb|EFK13033.1| ribosomal protein L20 [Escherichia coli MS 116-1]
 gi|300456149|gb|EFK19642.1| ribosomal protein L20 [Escherichia coli MS 21-1]
 gi|300461366|gb|EFK24859.1| ribosomal protein L20 [Escherichia coli MS 187-1]
 gi|300525913|gb|EFK46982.1| ribosomal protein L20 [Escherichia coli MS 119-7]
 gi|300528995|gb|EFK50057.1| ribosomal protein L20 [Escherichia coli MS 107-1]
 gi|300840793|gb|EFK68553.1| ribosomal protein L20 [Escherichia coli MS 124-1]
 gi|300845958|gb|EFK73718.1| ribosomal protein L20 [Escherichia coli MS 78-1]
 gi|301073964|gb|EFK88770.1| ribosomal protein L20 [Escherichia coli MS 146-1]
 gi|301157873|emb|CBW17367.1| 50S ribosomal protein L20. Chloroplast 50S ribosomal protein L20
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|305851679|gb|EFM52132.1| 50S ribosomal protein L20 [Escherichia coli NC101]
 gi|306908892|gb|EFN39388.1| ribosomal protein L20 [Escherichia coli W]
 gi|307553737|gb|ADN46512.1| 50S ribosomal subunit protein L20 [Escherichia coli ABU 83972]
 gi|307626797|gb|ADN71101.1| 50S ribosomal protein L20 [Escherichia coli UM146]
 gi|308123073|gb|EFO60335.1| ribosomal protein L20 [Escherichia coli MS 145-7]
 gi|309701939|emb|CBJ01252.1| 50S ribosomal subunit protein L20 [Escherichia coli ETEC H10407]
 gi|310338029|gb|EFQ03118.1| ribosomal protein L20 [Escherichia coli 1827-70]
 gi|312288382|gb|EFR16284.1| ribosomal protein L20 [Escherichia coli 2362-75]
 gi|312912321|dbj|BAJ36295.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|312946317|gb|ADR27144.1| 50S ribosomal protein L20 [Escherichia coli O83:H1 str. NRG 857C]
 gi|315061021|gb|ADT75348.1| 50S ribosomal subunit protein L20 [Escherichia coli W]
 gi|315136356|dbj|BAJ43515.1| 50S ribosomal protein L20 [Escherichia coli DH1]
 gi|315257479|gb|EFU37447.1| ribosomal protein L20 [Escherichia coli MS 85-1]
 gi|315286435|gb|EFU45870.1| ribosomal protein L20 [Escherichia coli MS 110-3]
 gi|315290477|gb|EFU49851.1| ribosomal protein L20 [Escherichia coli MS 153-1]
 gi|315299751|gb|EFU58991.1| ribosomal protein L20 [Escherichia coli MS 16-3]
 gi|315618913|gb|EFU99496.1| ribosomal protein L20 [Escherichia coli 3431]
 gi|320086184|emb|CBY95958.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|320173201|gb|EFW48412.1| LSU ribosomal protein L20p [Shigella dysenteriae CDC 74-1112]
 gi|320181256|gb|EFW56175.1| LSU ribosomal protein L20p [Shigella boydii ATCC 9905]
 gi|320185861|gb|EFW60612.1| LSU ribosomal protein L20p [Shigella flexneri CDC 796-83]
 gi|320188403|gb|EFW63065.1| LSU ribosomal protein L20p [Escherichia coli O157:H7 str. EC1212]
 gi|320194573|gb|EFW69204.1| LSU ribosomal protein L20p [Escherichia coli WV_060327]
 gi|320197899|gb|EFW72507.1| LSU ribosomal protein L20p [Escherichia coli EC4100B]
 gi|320641564|gb|EFX10952.1| 50S ribosomal protein L20 [Escherichia coli O157:H7 str. G5101]
 gi|320646923|gb|EFX15756.1| 50S ribosomal protein L20 [Escherichia coli O157:H- str. 493-89]
 gi|320652205|gb|EFX20503.1| 50S ribosomal protein L20 [Escherichia coli O157:H- str. H 2687]
 gi|320657806|gb|EFX25568.1| 50S ribosomal protein L20 [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320658381|gb|EFX26075.1| 50S ribosomal protein L20 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320668278|gb|EFX35105.1| 50S ribosomal protein L20 [Escherichia coli O157:H7 str. LSU-61]
 gi|321223964|gb|EFX49027.1| LSU ribosomal protein L20p [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322616721|gb|EFY13630.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322620020|gb|EFY16893.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622330|gb|EFY19175.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627854|gb|EFY24644.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322633048|gb|EFY29791.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636706|gb|EFY33409.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641268|gb|EFY37909.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322645257|gb|EFY41786.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650198|gb|EFY46612.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655772|gb|EFY52074.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660098|gb|EFY56337.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665335|gb|EFY61523.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669593|gb|EFY65741.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322673519|gb|EFY69621.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322677445|gb|EFY73509.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679890|gb|EFY75929.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322687362|gb|EFY83334.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322714391|gb|EFZ05962.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323129607|gb|ADX17037.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323153046|gb|EFZ39315.1| ribosomal protein L20 [Escherichia coli EPECa14]
 gi|323158487|gb|EFZ44503.1| ribosomal protein L20 [Escherichia coli E128010]
 gi|323169351|gb|EFZ55027.1| ribosomal protein L20 [Shigella sonnei 53G]
 gi|323175216|gb|EFZ60830.1| ribosomal protein L20 [Escherichia coli LT-68]
 gi|323180494|gb|EFZ66039.1| ribosomal protein L20 [Escherichia coli 1180]
 gi|323186268|gb|EFZ71620.1| ribosomal protein L20 [Escherichia coli 1357]
 gi|323186898|gb|EFZ72216.1| ribosomal protein L20 [Escherichia coli RN587/1]
 gi|323192480|gb|EFZ77710.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323198665|gb|EFZ83766.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323204093|gb|EFZ89107.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323208712|gb|EFZ93650.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210225|gb|EFZ95124.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323217688|gb|EGA02403.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323220242|gb|EGA04697.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323223492|gb|EGA07818.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323229490|gb|EGA13613.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323232713|gb|EGA16809.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240248|gb|EGA24292.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242764|gb|EGA26785.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249080|gb|EGA32999.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254419|gb|EGA38236.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255603|gb|EGA39359.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323260120|gb|EGA43745.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323267116|gb|EGA50601.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323271560|gb|EGA54981.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|323378408|gb|ADX50676.1| ribosomal protein L20 [Escherichia coli KO11]
 gi|323937318|gb|EGB33597.1| ribosomal protein L20 [Escherichia coli E1520]
 gi|323940618|gb|EGB36809.1| ribosomal protein L20 [Escherichia coli E482]
 gi|323948094|gb|EGB44085.1| ribosomal protein L20 [Escherichia coli H120]
 gi|323952223|gb|EGB48096.1| ribosomal protein L20 [Escherichia coli H252]
 gi|323956617|gb|EGB52355.1| ribosomal protein L20 [Escherichia coli H263]
 gi|323962099|gb|EGB57695.1| ribosomal protein L20 [Escherichia coli H489]
 gi|323968485|gb|EGB63891.1| ribosomal protein L20 [Escherichia coli M863]
 gi|323973904|gb|EGB69076.1| ribosomal protein L20 [Escherichia coli TA007]
 gi|323978101|gb|EGB73187.1| ribosomal protein L20 [Escherichia coli TW10509]
 gi|324007095|gb|EGB76314.1| ribosomal protein L20 [Escherichia coli MS 57-2]
 gi|324011504|gb|EGB80723.1| ribosomal protein L20 [Escherichia coli MS 60-1]
 gi|324016469|gb|EGB85688.1| ribosomal protein L20 [Escherichia coli MS 117-3]
 gi|324113467|gb|EGC07442.1| ribosomal protein L20 [Escherichia fergusonii B253]
 gi|324119201|gb|EGC13089.1| ribosomal protein L20 [Escherichia coli E1167]
 gi|325497123|gb|EGC94982.1| 50S ribosomal protein L20 [Escherichia fergusonii ECD227]
 gi|326342083|gb|EGD65864.1| LSU ribosomal protein L20p [Escherichia coli O157:H7 str. 1044]
 gi|326343635|gb|EGD67397.1| LSU ribosomal protein L20p [Escherichia coli O157:H7 str. 1125]
 gi|326623537|gb|EGE29882.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326628014|gb|EGE34357.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|327252832|gb|EGE64486.1| ribosomal protein L20 [Escherichia coli STEC_7v]
 gi|328534771|gb|EGF61327.1| ribosomal protein L20 [Klebsiella sp. MS 92-3]
 gi|330911520|gb|EGH40030.1| LSU ribosomal protein L20p [Escherichia coli AA86]
 gi|331039111|gb|EGI11331.1| ribosomal protein L20 [Escherichia coli H736]
 gi|331043990|gb|EGI16126.1| ribosomal protein L20 [Escherichia coli M605]
 gi|331049214|gb|EGI21286.1| ribosomal protein L20 [Escherichia coli M718]
 gi|331055944|gb|EGI27953.1| ribosomal protein L20 [Escherichia coli TA206]
 gi|331058994|gb|EGI30971.1| ribosomal protein L20 [Escherichia coli TA143]
 gi|331063595|gb|EGI35506.1| ribosomal protein L20 [Escherichia coli TA271]
 gi|331069465|gb|EGI40852.1| ribosomal protein L20 [Escherichia coli TA280]
 gi|331074049|gb|EGI45369.1| ribosomal protein L20 [Escherichia coli H591]
 gi|331079437|gb|EGI50634.1| ribosomal protein L20 [Escherichia coli H299]
 gi|332093959|gb|EGI99012.1| ribosomal protein L20 [Shigella dysenteriae 155-74]
 gi|332096324|gb|EGJ01325.1| ribosomal protein L20 [Shigella boydii 3594-74]
 gi|332101485|gb|EGJ04831.1| 50S ribosomal subunit protein L20 [Shigella sp. D9]
 gi|332343435|gb|AEE56769.1| ribosomal protein RplT [Escherichia coli UMNK88]
 gi|332988224|gb|AEF07207.1| 50S ribosomal protein L20 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
 gi|333003772|gb|EGK23308.1| ribosomal protein L20 [Shigella flexneri VA-6]
 gi|333006573|gb|EGK26073.1| ribosomal protein L20 [Shigella flexneri K-272]
 gi|333018792|gb|EGK38085.1| ribosomal protein L20 [Shigella flexneri K-227]
          Length = 118

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAALA 118


>gi|156934287|ref|YP_001438203.1| 50S ribosomal protein L20 [Cronobacter sakazakii ATCC BAA-894]
 gi|161503555|ref|YP_001570667.1| 50S ribosomal protein L20 [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|166219642|sp|A7MNZ1|RL20_ENTS8 RecName: Full=50S ribosomal protein L20
 gi|189041882|sp|A9MFC0|RL20_SALAR RecName: Full=50S ribosomal protein L20
 gi|156532541|gb|ABU77367.1| hypothetical protein ESA_02118 [Cronobacter sakazakii ATCC BAA-894]
 gi|160864902|gb|ABX21525.1| hypothetical protein SARI_01633 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 118

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKAALA 118


>gi|116491272|ref|YP_810816.1| 50S ribosomal protein L20P [Oenococcus oeni PSU-1]
 gi|122276546|sp|Q04EH1|RL20_OENOB RecName: Full=50S ribosomal protein L20
 gi|116091997|gb|ABJ57151.1| LSU ribosomal protein L20P [Oenococcus oeni PSU-1]
          Length = 196

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 51/117 (43%), Positives = 77/117 (65%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK   V+  + KK++K AKG+ G+R    + AK  V +S  YAYRDR+  KRD+R LWI
Sbjct: 2   RVKGTNVTRIRRKKMIKLAKGYRGQRHINFKVAKQQVWKSYLYAYRDRKNVKRDYRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
            RINAA R   ++YSQ ++G   AGI L+RK+L++LA++   +F K+ E ++ ++  
Sbjct: 62  ARINAASRKNGISYSQLMHGFKVAGIDLNRKMLAELAVSDFATFSKLAETAKKQVSA 118


>gi|210632541|ref|ZP_03297451.1| hypothetical protein COLSTE_01354 [Collinsella stercoris DSM 13279]
 gi|229816629|ref|ZP_04446918.1| hypothetical protein COLINT_03677 [Collinsella intestinalis DSM
           13280]
 gi|210159488|gb|EEA90459.1| hypothetical protein COLSTE_01354 [Collinsella stercoris DSM 13279]
 gi|229807757|gb|EEP43570.1| hypothetical protein COLINT_03677 [Collinsella intestinalis DSM
           13280]
          Length = 119

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 59/119 (49%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL  AKG+YG+   + + AK  V  S QY YRDRR KKR+ RSL
Sbjct: 1   MARVKRAVNAKKKRRTVLNRAKGYYGQASRSYKYAKEQVQHSLQYQYRDRRNKKREIRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+ D++YSQF++GL  AGI LDRKVL+ +A   ++SF ++  +++  L  
Sbjct: 61  WITRINAAARMNDISYSQFMHGLKLAGIELDRKVLAQMAYEDIESFNELAAIAKKALEA 119


>gi|237785424|ref|YP_002906129.1| 50S ribosomal protein L20 [Corynebacterium kroppenstedtii DSM
           44385]
 gi|259646178|sp|C4LID1|RL20_CORK4 RecName: Full=50S ribosomal protein L20
 gi|237758336|gb|ACR17586.1| 50S ribosomal protein L20 [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 126

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K ++VLKSAKG+ G+R    R AK  +  S+ Y +RDRR KK DFR L
Sbjct: 1   MARVKRSVNAKKKRREVLKSAKGYRGQRSRLYRKAKEQMLHSKTYEFRDRRAKKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R  D+ Y++ I GL  AG+ +DRK L+DLA++   +F  +   ++  L  D
Sbjct: 61  WITRINAAARQNDMTYNRLIQGLRLAGVDIDRKNLADLAVSDEQAFSALCAAAKDALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|148264669|ref|YP_001231375.1| 50S ribosomal protein L20 [Geobacter uraniireducens Rf4]
 gi|189041865|sp|A5G4T4|RL20_GEOUR RecName: Full=50S ribosomal protein L20
 gi|146398169|gb|ABQ26802.1| LSU ribosomal protein L20P [Geobacter uraniireducens Rf4]
          Length = 117

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 60/117 (51%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+ I+GL  A + +DRKV++DLA++    F +I  L+++ +
Sbjct: 61  WIARINAAARINGLSYSKLIHGLKIAKVEVDRKVMADLAVSDPRGFAEIASLAKANI 117


>gi|148261905|ref|YP_001236032.1| 50S ribosomal protein L20 [Acidiphilium cryptum JF-5]
 gi|326405409|ref|YP_004285491.1| 50S ribosomal protein L20 [Acidiphilium multivorum AIU301]
 gi|166219599|sp|A5G2N1|RL20_ACICJ RecName: Full=50S ribosomal protein L20
 gi|146403586|gb|ABQ32113.1| LSU ribosomal protein L20P [Acidiphilium cryptum JF-5]
 gi|325052271|dbj|BAJ82609.1| 50S ribosomal protein L20 [Acidiphilium multivorum AIU301]
          Length = 118

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 63/115 (54%), Positives = 79/115 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK +KGF GR     R A   ++++ +YAYRDRR KKR+FR+L
Sbjct: 1   MARVKRGVTTHARHKKVLKQSKGFVGRSSTNYRIALERLEKALRYAYRDRRNKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAAVR   + YSQFI  L  A I LDRKVL+ +A      F  IVE +++
Sbjct: 61  WIQRINAAVREQGMTYSQFIAALKAANIELDRKVLAAMAFDDPAGFTAIVEAAKA 115


>gi|86131539|ref|ZP_01050137.1| 50S ribosomal protein L20 [Dokdonia donghaensis MED134]
 gi|85817984|gb|EAQ39152.1| 50S ribosomal protein L20 [Dokdonia donghaensis MED134]
          Length = 114

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 80/114 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKV+K AKG++GRRKN    AK AVD++  YAYRDRR KKR+FRSL
Sbjct: 1   MPRSVNSVAKRARRKKVMKQAKGYFGRRKNVWTVAKNAVDKAMSYAYRDRRQKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R++ ++YSQF+ G+   GI L+RKVL+DLA+   ++F+ I+   +
Sbjct: 61  WITRINAGARMHGMSYSQFMGGVKANGIELNRKVLADLAMNHPEAFEAIINKVK 114


>gi|260892438|ref|YP_003238535.1| ribosomal protein L20 [Ammonifex degensii KC4]
 gi|260864579|gb|ACX51685.1| ribosomal protein L20 [Ammonifex degensii KC4]
          Length = 118

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V S  + KK+LK AKG++G R    R AK  V +S  YAYRDRR +KRDFR L
Sbjct: 1   MPRVKTSVASRRRRKKILKMAKGYWGARSKLYRIAKQQVMKSLMYAYRDRRARKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L YS+FINGL KAG+ LDRKVL+DLA+   ++F ++VEL++++L
Sbjct: 61  WIVRINAAAREAGLTYSRFINGLKKAGVELDRKVLADLAVRDREAFGRLVELAKAQL 117


>gi|194466645|ref|ZP_03072632.1| ribosomal protein L20 [Lactobacillus reuteri 100-23]
 gi|227543934|ref|ZP_03973983.1| ribosomal protein L20 [Lactobacillus reuteri CF48-3A]
 gi|300909683|ref|ZP_07127144.1| 50S ribosomal protein L20 [Lactobacillus reuteri SD2112]
 gi|194453681|gb|EDX42578.1| ribosomal protein L20 [Lactobacillus reuteri 100-23]
 gi|227186085|gb|EEI66156.1| ribosomal protein L20 [Lactobacillus reuteri CF48-3A]
 gi|300893548|gb|EFK86907.1| 50S ribosomal protein L20 [Lactobacillus reuteri SD2112]
          Length = 117

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 80/115 (69%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ K+++K AKG+ G +    + AK  V +S  YA+RDR+V KR FR LWI
Sbjct: 2   RVKGGTVTRARRKRIMKLAKGYRGSKHRLFKTAKDQVMKSYTYAFRDRKVNKRKFRELWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D++YS+ ++GL  A I ++RK+L+DLA+   D+FK +V+ ++  L
Sbjct: 62  ARINAAARMNDISYSKLMHGLKVANIDINRKMLADLAVNDADAFKALVDEAKKAL 116


>gi|118443763|ref|YP_877836.1| 50S ribosomal protein L20 [Clostridium novyi NT]
 gi|166219635|sp|A0PZN4|RL20_CLONN RecName: Full=50S ribosomal protein L20
 gi|118134219|gb|ABK61263.1| ribosomal protein L20 [Clostridium novyi NT]
          Length = 119

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 59/119 (49%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  KHKK+LK AKG+YGRR  T + A   V R+  +AY  R++KKRDFR L
Sbjct: 1   MARVKRAMHARKKHKKILKLAKGYYGRRSRTFKNANETVLRAMNFAYVGRKLKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+  AGI ++RK+LS++AI    +F  +VE+++ +L  
Sbjct: 61  WIARINAAARMNGLSYSKFMNGIKLAGINMNRKMLSEIAINDEKAFADLVEVAKKQLNA 119


>gi|269126375|ref|YP_003299745.1| 50S ribosomal protein L20 [Thermomonospora curvata DSM 43183]
 gi|268311333|gb|ACY97707.1| ribosomal protein L20 [Thermomonospora curvata DSM 43183]
          Length = 125

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 78/122 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V ++ K + VL+ A+G+ G+R    R AK  +  S  YAYRDR+ +K  FR L
Sbjct: 1   MARVKRAVNAAKKRRVVLERARGYRGQRSRLYRKAKEQMLHSMTYAYRDRKDRKGQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++FI GL  A + +DR++L++LA+   + FK +VEL++  L   
Sbjct: 61  WIQRINAAARANGMTYNRFIQGLKAAELEVDRRMLAELAVNDPEVFKTLVELAKQALPAQ 120

Query: 121 VA 122
            A
Sbjct: 121 DA 122


>gi|46580939|ref|YP_011747.1| 50S ribosomal protein L20 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601760|ref|YP_966160.1| 50S ribosomal protein L20 [Desulfovibrio vulgaris DP4]
 gi|60390489|sp|Q728R8|RL20_DESVH RecName: Full=50S ribosomal protein L20
 gi|166219639|sp|A1VBB7|RL20_DESVV RecName: Full=50S ribosomal protein L20
 gi|46450359|gb|AAS97007.1| ribosomal protein L20 [Desulfovibrio vulgaris str. Hildenborough]
 gi|120561989|gb|ABM27733.1| LSU ribosomal protein L20P [Desulfovibrio vulgaris DP4]
 gi|311234629|gb|ADP87483.1| ribosomal protein L20 [Desulfovibrio vulgaris RCH1]
          Length = 117

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 64/115 (55%), Positives = 86/115 (74%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ +  +HKK L  AKG+ G R    R A+ AV+RS  YA+RDR+VKKR+FR LWI
Sbjct: 2   RVKRGLAAHRRHKKYLDMAKGYRGGRSRLYRTAREAVERSLCYAFRDRKVKKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+  L+YS+F++GL  AG+ L+RKVL+DLA+ + D F KI EL++S+L
Sbjct: 62  LRINAAARLNGLSYSKFMHGLTLAGVELNRKVLADLAVREKDDFAKIAELAKSKL 116


>gi|11467700|ref|NP_050752.1| ribosomal protein L20 [Guillardia theta]
 gi|6093981|sp|O78495|RK20_GUITH RecName: Full=50S ribosomal protein L20, chloroplastic
 gi|3603025|gb|AAC35686.1| ribosomal protein L20 [Guillardia theta]
          Length = 114

 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 76/112 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KRG ++  +HKK+LK AKGF G      R A   V ++ +Y Y  R+ +KR+FRSL
Sbjct: 1   MVRIKRGNIARKRHKKILKLAKGFRGSHSKLFRIANQQVMKALRYGYHGRKRRKREFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVEL 112
           WI RINAAVR+   NYS FIN L +  I L+RK+L+ LA++  ++FK++ ++
Sbjct: 61  WITRINAAVRIEGTNYSCFINSLKRQHIALNRKMLAQLAVSDQNAFKQLTKI 112


>gi|253989349|ref|YP_003040705.1| 50s ribosomal protein l20 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780799|emb|CAQ83961.1| 50s ribosomal protein l20 [Photorhabdus asymbiotica]
          Length = 118

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L+
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKVAFAALVEKAKGALV 118


>gi|146311383|ref|YP_001176457.1| 50S ribosomal protein L20 [Enterobacter sp. 638]
 gi|166984734|sp|A4W9M6|RL20_ENT38 RecName: Full=50S ribosomal protein L20
 gi|145318259|gb|ABP60406.1| LSU ribosomal protein L20P [Enterobacter sp. 638]
          Length = 118

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKLAFTALVEKAKAALA 118


>gi|220912251|ref|YP_002487560.1| 50S ribosomal protein L20 [Arthrobacter chlorophenolicus A6]
 gi|219859129|gb|ACL39471.1| ribosomal protein L20 [Arthrobacter chlorophenolicus A6]
          Length = 153

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 78/122 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ AKG+ G+R    R AK  +  S  Y+Y DR+ KK DFR L
Sbjct: 1   MARVKRAVNAHKKRRVILERAKGYRGQRSRLYRKAKEQLLHSFVYSYGDRKKKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   L Y++ I GL  A + +DR++L++LA++  ++F  +V++++  L  D
Sbjct: 61  WIQRINAASRANGLTYNRLIQGLKAAEVEVDRRMLAELAVSDANAFAALVKVAKDSLPAD 120

Query: 121 VA 122
            +
Sbjct: 121 TS 122


>gi|239625929|ref|ZP_04668960.1| ribosomal protein L20 [Clostridiales bacterium 1_7_47_FAA]
 gi|239520159|gb|EEQ60025.1| ribosomal protein L20 [Clostridiales bacterium 1_7_47FAA]
          Length = 118

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARVKGGLNAKKKHNRVLKMAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  A + L+RK+LSD+AI   + F K+ EL++S++ 
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLAEVDLNRKILSDMAINDAEGFAKLAELAKSKIA 118


>gi|167626329|ref|YP_001676829.1| 50S ribosomal protein L20 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241668762|ref|ZP_04756340.1| 50S ribosomal protein L20 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877293|ref|ZP_05250003.1| 50S ribosomal protein L20 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189041864|sp|B0TY86|RL20_FRAP2 RecName: Full=50S ribosomal protein L20
 gi|167596330|gb|ABZ86328.1| ribosomal protein L20 [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
 gi|254843314|gb|EET21728.1| 50S ribosomal protein L20 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 118

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 68/106 (64%), Positives = 84/106 (79%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVLK AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLKQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KAG+ LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKAGVELDRKALAELAVYNKDAF 106


>gi|163788633|ref|ZP_02183078.1| 50S ribosomal protein L20 [Flavobacteriales bacterium ALC-1]
 gi|159875870|gb|EDP69929.1| 50S ribosomal protein L20 [Flavobacteriales bacterium ALC-1]
          Length = 114

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 77/114 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AVD++ QY+YRDRR KKR FRSL
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGYFGRRKNVWTVAKNAVDKAMQYSYRDRRNKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R + ++YS+F+  L    I L+RKVL+DLA+   ++F+ IV   +
Sbjct: 61  WIMRINAGARQHGMSYSKFMGKLKANNIELNRKVLADLAMNHPEAFEAIVNKVK 114


>gi|157370387|ref|YP_001478376.1| 50S ribosomal protein L20 [Serratia proteamaculans 568]
 gi|270261560|ref|ZP_06189833.1| 50S ribosomal protein L20 [Serratia odorifera 4Rx13]
 gi|166984769|sp|A8GDQ8|RL20_SERP5 RecName: Full=50S ribosomal protein L20
 gi|157322151|gb|ABV41248.1| ribosomal protein L20 [Serratia proteamaculans 568]
 gi|270045044|gb|EFA18135.1| 50S ribosomal protein L20 [Serratia odorifera 4Rx13]
          Length = 118

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA RV  L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARVNGLSYSKFINGLKKASIEIDRKILADIAVFDKVAFGALVEKAKAALA 118


>gi|253580170|ref|ZP_04857437.1| 50S ribosomal protein L20 [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848689|gb|EES76652.1| 50S ribosomal protein L20 [Ruminococcus sp. 5_1_39BFAA]
          Length = 118

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 48/118 (40%), Positives = 74/118 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH + LK AKG+ G R    R AK +V R+   +Y  R+ KKR FR L
Sbjct: 1   MARIKGGLNAKKKHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L++LA+   + F  + E+++  + 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKVANIDINRKMLAELAVNDAEGFAALAEIAKKAIA 118


>gi|284006264|emb|CBA71500.1| 50S ribosomal protein L20 [Arsenophonus nasoniae]
          Length = 118

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 67/118 (56%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+LSD+A+    +F  +VE ++S L 
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILSDIAVFDKVAFAALVEKAKSALA 118


>gi|257056553|ref|YP_003134385.1| 50S ribosomal protein L20P [Saccharomonospora viridis DSM 43017]
 gi|256586425|gb|ACU97558.1| LSU ribosomal protein L20P [Saccharomonospora viridis DSM 43017]
          Length = 125

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 54/121 (44%), Positives = 74/121 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK     S  Y+YRDRR +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRATLELASGYRGQRSRLYRKAKEQTLHSFNYSYRDRRARKGDFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R   + Y++FI GL  AG+ +DRK+L+DLA+    +F  + E+++  L  D
Sbjct: 61  WITRINAAARQNGVTYNRFIQGLKAAGVEVDRKILADLAVNDAAAFASLAEVAKQNLSSD 120

Query: 121 V 121
           V
Sbjct: 121 V 121


>gi|212704418|ref|ZP_03312546.1| hypothetical protein DESPIG_02473 [Desulfovibrio piger ATCC 29098]
 gi|212672139|gb|EEB32622.1| hypothetical protein DESPIG_02473 [Desulfovibrio piger ATCC 29098]
          Length = 116

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 85/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ +  +HKK L +AKGF G R    R A+ AV+RS QY++  R+ +KRDFR+LWI
Sbjct: 2   RVKRGLAAHRRHKKYLSAAKGFRGGRSRLYRTAREAVERSLQYSFIGRKHRKRDFRTLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINA  R+  L+YS+ ++GL+KAGI L+RKVL+DLA+   D F K+VE++++ L
Sbjct: 62  LRINAGARLNGLSYSRLMHGLNKAGIALNRKVLADLAVYHKDDFAKVVEMAKAAL 116


>gi|300716461|ref|YP_003741264.1| 50S ribosomal protein L20 [Erwinia billingiae Eb661]
 gi|299062297|emb|CAX59414.1| 50S ribosomal protein L20 [Erwinia billingiae Eb661]
          Length = 118

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARTNGMSYSRFINGLKKASIEIDRKILADIAVFDKVTFTALVEKAKTALA 118


>gi|225076637|ref|ZP_03719836.1| hypothetical protein NEIFLAOT_01687 [Neisseria flavescens
           NRL30031/H210]
 gi|241758581|ref|ZP_04756696.1| ribosomal protein L20 [Neisseria flavescens SK114]
 gi|261377869|ref|ZP_05982442.1| ribosomal protein L20 [Neisseria cinerea ATCC 14685]
 gi|261379894|ref|ZP_05984467.1| ribosomal protein L20 [Neisseria subflava NJ9703]
 gi|224952043|gb|EEG33252.1| hypothetical protein NEIFLAOT_01687 [Neisseria flavescens
           NRL30031/H210]
 gi|241321233|gb|EER57405.1| ribosomal protein L20 [Neisseria flavescens SK114]
 gi|269145719|gb|EEZ72137.1| ribosomal protein L20 [Neisseria cinerea ATCC 14685]
 gi|284797595|gb|EFC52942.1| ribosomal protein L20 [Neisseria subflava NJ9703]
          Length = 119

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 65/119 (54%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+KV   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKVFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F ++VE +++ L  
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRAAIEIDRKVLADLAVFDKAAFAQLVEKAKAALAA 119


>gi|154174891|ref|YP_001407370.1| 50S ribosomal protein L20 [Campylobacter curvus 525.92]
 gi|166219624|sp|A7GVX8|RL20_CAMC5 RecName: Full=50S ribosomal protein L20
 gi|112802360|gb|EAT99704.1| ribosomal protein L20 [Campylobacter curvus 525.92]
          Length = 118

 Score =  143 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK A+GF+  R    R AK  ++RS  YAYRDRR KKRDFR L
Sbjct: 1   MARVKTGVVRRRRHKKVLKLARGFFSARHKHFRKAKEQLERSLVYAYRDRRQKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ DL+YS+F+NGL KA I LDRK+L+DLA+    +F  + + ++  L
Sbjct: 61  WIVRINAACRLNDLSYSRFMNGLKKANIELDRKILADLAMNDAKAFAALAKQAKDAL 117


>gi|294673349|ref|YP_003573965.1| 50S ribosomal protein L20 [Prevotella ruminicola 23]
 gi|294473009|gb|ADE82398.1| ribosomal protein L20 [Prevotella ruminicola 23]
          Length = 114

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 76/114 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G++G RKN    AK   ++   YAYRDRR KKR+FRSL
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYFGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R   ++YS  +  L KAGI ++RKVL+DLA+   ++FK IVE  +
Sbjct: 61  WIQRINAAARQEGMSYSVLMGNLAKAGIEINRKVLADLAMNNPEAFKAIVEKVK 114


>gi|320353539|ref|YP_004194878.1| 50S ribosomal protein L20P [Desulfobulbus propionicus DSM 2032]
 gi|320122041|gb|ADW17587.1| LSU ribosomal protein L20P [Desulfobulbus propionicus DSM 2032]
          Length = 117

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 74/116 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV RG  +  +  KVL  AKGF G +    + A  AVDR+  YAYRDRRVKKR+FR L
Sbjct: 1   MPRVTRGFKARRRRNKVLTLAKGFRGGKHRLFKTAAEAVDRALCYAYRDRRVKKREFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA +    +YS+ INGL K  I LDRKVLS+LAI   ++F  +V+ S   
Sbjct: 61  WIARINAAAKQNGTSYSRLINGLSKNSIELDRKVLSNLAIVDPNAFSAVVKASGQA 116


>gi|218134267|ref|ZP_03463071.1| hypothetical protein BACPEC_02160 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991642|gb|EEC57648.1| hypothetical protein BACPEC_02160 [Bacteroides pectinophilus ATCC
           43243]
          Length = 119

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 78/119 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKKHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+ GL  A + L+RKVLS++AI   + F K+ E+++S+L  
Sbjct: 61  WIARINAAARMNGLSYSKFMYGLKLANVDLNRKVLSEMAINDAEGFAKLAEVAKSKLAA 119


>gi|254481700|ref|ZP_05094943.1| ribosomal protein L20 [marine gamma proteobacterium HTCC2148]
 gi|214037829|gb|EEB78493.1| ribosomal protein L20 [marine gamma proteobacterium HTCC2148]
          Length = 111

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 60/110 (54%), Positives = 77/110 (70%)

Query: 9   VSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAA 68
           V+  +HKK+LK AKG+YG R    R AK AV ++ QYAYRDRR +KR FR+LWI RINA 
Sbjct: 2   VAHRRHKKILKQAKGYYGARSRVFRVAKQAVTKAGQYAYRDRRQRKRQFRALWITRINAQ 61

Query: 69  VRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
            R   L+YS+ INGL KA I LDR+VL+DLA+    +F  IVE +++ L 
Sbjct: 62  SRANGLSYSRLINGLKKADIALDRRVLADLAVHDKPAFAAIVEQAKASLA 111


>gi|218779647|ref|YP_002430965.1| 50S ribosomal protein L20 [Desulfatibacillum alkenivorans AK-01]
 gi|226730387|sp|B8FFU2|RL20_DESAA RecName: Full=50S ribosomal protein L20
 gi|218761031|gb|ACL03497.1| ribosomal protein L20 [Desulfatibacillum alkenivorans AK-01]
          Length = 116

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 61/111 (54%), Positives = 75/111 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG  +  + KKVLK AKGF G      R A   VDR+  YAYRDRR KKRDFR+LWI
Sbjct: 2   RVKRGFKARRRRKKVLKLAKGFRGGHSKLYRTAADTVDRALMYAYRDRRQKKRDFRALWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
            RINA  R+  L+YS+FI GL +A + LDRKVL++LAI+    F +I  L+
Sbjct: 62  ARINAGARMNGLSYSKFIYGLKQADVALDRKVLAELAISDPACFAEITSLA 112


>gi|118497778|ref|YP_898828.1| 50S ribosomal protein L20 [Francisella tularensis subsp. novicida
           U112]
 gi|194323750|ref|ZP_03057526.1| ribosomal protein L20 [Francisella tularensis subsp. novicida FTE]
 gi|208779841|ref|ZP_03247185.1| ribosomal protein L20 [Francisella novicida FTG]
 gi|166219645|sp|A0Q759|RL20_FRATN RecName: Full=50S ribosomal protein L20
 gi|118423684|gb|ABK90074.1| 50S ribosomal protein L20 [Francisella novicida U112]
 gi|194322114|gb|EDX19596.1| ribosomal protein L20 [Francisella tularensis subsp. novicida FTE]
 gi|208744296|gb|EDZ90596.1| ribosomal protein L20 [Francisella novicida FTG]
          Length = 118

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 68/106 (64%), Positives = 83/106 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KAGI LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKAGIELDRKALAELAVYNKDAF 106


>gi|88608583|ref|YP_506110.1| 50S ribosomal protein L20 [Neorickettsia sennetsu str. Miyayama]
 gi|109893126|sp|Q2GEI6|RL20_NEOSM RecName: Full=50S ribosomal protein L20
 gi|88600752|gb|ABD46220.1| ribosomal protein L20 [Neorickettsia sennetsu str. Miyayama]
          Length = 117

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 69/117 (58%), Positives = 89/117 (76%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV    +HKKV+K AKGF+GR KN  R A   +++S QYAYRDR+V+KRDFRSL
Sbjct: 1   MARVKRGVQVRQRHKKVIKQAKGFHGRSKNCYRIALRRLEKSWQYAYRDRKVRKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YS F+ GL  AG+ ++RKVLS+LAI+Q  +F +IV  +++ L
Sbjct: 61  WIQRINAAVRSFGLVYSVFMKGLKAAGVDVNRKVLSELAISQPSAFGEIVNKAKAAL 117


>gi|323344266|ref|ZP_08084492.1| 50S ribosomal protein L20 [Prevotella oralis ATCC 33269]
 gi|323094995|gb|EFZ37570.1| 50S ribosomal protein L20 [Prevotella oralis ATCC 33269]
          Length = 114

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 61/114 (53%), Positives = 79/114 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  KG+YG RKN    AK   ++   YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNHVASKAKRKRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+ D++YSQ +  LHKAGI ++RKVL+DLA+   ++FK IV+  +
Sbjct: 61  WIQRINAAARLQDMSYSQLMGALHKAGIEINRKVLADLAVNNPEAFKAIVDKVK 114


>gi|116618536|ref|YP_818907.1| 50S ribosomal protein L20P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227431921|ref|ZP_03913943.1| ribosomal protein L20 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|122271264|sp|Q03W88|RL20_LEUMM RecName: Full=50S ribosomal protein L20
 gi|116097383|gb|ABJ62534.1| LSU ribosomal protein L20P [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227352325|gb|EEJ42529.1| ribosomal protein L20 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
          Length = 139

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 83/118 (70%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G VS A+ KK +K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVSRARRKKFVKLAKGYRGQRRINYKVAKQQVYKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG+ L+RK+L+++A++  D+F K+ + +++ L  D
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGVELNRKMLAEIAVSDFDTFTKLADQAKAALSSD 119


>gi|82777064|ref|YP_403413.1| 50S ribosomal protein L20 [Shigella dysenteriae Sd197]
 gi|309788456|ref|ZP_07683060.1| ribosomal protein L20 [Shigella dysenteriae 1617]
 gi|109893152|sp|Q32FI3|RL20_SHIDS RecName: Full=50S ribosomal protein L20
 gi|81241212|gb|ABB61922.1| 50S ribosomal subunit protein L20 [Shigella dysenteriae Sd197]
 gi|308923838|gb|EFP69341.1| ribosomal protein L20 [Shigella dysenteriae 1617]
          Length = 118

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 62/118 (52%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++  +HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARTRHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAALA 118


>gi|299830370|ref|YP_003734585.1| ribosomal protein L20 [Kryptoperidinium foliaceum]
 gi|297385072|gb|ADI40370.1| ribosomal protein L20 [Kryptoperidinium foliaceum]
          Length = 114

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 68/111 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+  + KKVL  A G+ G      R A   V ++ +Y+Y  R+ KKR FR +
Sbjct: 1   MVRVKRGNVARKRRKKVLSLASGYRGAHSVLFRVANQQVMKALRYSYIGRKQKKRIFRRI 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINA  R+  ++YSQ IN   K+ I L+RK+LS +AI    +FK +++
Sbjct: 61  WISRINATSRLNGISYSQLINKFKKSNIDLNRKMLSQIAILDSSTFKSLIQ 111


>gi|116782437|gb|ABK22506.1| unknown [Picea sitchensis]
          Length = 125

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 58/102 (56%), Positives = 76/102 (74%)

Query: 17  VLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNY 76
           +LK AKGF GR KN IR A+  V+++ QY+YRDRR KKRD R LWIQRINA  R++ +NY
Sbjct: 6   ILKLAKGFRGRAKNCIRVARERVEKALQYSYRDRRNKKRDMRGLWIQRINAGTRLHGVNY 65

Query: 77  SQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
            QFI+GL K  I L+RKVLS+LA+ +  SFK +VE++R+   
Sbjct: 66  GQFIHGLTKENIQLNRKVLSELAMHEPYSFKSLVEIARNAFP 107


>gi|320539028|ref|ZP_08038703.1| 50S ribosomal subunit protein L20 [Serratia symbiotica str. Tucson]
 gi|320030961|gb|EFW12965.1| 50S ribosomal subunit protein L20 [Serratia symbiotica str. Tucson]
          Length = 118

 Score =  143 bits (363), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK++K AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKIMKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L+
Sbjct: 61  WIARINAAARQSGLSYSKFINGLKKASIEIDRKILADIAVFDKVAFSTLVEKAKAALV 118


>gi|18860334|ref|NP_569652.1| ribosomal protein L20 [Psilotum nudum]
 gi|22654042|sp|Q8WHZ8|RK20_PSINU RecName: Full=50S ribosomal protein L20, chloroplastic
 gi|18389487|dbj|BAB84239.1| ribosomal protein L20 [Psilotum nudum]
          Length = 114

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 46/114 (40%), Positives = 63/114 (55%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+     ++L    GF G      R A     ++  YAYRDR   KRDFR L
Sbjct: 1   MTRVKRGYVARRHRNRILALTSGFQGAHSKLFRTANQQGMKALTYAYRDRANCKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R   + Y+  I+ L+   I L+RK+L+ +A    D F +I+ + +
Sbjct: 61  WITRINAAARENQITYNNMIHSLYMNQIHLNRKILAQIAALDKDCFVEILRIIK 114


>gi|225028459|ref|ZP_03717651.1| hypothetical protein EUBHAL_02733 [Eubacterium hallii DSM 3353]
 gi|224954209|gb|EEG35418.1| hypothetical protein EUBHAL_02733 [Eubacterium hallii DSM 3353]
          Length = 118

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 53/118 (44%), Positives = 75/118 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  + +  +H + LK AKG+ G R    R AK +V R+   AY  R+ KKR FR L
Sbjct: 1   MARVKGAIGAKKRHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSAYAGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  AG+ ++RK+LS++AI     F  + EL++S+L 
Sbjct: 61  WIARINAAARMNGLSYSKFMYGLKLAGVEVNRKMLSEMAIADPAGFAALAELAKSKLA 118


>gi|258544545|ref|ZP_05704779.1| inorganic diphosphatase [Cardiobacterium hominis ATCC 15826]
 gi|258520176|gb|EEV89035.1| inorganic diphosphatase [Cardiobacterium hominis ATCC 15826]
          Length = 117

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 62/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL +AKG+Y  R+   R AK AV ++ QYAYRDR+ +KR FR L
Sbjct: 1   MARVKRGVTARARHKKVLAAAKGYYNARRKVFRIAKQAVIKAGQYAYRDRKARKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINA  R + L+YS+FINGL K+GI +DRK+L++LA+     F  + E +++ L
Sbjct: 61  WIIRINAGARQHGLSYSRFINGLKKSGIAIDRKMLAELAVYNKQVFAVLAEKAKAAL 117


>gi|167758933|ref|ZP_02431060.1| hypothetical protein CLOSCI_01279 [Clostridium scindens ATCC 35704]
 gi|167663340|gb|EDS07470.1| hypothetical protein CLOSCI_01279 [Clostridium scindens ATCC 35704]
          Length = 118

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 48/118 (40%), Positives = 76/118 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  +H + LK AKG+ G R    R AK +V R+   AY  R+ +KR  R L
Sbjct: 1   MARIKGGLNAKKRHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSAYAGRKQRKRQMRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F++GL  A I ++RK+L++LA+   + F  + EL+++++ 
Sbjct: 61  WIARINAAARMNGLSYSKFMHGLKLANIDVNRKMLAELAVNDAEGFATLAELAKAKVA 118


>gi|50121347|ref|YP_050514.1| 50S ribosomal protein L20 [Pectobacterium atrosepticum SCRI1043]
 gi|227111542|ref|ZP_03825198.1| 50S ribosomal protein L20 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227327042|ref|ZP_03831066.1| 50S ribosomal protein L20 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|253688278|ref|YP_003017468.1| ribosomal protein L20 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261821454|ref|YP_003259560.1| 50S ribosomal protein L20 [Pectobacterium wasabiae WPP163]
 gi|60390384|sp|Q6D4H1|RL20_ERWCT RecName: Full=50S ribosomal protein L20
 gi|259646193|sp|C6DFY9|RL20_PECCP RecName: Full=50S ribosomal protein L20
 gi|49611873|emb|CAG75322.1| 50S ribosomal protein L20 [Pectobacterium atrosepticum SCRI1043]
 gi|251754856|gb|ACT12932.1| ribosomal protein L20 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|261605467|gb|ACX87953.1| ribosomal protein L20 [Pectobacterium wasabiae WPP163]
          Length = 118

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKLAFSALVEKAKAALA 118


>gi|56698420|ref|YP_168793.1| 50S ribosomal protein L20 [Ruegeria pomeroyi DSS-3]
 gi|81819908|sp|Q5LMG5|RL20_SILPO RecName: Full=50S ribosomal protein L20
 gi|56680157|gb|AAV96823.1| ribosomal protein L20 [Ruegeria pomeroyi DSS-3]
          Length = 121

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 69/112 (61%), Positives = 92/112 (82%), Gaps = 2/112 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKVLK+AKG+YGRRK++ + A  AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVLKAAKGYYGRRKSSFKVATQAVDKANQYATRDRKARKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIV 112


>gi|262374870|ref|ZP_06068104.1| ribosomal protein L20 [Acinetobacter lwoffii SH145]
 gi|262309883|gb|EEY91012.1| ribosomal protein L20 [Acinetobacter lwoffii SH145]
          Length = 119

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 78/119 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVQAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+ I GL KA +++DR+VL+D+A+    +F  +   ++  L  
Sbjct: 61  WIARINAGARQNGLSYSRMIAGLKKAQVIIDRRVLADIAMHDAIAFAALASKAKDALAA 119


>gi|197118375|ref|YP_002138802.1| 50S ribosomal protein L20 [Geobacter bemidjiensis Bem]
 gi|253700845|ref|YP_003022034.1| 50S ribosomal protein L20 [Geobacter sp. M21]
 gi|226730403|sp|B5EBY2|RL20_GEOBB RecName: Full=50S ribosomal protein L20
 gi|259646187|sp|C6DYJ2|RL20_GEOSM RecName: Full=50S ribosomal protein L20
 gi|197087735|gb|ACH39006.1| ribosomal protein L20 [Geobacter bemidjiensis Bem]
 gi|251775695|gb|ACT18276.1| ribosomal protein L20 [Geobacter sp. M21]
          Length = 117

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 58/106 (54%), Positives = 76/106 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  L+YS+ I+GL  A + +DRKV++DLA++  + F
Sbjct: 61  WITRINAAARINGLSYSKLIHGLKLANVEIDRKVMADLAVSDPNGF 106


>gi|11466409|ref|NP_038413.1| ribosomal protein L20 [Mesostigma viride]
 gi|14195140|sp|Q9MUP7|RK20_MESVI RecName: Full=50S ribosomal protein L20, chloroplastic
 gi|7259552|gb|AAF43853.1|AF166114_65 ribosomal protein L20 [Mesostigma viride]
          Length = 115

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 72/115 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+     K+L  AKGF G      R A   + +S +YAYRDR  KKRDFR L
Sbjct: 1   MTRVKRGNVARKHRNKILNLAKGFRGAHSVLFRTANQQIIKSLRYAYRDRARKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA R  +++YSQ IN L  + I+L+RK+L+ +A+     F +IV  S S
Sbjct: 61  WIARINAASRQNNISYSQLINQLKTSNILLNRKILAQIALLDGPVFSQIVMESNS 115


>gi|326336125|ref|ZP_08202297.1| 50S ribosomal protein L20 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325691634|gb|EGD33601.1| 50S ribosomal protein L20 [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 114

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 60/114 (52%), Positives = 78/114 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KK++K AKG++GRRKN    AK AV+++  YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNAVARRARRKKIMKQAKGYFGRRKNVWTVAKNAVEKALVYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA VR Y L+YS+F+  L    I L+RKVL+DLA+   ++FK IVE  +
Sbjct: 61  WIVRINAGVRPYGLSYSKFMGALRANEIELNRKVLADLAMNHPEAFKAIVEKVK 114


>gi|296394204|ref|YP_003659088.1| 50S ribosomal protein L20 [Segniliparus rotundus DSM 44985]
 gi|296181351|gb|ADG98257.1| ribosomal protein L20 [Segniliparus rotundus DSM 44985]
          Length = 127

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+++KG+ G+R    R AK    RS  YA+RDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRTILEASKGYRGQRSRMYRKAKEQQLRSLVYAFRDRRARKGEFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L Y++FI GL  AG+ +DRK+L++LA+ +   F ++VE ++  + 
Sbjct: 61  WITRINAAARANGLTYNRFIQGLALAGVEVDRKILAELAVNEPQVFAQLVEAAKEAVA 118


>gi|304317238|ref|YP_003852383.1| ribosomal protein L20 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302778740|gb|ADL69299.1| ribosomal protein L20 [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 119

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 82/119 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+  +HKK+LK AKG+YG +    R A  AV +S  YAY  R+++KRDFR L
Sbjct: 1   MSRVKSGKVTRRRHKKILKLAKGYYGAKSKLFRVANQAVMKSLNYAYIGRKLRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   ++YS+FINGL KA I ++RK+LS++AI    +F  +V +++ +L  
Sbjct: 61  WIARINAAARANGISYSRFINGLKKANIEINRKMLSEMAIHDNKAFADLVNIAKQQLNA 119


>gi|290968294|ref|ZP_06559836.1| ribosomal protein L20 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781653|gb|EFD94239.1| ribosomal protein L20 [Megasphaera genomosp. type_1 str. 28L]
          Length = 116

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 60/116 (51%), Positives = 86/116 (74%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K GV + A+HKK++K AKG+ G R    + A  +V ++  YA RDRRVKKR+FR L
Sbjct: 1   MARIKVGVTAHARHKKIIKMAKGYRGTRSRLFKKANESVMKALFYARRDRRVKKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA RV+ L+YS+FI GL KAG+ +DRK+L+DLA+    +F K+VE+++++
Sbjct: 61  WIARINAATRVHGLSYSRFICGLTKAGVAVDRKMLADLAVNDAAAFAKLVEVAKAQ 116


>gi|22125798|ref|NP_669221.1| 50S ribosomal protein L20 [Yersinia pestis KIM 10]
 gi|45442008|ref|NP_993547.1| 50S ribosomal protein L20 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51596663|ref|YP_070854.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis IP 32953]
 gi|108807770|ref|YP_651686.1| 50S ribosomal protein L20 [Yersinia pestis Antiqua]
 gi|108812047|ref|YP_647814.1| 50S ribosomal protein L20 [Yersinia pestis Nepal516]
 gi|145598023|ref|YP_001162099.1| 50S ribosomal protein L20 [Yersinia pestis Pestoides F]
 gi|149365661|ref|ZP_01887696.1| 50S ribosomal protein L20 [Yersinia pestis CA88-4125]
 gi|153947105|ref|YP_001400692.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis IP 31758]
 gi|162419875|ref|YP_001607029.1| 50S ribosomal protein L20 [Yersinia pestis Angola]
 gi|165927521|ref|ZP_02223353.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939532|ref|ZP_02228078.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011787|ref|ZP_02232685.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166210504|ref|ZP_02236539.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167400939|ref|ZP_02306445.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422078|ref|ZP_02313831.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425028|ref|ZP_02316781.1| ribosomal protein L20 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170024062|ref|YP_001720567.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis YPIII]
 gi|186895719|ref|YP_001872831.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis PB1/+]
 gi|218929519|ref|YP_002347394.1| 50S ribosomal protein L20 [Yersinia pestis CO92]
 gi|229837957|ref|ZP_04458116.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229895118|ref|ZP_04510294.1| 50S ribosomal subunit protein L20 [Yersinia pestis Pestoides A]
 gi|229898518|ref|ZP_04513663.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229902359|ref|ZP_04517479.1| 50S ribosomal subunit protein L20 [Yersinia pestis Nepal516]
 gi|270490461|ref|ZP_06207535.1| ribosomal protein L20 [Yersinia pestis KIM D27]
 gi|294503568|ref|YP_003567630.1| 50S ribosomal protein L20 [Yersinia pestis Z176003]
 gi|20978603|sp|Q8ZDW8|RL20_YERPE RecName: Full=50S ribosomal protein L20
 gi|60390352|sp|Q669Z3|RL20_YERPS RecName: Full=50S ribosomal protein L20
 gi|122383263|sp|Q1C731|RL20_YERPA RecName: Full=50S ribosomal protein L20
 gi|122384740|sp|Q1CIG6|RL20_YERPN RecName: Full=50S ribosomal protein L20
 gi|166220806|sp|A4TIL4|RL20_YERPP RecName: Full=50S ribosomal protein L20
 gi|166984824|sp|A7FHG4|RL20_YERP3 RecName: Full=50S ribosomal protein L20
 gi|226730479|sp|B2K665|RL20_YERPB RecName: Full=50S ribosomal protein L20
 gi|226730480|sp|A9R0A5|RL20_YERPG RecName: Full=50S ribosomal protein L20
 gi|226730481|sp|B1JJ20|RL20_YERPY RecName: Full=50S ribosomal protein L20
 gi|21958724|gb|AAM85472.1|AE013793_8 50S ribosomal subunit protein L20 [Yersinia pestis KIM 10]
 gi|45436871|gb|AAS62424.1| 50S ribosomal protein L20 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51589945|emb|CAH21577.1| 50S ribosomal protein L20 [Yersinia pseudotuberculosis IP 32953]
 gi|108775695|gb|ABG18214.1| LSU ribosomal protein L20P [Yersinia pestis Nepal516]
 gi|108779683|gb|ABG13741.1| LSU ribosomal protein L20P [Yersinia pestis Antiqua]
 gi|115348130|emb|CAL21058.1| 50S ribosomal protein L20 [Yersinia pestis CO92]
 gi|145209719|gb|ABP39126.1| LSU ribosomal protein L20P [Yersinia pestis Pestoides F]
 gi|149292074|gb|EDM42148.1| 50S ribosomal protein L20 [Yersinia pestis CA88-4125]
 gi|152958600|gb|ABS46061.1| ribosomal protein L20 [Yersinia pseudotuberculosis IP 31758]
 gi|162352690|gb|ABX86638.1| ribosomal protein L20 [Yersinia pestis Angola]
 gi|165912581|gb|EDR31212.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165920576|gb|EDR37853.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989252|gb|EDR41553.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166207684|gb|EDR52164.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166958890|gb|EDR55911.1| ribosomal protein L20 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049792|gb|EDR61200.1| ribosomal protein L20 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167056215|gb|EDR65993.1| ribosomal protein L20 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169750596|gb|ACA68114.1| ribosomal protein L20 [Yersinia pseudotuberculosis YPIII]
 gi|186698745|gb|ACC89374.1| ribosomal protein L20 [Yersinia pseudotuberculosis PB1/+]
 gi|229680694|gb|EEO76790.1| 50S ribosomal subunit protein L20 [Yersinia pestis Nepal516]
 gi|229688066|gb|EEO80137.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229694323|gb|EEO84370.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229701880|gb|EEO89903.1| 50S ribosomal subunit protein L20 [Yersinia pestis Pestoides A]
 gi|262361610|gb|ACY58331.1| 50S ribosomal protein L20 [Yersinia pestis D106004]
 gi|262365649|gb|ACY62206.1| 50S ribosomal protein L20 [Yersinia pestis D182038]
 gi|270338965|gb|EFA49742.1| ribosomal protein L20 [Yersinia pestis KIM D27]
 gi|294354027|gb|ADE64368.1| 50S ribosomal protein L20 [Yersinia pestis Z176003]
 gi|320015087|gb|ADV98658.1| 50S ribosomal subunit protein L20 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 118

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKAALA 118


>gi|291523569|emb|CBK81862.1| LSU ribosomal protein L20P [Coprococcus catus GD/7]
          Length = 118

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 50/118 (42%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKKHNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  AG+ ++RK+LS++AI+   +F  + E ++++L 
Sbjct: 61  WIARINAAARMNGLSYSKLMHGLKLAGVEVNRKMLSEMAISDAAAFTALCETAKAKLA 118


>gi|238749479|ref|ZP_04610984.1| 50S ribosomal protein L20 [Yersinia rohdei ATCC 43380]
 gi|238712134|gb|EEQ04347.1| 50S ribosomal protein L20 [Yersinia rohdei ATCC 43380]
          Length = 118

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKAALA 118


>gi|291617250|ref|YP_003519992.1| RplT [Pantoea ananatis LMG 20103]
 gi|291152280|gb|ADD76864.1| RplT [Pantoea ananatis LMG 20103]
 gi|327393704|dbj|BAK11126.1| 50S ribosomal protein L20 RplT [Pantoea ananatis AJ13355]
          Length = 118

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++S L 
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKAAIEIDRKILADIAVFDKVAFTALVEKAKSALA 118


>gi|304397619|ref|ZP_07379496.1| ribosomal protein L20 [Pantoea sp. aB]
 gi|308186649|ref|YP_003930780.1| 50S ribosomal protein L20 [Pantoea vagans C9-1]
 gi|304354791|gb|EFM19161.1| ribosomal protein L20 [Pantoea sp. aB]
 gi|308057159|gb|ADO09331.1| 50S ribosomal protein L20 [Pantoea vagans C9-1]
          Length = 118

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++S L 
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKAAIEIDRKILADIAVFDKVAFSALVEKAKSALA 118


>gi|78357678|ref|YP_389127.1| 50S ribosomal protein L20 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|109893112|sp|Q30Y14|RL20_DESDG RecName: Full=50S ribosomal protein L20
 gi|78220083|gb|ABB39432.1| LSU ribosomal protein L20P [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 117

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 84/116 (72%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG+ +  +HKK LK AKG+ G R    R A+ AV+RS  Y+ RDR+V+KR+FR LWI
Sbjct: 2   RVKRGMATHRRHKKYLKMAKGYRGGRSKLYRTAREAVERSLAYSTRDRKVRKREFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
            RINAA R   ++YS+FI+GL  AGI L+RKVL+DLA+ + + F K+ EL +S+L 
Sbjct: 62  LRINAAARENGVSYSKFIHGLALAGIELNRKVLADLAVREKEDFAKLAELVKSKLS 117


>gi|290475544|ref|YP_003468432.1| 50S ribosomal subunit protein L20 [Xenorhabdus bovienii SS-2004]
 gi|300722781|ref|YP_003712072.1| 50S ribosomal subunit protein L20 [Xenorhabdus nematophila ATCC
           19061]
 gi|289174865|emb|CBJ81666.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Xenorhabdus bovienii SS-2004]
 gi|297629289|emb|CBJ89888.1| 50S ribosomal subunit protein L20, also posttranslational
           autoregulator [Xenorhabdus nematophila ATCC 19061]
          Length = 118

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASIEIDRKILADIAVFDKVAFAALVEKAKGALA 118


>gi|325662118|ref|ZP_08150736.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331085915|ref|ZP_08334998.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325471567|gb|EGC74787.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330406838|gb|EGG86343.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 118

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 50/118 (42%), Positives = 75/118 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH + LK AKG+ G R    R AK +V R+   +Y  R+ +KR  R L
Sbjct: 1   MARIKGGMNARKKHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQMRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  AG+ ++RK+L+D+AI     F  + E+++S+L 
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLAGVEMNRKILADMAINDAQGFATLAEVAKSKLA 118


>gi|294636230|ref|ZP_06714644.1| ribosomal protein L20 [Edwardsiella tarda ATCC 23685]
 gi|291090487|gb|EFE23048.1| ribosomal protein L20 [Edwardsiella tarda ATCC 23685]
          Length = 118

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKAALA 118


>gi|332090641|gb|EGI95736.1| ribosomal protein L20 [Shigella boydii 5216-82]
          Length = 118

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAVLA 118


>gi|37526557|ref|NP_929901.1| 50S ribosomal protein L20 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|39931728|sp|Q7N3P9|RL20_PHOLL RecName: Full=50S ribosomal protein L20
 gi|36785988|emb|CAE15040.1| 50S ribosomal protein L20 [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 118

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FI+GL KA I +DRK+L+D+A+    +F  +VE ++S L 
Sbjct: 61  WIARINAAARQNGLSYSRFIDGLKKASIEIDRKILADIAVFDKVAFAALVEKAKSALA 118


>gi|148544463|ref|YP_001271833.1| 50S ribosomal protein L20 [Lactobacillus reuteri DSM 20016]
 gi|184153828|ref|YP_001842169.1| 50S ribosomal protein L20 [Lactobacillus reuteri JCM 1112]
 gi|227363109|ref|ZP_03847244.1| ribosomal protein L20 [Lactobacillus reuteri MM2-3]
 gi|325682785|ref|ZP_08162301.1| 50S ribosomal protein L20 [Lactobacillus reuteri MM4-1A]
 gi|215274799|sp|A5VKX2|RL20_LACRD RecName: Full=50S ribosomal protein L20
 gi|215274800|sp|B2G8A7|RL20_LACRJ RecName: Full=50S ribosomal protein L20
 gi|148531497|gb|ABQ83496.1| LSU ribosomal protein L20P [Lactobacillus reuteri DSM 20016]
 gi|183225172|dbj|BAG25689.1| 50S ribosomal protein L20 [Lactobacillus reuteri JCM 1112]
 gi|227071827|gb|EEI10115.1| ribosomal protein L20 [Lactobacillus reuteri MM2-3]
 gi|324977135|gb|EGC14086.1| 50S ribosomal protein L20 [Lactobacillus reuteri MM4-1A]
          Length = 117

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 80/115 (69%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ K+++K AKG+ G +    + AK  V +S  YA+RDR+V KR FR LWI
Sbjct: 2   RVKGGTVTRARRKRIMKLAKGYRGSKHRLFKTAKDQVMKSYAYAFRDRKVNKRKFRELWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R+ D++YS+ ++GL  A I ++RK+L+DLA+   D+FK +V+ ++  L
Sbjct: 62  ARINAAARMNDISYSKLMHGLKVANIDINRKMLADLAVNDADAFKALVDEAKKAL 116


>gi|304559083|gb|ADM41747.1| LSU ribosomal protein L20p [Edwardsiella tarda FL6-60]
          Length = 118

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAALA 118


>gi|260432657|ref|ZP_05786628.1| ribosomal protein L20 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416485|gb|EEX09744.1| ribosomal protein L20 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 121

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 70/112 (62%), Positives = 93/112 (83%), Gaps = 2/112 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRKNT + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVVKAAKGYYGRRKNTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIV 112


>gi|228472719|ref|ZP_04057477.1| ribosomal protein L20 [Capnocytophaga gingivalis ATCC 33624]
 gi|228275770|gb|EEK14536.1| ribosomal protein L20 [Capnocytophaga gingivalis ATCC 33624]
          Length = 114

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 60/114 (52%), Positives = 78/114 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KK++K AKG++GRRKN    AK AV+++  YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNAVARRARRKKIMKQAKGYFGRRKNVWTVAKNAVEKALVYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA VR Y L+YS+F+  L    I L+RKVL+DLA+   ++FK IVE  +
Sbjct: 61  WIVRINAGVRPYGLSYSKFMGALKANKIELNRKVLADLALNHPEAFKAIVEKVK 114


>gi|134301675|ref|YP_001121643.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|254373135|ref|ZP_04988624.1| 50S ribosomal protein L20 [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254374588|ref|ZP_04990069.1| 50S ribosomal protein L20 [Francisella novicida GA99-3548]
 gi|166219646|sp|A4IX71|RL20_FRATW RecName: Full=50S ribosomal protein L20
 gi|134049452|gb|ABO46523.1| ribosomal protein L20 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|151570862|gb|EDN36516.1| 50S ribosomal protein L20 [Francisella novicida GA99-3549]
 gi|151572307|gb|EDN37961.1| 50S ribosomal protein L20 [Francisella novicida GA99-3548]
 gi|332184281|gb|AEE26535.1| LSU ribosomal protein L20p [Francisella cf. novicida 3523]
 gi|332678494|gb|AEE87623.1| LSU ribosomal protein L20p [Francisella cf. novicida Fx1]
          Length = 118

 Score =  143 bits (362), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 83/106 (78%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KAG+ LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKAGVELDRKALAELAVYNKDAF 106


>gi|123442192|ref|YP_001006173.1| 50S ribosomal protein L20 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238757780|ref|ZP_04618963.1| 50S ribosomal protein L20 [Yersinia aldovae ATCC 35236]
 gi|238765298|ref|ZP_04626225.1| 50S ribosomal protein L20 [Yersinia kristensenii ATCC 33638]
 gi|332161614|ref|YP_004298191.1| 50S ribosomal protein L20 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|166220805|sp|A1JMK7|RL20_YERE8 RecName: Full=50S ribosomal protein L20
 gi|122089153|emb|CAL11995.1| 50S ribosomal protein L20 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238696471|gb|EEP89261.1| 50S ribosomal protein L20 [Yersinia kristensenii ATCC 33638]
 gi|238704023|gb|EEP96557.1| 50S ribosomal protein L20 [Yersinia aldovae ATCC 35236]
 gi|318605895|emb|CBY27393.1| LSU ribosomal protein L20p [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665844|gb|ADZ42488.1| 50S ribosomal protein L20 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861022|emb|CBX71294.1| 50S ribosomal protein L20 [Yersinia enterocolitica W22703]
          Length = 118

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 86/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R  D++YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNDMSYSKFINGLKKASIEIDRKILADIAVFDKVAFSALVEKAKAALA 118


>gi|308272686|emb|CBX29290.1| 50S ribosomal protein L20 [uncultured Desulfobacterium sp.]
          Length = 116

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 58/111 (52%), Positives = 74/111 (66%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRG  +  + KKVLK AKGF G      R A   VDR+  YAYRDR+  KRDFR LWI
Sbjct: 2   RVKRGFKARRRRKKVLKLAKGFRGGHSKLFRTAADTVDRALAYAYRDRKACKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
            RINAA R+ +L+YS+ I+GL  A I LDRKVL++LAI+  + F  +  ++
Sbjct: 62  VRINAAARMNNLSYSKLIHGLKIANIDLDRKVLAELAISDPNGFAHLAGIA 112


>gi|317124677|ref|YP_004098789.1| 50S ribosomal protein L20P [Intrasporangium calvum DSM 43043]
 gi|315588765|gb|ADU48062.1| LSU ribosomal protein L20P [Intrasporangium calvum DSM 43043]
          Length = 128

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 59/119 (49%), Positives = 77/119 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDRR KK DFR L
Sbjct: 1   MARVKRAVNAQKKRRVVLERASGYRGQRSRLYRKAKEQVTHSLGYAYRDRRAKKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAA R   + Y++F+ GL  AG+ +DRK+L+DLA+    +F  +VE+SR  + V
Sbjct: 61  WIQRINAAARANGMTYNRFMQGLKAAGVEVDRKILADLAVNDAPAFAALVEISRVNVPV 119


>gi|317502975|ref|ZP_07961064.1| 50S ribosomal protein L20 [Prevotella salivae DSM 15606]
 gi|315665911|gb|EFV05489.1| 50S ribosomal protein L20 [Prevotella salivae DSM 15606]
          Length = 114

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 78/114 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+ +++YS  +  LHKAGI ++RKVL+DLA+   ++FK IV+  +
Sbjct: 61  WIQRINAAARLENMSYSTLMGALHKAGIEINRKVLADLAVNNPEAFKAIVDKVK 114


>gi|288928016|ref|ZP_06421863.1| ribosomal protein L20 [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330850|gb|EFC69434.1| ribosomal protein L20 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 114

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 75/114 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNHVASKARRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+ ++ YS  +  LHKAGI ++RKVL+DLA+    +FK IV+  +
Sbjct: 61  WIQRINAAARLENMTYSTLMGALHKAGIEINRKVLADLAVNNPQAFKAIVDKVK 114


>gi|86143060|ref|ZP_01061482.1| 50S ribosomal protein L20 [Leeuwenhoekiella blandensis MED217]
 gi|85830505|gb|EAQ48964.1| 50S ribosomal protein L20 [Leeuwenhoekiella blandensis MED217]
          Length = 114

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 80/114 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV+++  YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGYFGRRKNVYTVAKNAVEKAMLYAYRDRRQKKRNFRTL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R++ ++YSQF+  +  A I L+RKVL+DLA+   ++F+ IV   +
Sbjct: 61  WITRINAGARMHGMSYSQFMGKVKAANIELNRKVLADLAMNHPEAFEAIVNKVK 114


>gi|281423153|ref|ZP_06254066.1| ribosomal protein L20 [Prevotella oris F0302]
 gi|299140593|ref|ZP_07033731.1| ribosomal protein L20 [Prevotella oris C735]
 gi|281402489|gb|EFB33320.1| ribosomal protein L20 [Prevotella oris F0302]
 gi|298577559|gb|EFI49427.1| ribosomal protein L20 [Prevotella oris C735]
          Length = 114

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 78/114 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+ +++YS  +  LHKAGI ++RKVL+DLA+   ++FK IVE  +
Sbjct: 61  WIQRINAAARLENMSYSTLMGALHKAGIEINRKVLADLAVNNPEAFKAIVEKVK 114


>gi|187933830|ref|YP_001886666.1| 50S ribosomal protein L20 [Clostridium botulinum B str. Eklund 17B]
 gi|188589172|ref|YP_001921628.1| 50S ribosomal protein L20 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251778142|ref|ZP_04821062.1| 50S ribosomal protein L20 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|226730376|sp|B2V599|RL20_CLOBA RecName: Full=50S ribosomal protein L20
 gi|226730377|sp|B2TS59|RL20_CLOBB RecName: Full=50S ribosomal protein L20
 gi|187721983|gb|ACD23204.1| 50S ribosomal protein L20 [Clostridium botulinum B str. Eklund 17B]
 gi|188499453|gb|ACD52589.1| 50S ribosomal protein L20 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|243082457|gb|EES48347.1| 50S ribosomal protein L20 [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 119

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 54/119 (45%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR   +   HKKVLK AKG+YG +    + A  +V R+ + +Y  R+ KKRD+R L
Sbjct: 1   MARVKRAKNARKNHKKVLKLAKGYYGGKSKLFKTANESVIRALRNSYVGRKNKKRDYRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+  L+YS+F+NG+  AGI ++RK+LS++AI    +F  +VE+++ +L  
Sbjct: 61  WIARINAATRINGLSYSKFMNGIKLAGIDINRKMLSEIAINDAKAFADLVEVAKKQLNA 119


>gi|94264272|ref|ZP_01288066.1| Ribosomal protein L20 [delta proteobacterium MLMS-1]
 gi|94266798|ref|ZP_01290463.1| Ribosomal protein L20 [delta proteobacterium MLMS-1]
 gi|93452541|gb|EAT03127.1| Ribosomal protein L20 [delta proteobacterium MLMS-1]
 gi|93455317|gb|EAT05524.1| Ribosomal protein L20 [delta proteobacterium MLMS-1]
          Length = 116

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 57/115 (49%), Positives = 75/115 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV RG  +  + KKVLK A GF G R    R+A  AVDR+  YAYRDRR KKRDFR L
Sbjct: 1   MPRVARGFKARRRRKKVLKMASGFVGGRHRLYRSATEAVDRALCYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RI AA   +   YS+ + GL K+ + LDRKVL+++AI     F ++V++S++
Sbjct: 61  WIVRIGAAAHDHGTTYSRLMGGLKKSQVDLDRKVLANMAIMDPAGFAEVVKISQA 115


>gi|82524024|emb|CAI78702.1| Ribosomal protein L20 [uncultured Flavobacteriaceae bacterium]
          Length = 114

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 61/114 (53%), Positives = 77/114 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKGF+GRRKN    AK AVD++  Y+YRDRR KKR FR+L
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGFFGRRKNVWTVAKNAVDKAMLYSYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R Y L+YSQF+  L    I L+RKVL+DLA+   ++FK ++E  +
Sbjct: 61  WITRINAGARQYGLSYSQFMGKLKANDIELNRKVLADLAMNNPEAFKAVIEKVK 114


>gi|154502800|ref|ZP_02039860.1| hypothetical protein RUMGNA_00614 [Ruminococcus gnavus ATCC 29149]
 gi|153796683|gb|EDN79103.1| hypothetical protein RUMGNA_00614 [Ruminococcus gnavus ATCC 29149]
          Length = 118

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH + LK AKG+ G R    R AK +V R+   AY  R+ +KR  R L
Sbjct: 1   MARIKGGMNAKKKHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSAYAGRKERKRQMRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F++GL  AG+ ++RK+L++LA++  + F  + EL++S+L 
Sbjct: 61  WIARINAAARMNGLSYSKFMHGLKVAGVDMNRKMLAELAVSDKEGFATLAELAKSKLA 118


>gi|262369837|ref|ZP_06063164.1| 50S ribosomal protein L20 [Acinetobacter johnsonii SH046]
 gi|262314876|gb|EEY95916.1| 50S ribosomal protein L20 [Acinetobacter johnsonii SH046]
          Length = 119

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 79/119 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+L  AKG+YG R    R A  AV ++ QYAYRDRR KKR FR+L
Sbjct: 1   MARVKRGVQAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQKKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R+  L+YS+ I GL KA +++DR+VL+D+A+    +F  +   ++  L  
Sbjct: 61  WIARINAGARLNGLSYSRMIAGLKKAQVIIDRRVLADIAMHDAVAFAALASKAKDALAA 119


>gi|333029964|ref|ZP_08458025.1| 50S ribosomal protein L20 [Bacteroides coprosuis DSM 18011]
 gi|332740561|gb|EGJ71043.1| 50S ribosomal protein L20 [Bacteroides coprosuis DSM 18011]
          Length = 115

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/115 (50%), Positives = 80/115 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ K+VLK  KG++G RKN    AK A ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKRVLKQTKGYFGARKNVWTVAKNAWEKGLTYAYRDRKSKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINAA R+  + YS+ + GL KAGI ++RKVL+DLA+   ++FK IV  +++
Sbjct: 61  WIQRINAAARLEGMTYSRLMGGLKKAGIEINRKVLADLAVNHPEAFKAIVAKAKA 115


>gi|148377740|ref|YP_001256616.1| 50S ribosomal protein L20 [Mycoplasma agalactiae PG2]
 gi|291320425|ref|YP_003515688.1| 50S ribosomal protein L20 [Mycoplasma agalactiae]
 gi|313678437|ref|YP_004056177.1| 50S ribosomal protein L20 [Mycoplasma bovis PG45]
 gi|226730424|sp|A5IYR6|RL20_MYCAP RecName: Full=50S ribosomal protein L20
 gi|148291786|emb|CAL59175.1| 50S ribosomal protein L20 [Mycoplasma agalactiae PG2]
 gi|290752759|emb|CBH40734.1| 50S ribosomal protein L20 [Mycoplasma agalactiae]
 gi|312950761|gb|ADR25356.1| ribosomal protein L20 [Mycoplasma bovis PG45]
          Length = 116

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 81/114 (71%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+ A+ KK +K AKG++G +    + AK AV +S  YA+RDR+  KRD+R LWI
Sbjct: 2   RVKGGTVTRARRKKWIKLAKGYFGHKSIGYKVAKQAVVKSWTYAFRDRKQVKRDYRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
            RI+AAVR+  L+YS+FINGL K+ I ++RK+LS+LAI +   F +++ ++R  
Sbjct: 62  SRISAAVRLEGLSYSKFINGLKKSNITINRKMLSELAINEPQVFSQLIAIARDS 115


>gi|153814478|ref|ZP_01967146.1| hypothetical protein RUMTOR_00691 [Ruminococcus torques ATCC 27756]
 gi|317500520|ref|ZP_07958743.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089380|ref|ZP_08338279.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145847972|gb|EDK24890.1| hypothetical protein RUMTOR_00691 [Ruminococcus torques ATCC 27756]
 gi|316898109|gb|EFV20157.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330404748|gb|EGG84286.1| 50S ribosomal protein L20 [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 118

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/118 (41%), Positives = 75/118 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH + LK AKG+ G R    R AK +V R+   AY  R+ +KR  R L
Sbjct: 1   MARIKGGMNARKKHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSAYAGRKQRKRQMRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+ DL+YS+F++GL  A + ++RK+L++LA+   + F  +  L++ +L 
Sbjct: 61  WIARINAAARMNDLSYSKFMHGLKLANVDINRKMLAELAVNDKEGFATLAALAKEKLA 118


>gi|298206756|ref|YP_003714935.1| 50S ribosomal protein L20 [Croceibacter atlanticus HTCC2559]
 gi|83849387|gb|EAP87255.1| 50S ribosomal protein L20 [Croceibacter atlanticus HTCC2559]
          Length = 114

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 79/114 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AVD++ QY+YRDR+ KKR+FRSL
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVDKAMQYSYRDRKTKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R+  ++YSQF+  + K  I L+RKVL+DLA+   ++F  +V   +
Sbjct: 61  WIMRINAGARLNGMSYSQFMGAVKKNNIELNRKVLADLAMNHPEAFTAVVNKVK 114


>gi|212691285|ref|ZP_03299413.1| hypothetical protein BACDOR_00776 [Bacteroides dorei DSM 17855]
 gi|237712286|ref|ZP_04542767.1| 50S ribosomal protein L20 [Bacteroides sp. 9_1_42FAA]
 gi|237726425|ref|ZP_04556906.1| 50S ribosomal protein L20 [Bacteroides sp. D4]
 gi|265751994|ref|ZP_06087787.1| 50S ribosomal protein L20 [Bacteroides sp. 3_1_33FAA]
 gi|212666517|gb|EEB27089.1| hypothetical protein BACDOR_00776 [Bacteroides dorei DSM 17855]
 gi|229434951|gb|EEO45028.1| 50S ribosomal protein L20 [Bacteroides dorei 5_1_36/D4]
 gi|229453607|gb|EEO59328.1| 50S ribosomal protein L20 [Bacteroides sp. 9_1_42FAA]
 gi|263236786|gb|EEZ22256.1| 50S ribosomal protein L20 [Bacteroides sp. 3_1_33FAA]
          Length = 116

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 56/116 (48%), Positives = 78/116 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+L   KG++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKILGLTKGYFGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WIQRINAA R+  ++YS+ +  LHKAGI ++RKVL+DLA+   ++FK IV  ++  
Sbjct: 61  WIQRINAAARLEGMSYSKLMGALHKAGIEINRKVLADLAMNHPEAFKAIVAKAKVA 116


>gi|170768779|ref|ZP_02903232.1| ribosomal protein L20 [Escherichia albertii TW07627]
 gi|170122327|gb|EDS91258.1| ribosomal protein L20 [Escherichia albertii TW07627]
          Length = 118

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 62/118 (52%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK++K AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKIMKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAALA 118


>gi|157736345|ref|YP_001489028.1| 50S ribosomal protein L20 [Arcobacter butzleri RM4018]
 gi|315635480|ref|ZP_07890746.1| 50S ribosomal protein L20 [Arcobacter butzleri JV22]
 gi|166984656|sp|A8EQY5|RL20_ARCB4 RecName: Full=50S ribosomal protein L20
 gi|157698199|gb|ABV66359.1| 50S ribosomal protein L20 [Arcobacter butzleri RM4018]
 gi|315480238|gb|EFU70905.1| 50S ribosomal protein L20 [Arcobacter butzleri JV22]
          Length = 118

 Score =  143 bits (361), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 61/117 (52%), Positives = 84/117 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVV   +HKKVLK+A+GF+  R+   R AK  ++RS  YA+RDRR KKRD R L
Sbjct: 1   MPRVKTGVVRRRRHKKVLKAARGFFSGRRKHFRKAKEQLERSLVYAFRDRRQKKRDIRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+ D+NYS+F+NGL  +G+ LDRK+L+D+A+    +F  +V  +++ L
Sbjct: 61  WIIRINAACRLNDINYSRFMNGLKLSGLELDRKILADMAMNDSAAFASLVATAKAAL 117


>gi|296532252|ref|ZP_06894996.1| 50S ribosomal protein L20 [Roseomonas cervicalis ATCC 49957]
 gi|296267422|gb|EFH13303.1| 50S ribosomal protein L20 [Roseomonas cervicalis ATCC 49957]
          Length = 123

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/123 (53%), Positives = 83/123 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+ GR     R A   V+++ QYAYRDRRVKKR+FR L
Sbjct: 1   MARVKRGVAAHARHKKVLKLAKGYVGRSSKAYRPALERVEKALQYAYRDRRVKKREFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R + L YS+FI GL  A I LDRKVL+ +A     +F  +VE +++ L   
Sbjct: 61  WIQRINAATREHGLTYSKFIAGLKAANIELDRKVLAAIAFEDAAAFGALVEKAKAALPAS 120

Query: 121 VAS 123
             +
Sbjct: 121 AEA 123


>gi|258647091|ref|ZP_05734560.1| ribosomal protein L20 [Prevotella tannerae ATCC 51259]
 gi|260853038|gb|EEX72907.1| ribosomal protein L20 [Prevotella tannerae ATCC 51259]
          Length = 114

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 60/114 (52%), Positives = 78/114 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G+YG RKN    AK   ++   YA+RDRR KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYYGARKNVWTVAKNTWEKGLTYAFRDRRNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+  L+YSQ +  LHKAGI ++RKVL+DLA+    +FK IVE  +
Sbjct: 61  WIQRINAAARLEGLSYSQLMGNLHKAGIEINRKVLADLAVNNPQAFKAIVEKVK 114


>gi|7524803|ref|NP_045805.1| ribosomal protein L20 [Chlorella vulgaris]
 gi|3024543|sp|P56352|RK20_CHLVU RecName: Full=50S ribosomal protein L20, chloroplastic
 gi|2224396|dbj|BAA57880.1| 50S ribosomal protein L20 [Chlorella vulgaris]
          Length = 115

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 52/114 (45%), Positives = 75/114 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  + K+VL  A GF G      R A+    ++  Y+YRDR+ KKR+F  L
Sbjct: 1   MTRVKRGNVARKRRKQVLNLASGFRGSSSRLFRTAQQQTMKALSYSYRDRQQKKREFCGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           W+ R+NAA R+Y LNY+ F + L KAGI L+RKVLS +A+    +F++++ L +
Sbjct: 61  WVTRLNAAARLYGLNYTNFRHNLKKAGIQLNRKVLSQVALRDKQAFEQLILLVK 114


>gi|239917948|ref|YP_002957506.1| LSU ribosomal protein L20P [Micrococcus luteus NCTC 2665]
 gi|289704521|ref|ZP_06500956.1| ribosomal protein L20 [Micrococcus luteus SK58]
 gi|259646192|sp|C5CAP8|RL20_MICLC RecName: Full=50S ribosomal protein L20
 gi|239839155|gb|ACS30952.1| LSU ribosomal protein L20P [Micrococcus luteus NCTC 2665]
 gi|289558779|gb|EFD52035.1| ribosomal protein L20 [Micrococcus luteus SK58]
          Length = 128

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/123 (39%), Positives = 75/123 (60%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L+ A G+ G+R    R AK  +  S  Y Y+ R  +K DFR L
Sbjct: 1   MARVKRAVNAHKKRRTMLERASGYRGQRSRLYRKAKEQMLHSFTYNYQHRHKRKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R   + Y++F+ GL  AG+ +DR++L+++A++   +F  +V+ +R  L  D
Sbjct: 61  WITRINAAARANGMTYNRFMQGLKLAGVEVDRRMLAEIAVSDAATFAVLVKTAREALPAD 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|189095341|ref|YP_001936354.1| ribosomal protein L20 [Heterosigma akashiwo]
 gi|157694684|gb|ABV65960.1| 50S ribosomal protein L20 [Heterosigma akashiwo]
 gi|157777915|gb|ABV70101.1| 50S ribosomal protein L20 [Heterosigma akashiwo]
          Length = 115

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/115 (42%), Positives = 71/115 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+  + +K+L  AKGF G      R A   V ++ +Y+Y  R+ KKR FR L
Sbjct: 1   MVRVKRGNVARKRRQKILIRAKGFRGAHSKLFRTANQQVMKALRYSYIGRKQKKRQFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI RINAA +++D+ YS  IN L  A ++L+RK+LS LAI    +F  ++   ++
Sbjct: 61  WITRINAAAKMHDIKYSVLINKLKNANVILNRKMLSQLAIVDPKTFSSLINQIKN 115


>gi|319637850|ref|ZP_07992616.1| 50S ribosomal protein L20 [Neisseria mucosa C102]
 gi|317401005|gb|EFV81660.1| 50S ribosomal protein L20 [Neisseria mucosa C102]
          Length = 119

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 85/119 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+H+KV   AKG+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHQKVFALAKGYRGRRKNVYRVAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINA  R   L+YS+F+NGL +A I +DRKVL+DLA+    +F K+VE +++ L  
Sbjct: 61  WIVRINAGARENGLSYSKFMNGLKRAAIEIDRKVLADLAVFDKAAFAKLVEKAKAALAA 119


>gi|281420274|ref|ZP_06251273.1| ribosomal protein L20 [Prevotella copri DSM 18205]
 gi|281405769|gb|EFB36449.1| ribosomal protein L20 [Prevotella copri DSM 18205]
          Length = 114

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 76/114 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+  ++YSQ +  LHKAGI ++RKVL+DLA+   ++FK IV   +
Sbjct: 61  WIQRINAAARLDGMSYSQLMGALHKAGIEINRKVLADLAVNNPEAFKAIVAKVK 114


>gi|259908575|ref|YP_002648931.1| 50S ribosomal protein L20 [Erwinia pyrifoliae Ep1/96]
 gi|292488132|ref|YP_003531009.1| 50S ribosomal protein L20 [Erwinia amylovora CFBP1430]
 gi|292899343|ref|YP_003538712.1| 50S ribosomal protein L20 [Erwinia amylovora ATCC 49946]
 gi|224964197|emb|CAX55704.1| 50S ribosomal protein L20 [Erwinia pyrifoliae Ep1/96]
 gi|283478544|emb|CAY74460.1| 50S ribosomal protein L20 [Erwinia pyrifoliae DSM 12163]
 gi|291199191|emb|CBJ46305.1| 50S ribosomal protein L20 [Erwinia amylovora ATCC 49946]
 gi|291553556|emb|CBA20601.1| 50S ribosomal protein L20 [Erwinia amylovora CFBP1430]
 gi|310767525|gb|ADP12475.1| 50S ribosomal protein L20 [Erwinia sp. Ejp617]
 gi|312172264|emb|CBX80521.1| 50S ribosomal protein L20 [Erwinia amylovora ATCC BAA-2158]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+     F  +VE ++S L 
Sbjct: 61  WIARINAAARTNGISYSRFINGLKKASIEIDRKILADIAVFDKAVFAALVEKAKSALA 118


>gi|238783382|ref|ZP_04627405.1| 50S ribosomal protein L20 [Yersinia bercovieri ATCC 43970]
 gi|238787091|ref|ZP_04630891.1| 50S ribosomal protein L20 [Yersinia frederiksenii ATCC 33641]
 gi|238791699|ref|ZP_04635336.1| 50S ribosomal protein L20 [Yersinia intermedia ATCC 29909]
 gi|238715627|gb|EEQ07616.1| 50S ribosomal protein L20 [Yersinia bercovieri ATCC 43970]
 gi|238724879|gb|EEQ16519.1| 50S ribosomal protein L20 [Yersinia frederiksenii ATCC 33641]
 gi|238728803|gb|EEQ20320.1| 50S ribosomal protein L20 [Yersinia intermedia ATCC 29909]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVFDKVAFSALVEKAKVALA 118


>gi|311747148|ref|ZP_07720933.1| ribosomal protein L20 [Algoriphagus sp. PR1]
 gi|126578857|gb|EAZ83021.1| ribosomal protein L20 [Algoriphagus sp. PR1]
          Length = 114

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 76/114 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKVLK+ +G++GR  N    AK   ++  QYAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNAVASRARRKKVLKATRGYFGRGSNVWTVAKNKYEKGLQYAYRDRKQKKREFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R + ++YSQ +  L K G+ L+RKVL+DLA+    +FK +VE  +
Sbjct: 61  WIQRINAGAREHGVSYSQLMGLLKKGGVELNRKVLADLAMNHPSAFKAVVESVK 114


>gi|296129473|ref|YP_003636723.1| ribosomal protein L20 [Cellulomonas flavigena DSM 20109]
 gi|296021288|gb|ADG74524.1| ribosomal protein L20 [Cellulomonas flavigena DSM 20109]
          Length = 128

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 78/123 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K +  L+ A G+ G+R    R AK  V  S  YAYRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRSTLERASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKARKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAA R   + Y++ I GL  AG+ +DR+VL+DLA+    +F  +V+++++ L  D
Sbjct: 61  WIQRINAAARENGMTYNRLIQGLKAAGVEVDRRVLADLAVNDAAAFAALVQVAKAALPED 120

Query: 121 VAS 123
           V +
Sbjct: 121 VNA 123


>gi|283797709|ref|ZP_06346862.1| ribosomal protein L20 [Clostridium sp. M62/1]
 gi|291074605|gb|EFE11969.1| ribosomal protein L20 [Clostridium sp. M62/1]
 gi|295092065|emb|CBK78172.1| LSU ribosomal protein L20P [Clostridium cf. saccharolyticum K10]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 81/118 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+ + +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKKHNRVLKLAKGYRGARSKQYRIAKQSVMRALKSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  AG+ ++RKVLSD+AI+  + F K+ EL++S+L 
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLAGVEMNRKVLSDMAISDAEGFAKLAELAKSKLA 118


>gi|89256697|ref|YP_514059.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115315104|ref|YP_763827.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|156502857|ref|YP_001428922.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|167010449|ref|ZP_02275380.1| ribosomal protein L20 [Francisella tularensis subsp. holarctica
           FSC200]
 gi|254368004|ref|ZP_04984024.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           257]
 gi|290954128|ref|ZP_06558749.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295312446|ref|ZP_06803218.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|122324894|sp|Q0BL44|RL20_FRATO RecName: Full=50S ribosomal protein L20
 gi|122500487|sp|Q2A2J3|RL20_FRATH RecName: Full=50S ribosomal protein L20
 gi|166219644|sp|A7NDB3|RL20_FRATF RecName: Full=50S ribosomal protein L20
 gi|89144528|emb|CAJ79843.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           LVS]
 gi|115130003|gb|ABI83190.1| ribosomal protein L20 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|134253814|gb|EBA52908.1| 50S ribosomal protein L20 [Francisella tularensis subsp. holarctica
           257]
 gi|156253460|gb|ABU61966.1| ribosomal protein L20 [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 82/106 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+KA + LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKADVELDRKALAELAVYNKDAF 106


>gi|113461018|ref|YP_719085.1| 50S ribosomal protein L20 [Haemophilus somnus 129PT]
 gi|170717590|ref|YP_001784674.1| 50S ribosomal protein L20 [Haemophilus somnus 2336]
 gi|123132111|sp|Q0I3J1|RL20_HAES1 RecName: Full=50S ribosomal protein L20
 gi|189041867|sp|B0UU75|RL20_HAES2 RecName: Full=50S ribosomal protein L20
 gi|112823061|gb|ABI25150.1| LSU ribosomal protein L20P [Haemophilus somnus 129PT]
 gi|168825719|gb|ACA31090.1| ribosomal protein L20 [Haemophilus somnus 2336]
          Length = 117

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAATRQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKSAL 117


>gi|242239480|ref|YP_002987661.1| ribosomal protein L20 [Dickeya dadantii Ech703]
 gi|242131537|gb|ACS85839.1| ribosomal protein L20 [Dickeya dadantii Ech703]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKLALA 118


>gi|261344013|ref|ZP_05971658.1| ribosomal protein L20 [Providencia rustigianii DSM 4541]
 gi|282568405|gb|EFB73940.1| ribosomal protein L20 [Providencia rustigianii DSM 4541]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK++K AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKIMKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFSALVEKAKGALA 118


>gi|291460370|ref|ZP_06599760.1| ribosomal protein L20 [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291416937|gb|EFE90656.1| ribosomal protein L20 [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 54/116 (46%), Positives = 77/116 (66%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R+K GV +  KH +VLK AKG+ G R    R AK +V R+   +YR R+ +KR FR LWI
Sbjct: 2   RIKGGVNAKKKHNRVLKLAKGYRGARSKQYRVAKQSVMRALTESYRGRKERKRQFRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
            RINAA R+  L+YS+ + GL  AGI ++RK+LS++AI   +SF K+ E ++ +L 
Sbjct: 62  ARINAAARLNSLSYSRLMYGLKSAGIDMNRKMLSEIAIADPESFAKLCEEAKGKLA 117


>gi|33519814|ref|NP_878646.1| 50S ribosomal protein L20 [Candidatus Blochmannia floridanus]
 gi|39931817|sp|Q7VR68|RL20_BLOFL RecName: Full=50S ribosomal protein L20
 gi|33504159|emb|CAD83421.1| 50S ribosomal subunit protein L20 [Candidatus Blochmannia
           floridanus]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/114 (46%), Positives = 75/114 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  V + ++HKK+LK A G+YG R  T R A  A+ ++ QYAYRDR+ KKR FR L
Sbjct: 1   MVRVKNSVTAHSRHKKILKRATGYYGARSRTYRVAYQAIIKAGQYAYRDRKQKKRIFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI  INA  R Y L+Y+  IN L+K+ I ++RK+L++LA +   +F  +V   +
Sbjct: 61  WISHINAVARQYGLSYNNLINNLYKSSIYINRKMLAELATSDQVAFLNLVNNIK 114


>gi|331001969|ref|ZP_08325489.1| 50S ribosomal protein L20 [Lachnospiraceae oral taxon 107 str.
           F0167]
 gi|330411765|gb|EGG91170.1| 50S ribosomal protein L20 [Lachnospiraceae oral taxon 107 str.
           F0167]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  + +  +H +VLK AKG+ G R    R AK +V R+   AY  R+ +KR FR L
Sbjct: 1   MARVKGALNAKKRHNRVLKLAKGYRGARSKQYRIAKQSVMRALASAYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  AG+ ++RK+L+DLA+     F KI EL++S+L 
Sbjct: 61  WIARINAAARINGLSYSKLMHGLKLAGVDMNRKILADLAVNDATGFSKIAELAKSKLA 118


>gi|260911580|ref|ZP_05918165.1| 50S ribosomal protein L20 [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260634286|gb|EEX52391.1| 50S ribosomal protein L20 [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 114

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 75/114 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK  ++LK  KG+YG RKN    AK   ++   YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNHVASKAKRTRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+ ++ YS  +  LHKAGI ++RKVL+DLA+    +FK IV+  +
Sbjct: 61  WIQRINAAARLENMTYSTLMGALHKAGIEINRKVLADLAVNNPQAFKAIVDKVK 114


>gi|254510129|ref|ZP_05122196.1| ribosomal protein L20 [Rhodobacteraceae bacterium KLH11]
 gi|221533840|gb|EEE36828.1| ribosomal protein L20 [Rhodobacteraceae bacterium KLH11]
          Length = 121

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 69/112 (61%), Positives = 93/112 (83%), Gaps = 2/112 (1%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVK G V+ A+HKKV+K+AKG+YGRRK+T + A+ AVD++ QYA RDR+ +KR+FR+L
Sbjct: 1   MSRVKGGTVTHARHKKVIKAAKGYYGRRKSTFKVARQAVDKANQYATRDRKNRKRNFRAL 60

Query: 61  WIQRINAAVRVYD--LNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIV 110
           WIQRINAAVR +D  L YS+FINGL+ AGI +DRKVL+DLA+ + ++F  IV
Sbjct: 61  WIQRINAAVRSHDEALTYSRFINGLNLAGIEVDRKVLADLAVHEPEAFGAIV 112


>gi|238919785|ref|YP_002933300.1| ribosomal protein L20, [Edwardsiella ictaluri 93-146]
 gi|259646184|sp|C5B849|RL20_EDWI9 RecName: Full=50S ribosomal protein L20
 gi|238869354|gb|ACR69065.1| ribosomal protein L20, putative [Edwardsiella ictaluri 93-146]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKVALA 118


>gi|283769361|ref|ZP_06342260.1| ribosomal protein L20 [Bulleidia extructa W1219]
 gi|283104018|gb|EFC05402.1| ribosomal protein L20 [Bulleidia extructa W1219]
          Length = 116

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 74/115 (64%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK    +  + KKVLK AKG++G +    R A   V RS +Y+Y  R+  KR+ R LWI
Sbjct: 2   RVKGSTPTRNRRKKVLKLAKGYFGSKHAIYRTAHEQVMRSLRYSYNHRKQTKREMRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAAVR + L+YS+F++GL  A I ++RK+LS++AI     F K+V+ ++  L
Sbjct: 62  ARINAAVRPFGLSYSKFMHGLKVAHISINRKMLSEIAIHDEAGFVKLVDAAKKAL 116


>gi|255280785|ref|ZP_05345340.1| ribosomal protein L20 [Bryantella formatexigens DSM 14469]
 gi|255268722|gb|EET61927.1| ribosomal protein L20 [Bryantella formatexigens DSM 14469]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  KH + LK AKG+ G R    + AK +V R+   +Y  R+ KKR FR L
Sbjct: 1   MARVKGGMNAKKKHNRTLKLAKGYRGARSKQYKIAKQSVMRALASSYAGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  AG+ ++RK+L+D+AI   + F  + EL++S++ 
Sbjct: 61  WIARINAAARLNGLSYSKMMHGLKVAGVDINRKILADMAINDAEGFATLAELAKSKIA 118


>gi|238753684|ref|ZP_04615046.1| 50S ribosomal protein L20 [Yersinia ruckeri ATCC 29473]
 gi|238708236|gb|EEQ00592.1| 50S ribosomal protein L20 [Yersinia ruckeri ATCC 29473]
          Length = 118

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQSGLSYSRFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKAALA 118


>gi|110638047|ref|YP_678256.1| 50S ribosomal protein L20 [Cytophaga hutchinsonii ATCC 33406]
 gi|123354609|sp|Q11UK0|RL20_CYTH3 RecName: Full=50S ribosomal protein L20
 gi|110280728|gb|ABG58914.1| LSU ribosomal protein L20P [Cytophaga hutchinsonii ATCC 33406]
          Length = 115

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 60/115 (52%), Positives = 77/115 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S  + KK+LK AKG++GRRKN    AK AV+R + +AY  R+ KKR FR L
Sbjct: 1   MPRSVPSVASRERRKKILKLAKGYFGRRKNVWTVAKNAVERGKVFAYIGRKQKKRHFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WIQRINA  R + L+YSQFI  L KA I L+RKVL+DLA+   ++FK +VE  + 
Sbjct: 61  WIQRINAGTRQHGLSYSQFIGALDKANIKLNRKVLADLAMNDPEAFKAVVEKVKK 115


>gi|325288438|ref|YP_004264619.1| LSU ribosomal protein L20P [Syntrophobotulus glycolicus DSM 8271]
 gi|324963839|gb|ADY54618.1| LSU ribosomal protein L20P [Syntrophobotulus glycolicus DSM 8271]
          Length = 127

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 83/122 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV +  +HKK+LK A+G+ GR+    + AK  V +S  Y++  R+ ++RDFR L
Sbjct: 1   MARVKRGVRAHQRHKKILKLARGYRGRKSKLFKMAKQQVVKSMAYSFIHRKQRRRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R+ D++YS+ + GL +AG+ ++RK+L+DLAI    +F  + +L++ +L   
Sbjct: 61  WIARINAASRMNDISYSRLMYGLKQAGVFVNRKMLADLAINDPGAFTSLCDLAKGKLNEG 120

Query: 121 VA 122
            A
Sbjct: 121 PA 122


>gi|160940541|ref|ZP_02087885.1| hypothetical protein CLOBOL_05436 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436501|gb|EDP14268.1| hypothetical protein CLOBOL_05436 [Clostridium bolteae ATCC
           BAA-613]
          Length = 118

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 78/118 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKKHNRVLKMAKGYRGARSKQYRIAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F+ GL  A + L+RKVLS++AI   + F K+ EL++S++ 
Sbjct: 61  WIARINAAARINGLSYSKFMYGLKLAEVDLNRKVLSEMAINDAEGFAKLAELAKSKIA 118


>gi|229827029|ref|ZP_04453098.1| hypothetical protein GCWU000182_02413 [Abiotrophia defectiva ATCC
           49176]
 gi|229788647|gb|EEP24761.1| hypothetical protein GCWU000182_02413 [Abiotrophia defectiva ATCC
           49176]
          Length = 118

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/118 (41%), Positives = 76/118 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  +H +VLK AKG+ G R    R AK +V R+   AY  RR +K DFR L
Sbjct: 1   MARIKGGLGAKKRHNRVLKLAKGYRGARSKQYRIAKQSVMRALASAYAGRRKRKGDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F++GL  A I ++RK+L++LA+     F  + + +++++ 
Sbjct: 61  WIVRINAAARLNGLSYSKFMHGLKLANIDINRKMLAELAVNDAAGFTALADAAKAKIA 118


>gi|284037107|ref|YP_003387037.1| ribosomal protein L20 [Spirosoma linguale DSM 74]
 gi|283816400|gb|ADB38238.1| ribosomal protein L20 [Spirosoma linguale DSM 74]
          Length = 114

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 81/114 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV++   Y+YRDRR KKRDFR+L
Sbjct: 1   MPRSVNHVASRARRKKVMKLAKGYFGRRKNVWTVAKNAVEKGLGYSYRDRRAKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINA  R++ ++YS F+  ++K+GI L+RKVL+DLA+   ++F  +V   +
Sbjct: 61  WIQRINAGARIHGMSYSAFMGAINKSGIELNRKVLADLAMNHPEAFAAVVAQVK 114


>gi|332521039|ref|ZP_08397497.1| ribosomal protein L20 [Lacinutrix algicola 5H-3-7-4]
 gi|332043132|gb|EGI79329.1| ribosomal protein L20 [Lacinutrix algicola 5H-3-7-4]
          Length = 114

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 77/114 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KKVLK AKG++GRRKN    AK AVD++ QY+YRDRR KKR FR+L
Sbjct: 1   MPRSVNSVAKRARRKKVLKQAKGYFGRRKNVWTVAKNAVDKAMQYSYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R++ ++YSQF+  L    I L+RKVL+DLA+    +F+ IV   +
Sbjct: 61  WITRINAGARLHGMSYSQFMGKLKANNIELNRKVLADLAMNHPVAFEAIVNKIK 114


>gi|17230920|ref|NP_487468.1| 50S ribosomal protein L20 [Nostoc sp. PCC 7120]
 gi|186685029|ref|YP_001868225.1| 50S ribosomal protein L20 [Nostoc punctiforme PCC 73102]
 gi|20978591|sp|Q8YRL8|RL20_ANASP RecName: Full=50S ribosomal protein L20
 gi|226730428|sp|B2J0D0|RL20_NOSP7 RecName: Full=50S ribosomal protein L20
 gi|17132561|dbj|BAB75127.1| 50S ribosomal protein L20 [Nostoc sp. PCC 7120]
 gi|186467481|gb|ACC83282.1| ribosomal protein L20 [Nostoc punctiforme PCC 73102]
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 74/116 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  +  K+LK AKGF G      R A   V ++ + AYRDR+ KKRDFR L
Sbjct: 1   MTRVKRGNVARKRRNKILKLAKGFRGSHSTLFRTANQQVMKALRSAYRDRKKKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R + L+YSQ I  L KA I L+RK+L+ LA+    SF K+ EL+   
Sbjct: 61  WITRINAASRQHGLSYSQLIGNLKKADIQLNRKMLAQLAVLDPASFGKVAELASQA 116


>gi|188533974|ref|YP_001907771.1| 50S ribosomal protein L20 [Erwinia tasmaniensis Et1/99]
 gi|226730398|sp|B2VEL7|RL20_ERWT9 RecName: Full=50S ribosomal protein L20
 gi|188029016|emb|CAO96884.1| 50S ribosomal protein L20 [Erwinia tasmaniensis Et1/99]
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA I +DRK+L+D+A+     F  +VE +++ L 
Sbjct: 61  WIARINAAARTNGISYSRFINGLKKASIEIDRKILADIAVFDKAVFAALVEKAKTALA 118


>gi|15602469|ref|NP_245541.1| 50S ribosomal protein L20 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|14195120|sp|Q9CN41|RL20_PASMU RecName: Full=50S ribosomal protein L20
 gi|12720875|gb|AAK02688.1| RpL20 [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 117

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKSAL 117


>gi|315221376|ref|ZP_07863297.1| ribosomal protein L20 [Streptococcus anginosus F0211]
 gi|315189495|gb|EFU23189.1| ribosomal protein L20 [Streptococcus anginosus F0211]
          Length = 119

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVND 102


>gi|157803530|ref|YP_001492079.1| 50S ribosomal protein L20 [Rickettsia canadensis str. McKiel]
 gi|166220738|sp|A8EY61|RL20_RICCK RecName: Full=50S ribosomal protein L20
 gi|157784793|gb|ABV73294.1| 50S ribosomal protein L20 [Rickettsia canadensis str. McKiel]
          Length = 117

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTR K G +S  +HKK+LK AKG+ GR  +  R A A V+++ QYAYRDRR +KR+FR L
Sbjct: 1   MTRAKSGKISKNRHKKILKLAKGYRGRANSCFRVAIAKVEKALQYAYRDRRNRKRNFRGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WIQRINAAVR + L YSQF+  L KAGI +DRKVL++LA+   D F  IVE +++ +
Sbjct: 61  WIQRINAAVRTHGLIYSQFMGTLKKAGIDIDRKVLAELAVNNSDGFASIVEKAKAHI 117


>gi|325287302|ref|YP_004263092.1| 50S ribosomal protein L20 [Cellulophaga lytica DSM 7489]
 gi|324322756|gb|ADY30221.1| 50S ribosomal protein L20 [Cellulophaga lytica DSM 7489]
          Length = 114

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 60/114 (52%), Positives = 81/114 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV+++ QYAYRDRRVKKR+FR+L
Sbjct: 1   MPRSVNSVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVEKAMQYAYRDRRVKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R++ ++YSQF+  +    I L+RKVL+DLA+   ++FK IV   +
Sbjct: 61  WITRINAGARLHGMSYSQFMGKVKANNIELNRKVLADLAMNHPEAFKAIVNKVK 114


>gi|297583670|ref|YP_003699450.1| 50S ribosomal protein L20 [Bacillus selenitireducens MLS10]
 gi|297142127|gb|ADH98884.1| ribosomal protein L20 [Bacillus selenitireducens MLS10]
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/117 (47%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+  + K+VLK AKG+ G +    + A+  V +S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGYVARRRRKRVLKLAKGYVGSKHRLFKTAQGQVMKSHLYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+Y++F++GL +AGI ++RK+L+DLAI    +F ++ + +++ L
Sbjct: 61  WIARINAAARINGLSYNRFMHGLKQAGIEMNRKMLADLAINDEKAFAELADKAKANL 117


>gi|282901102|ref|ZP_06309034.1| Ribosomal protein L20 [Cylindrospermopsis raciborskii CS-505]
 gi|281194001|gb|EFA68966.1| Ribosomal protein L20 [Cylindrospermopsis raciborskii CS-505]
          Length = 119

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/113 (50%), Positives = 73/113 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  +  K+LK AKGF G      R A   V ++ + AYRDR+ KKRDFR L
Sbjct: 1   MTRVKRGNVARNRRNKILKLAKGFRGSHSTLFRTANQQVMKALRSAYRDRKKKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAA R   L+YSQ I  L KA + L+RK+L+ LA+    +F K+ EL+
Sbjct: 61  WITRINAASRQQGLSYSQLIGNLKKANVELNRKMLAQLAVLDPTTFAKVAELA 113


>gi|300021910|ref|YP_003754521.1| ribosomal protein L20 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523731|gb|ADJ22200.1| ribosomal protein L20 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 133

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 72/106 (67%), Positives = 87/106 (82%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + AKHKKV+K+AKG+YGRRKNTIR AK AV+++QQYAYRDR+ +KR+FR+L
Sbjct: 1   MARVKRGVTAHAKHKKVIKAAKGYYGRRKNTIRVAKQAVEKAQQYAYRDRKRRKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WIQRINAAVR + L Y +FINGL   GI +DRKVLSD+AI     F
Sbjct: 61  WIQRINAAVREHGLTYGRFINGLTNLGIEVDRKVLSDIAINDPAGF 106


>gi|213963355|ref|ZP_03391611.1| ribosomal protein L20 [Capnocytophaga sputigena Capno]
 gi|256819832|ref|YP_003141111.1| ribosomal protein L20 [Capnocytophaga ochracea DSM 7271]
 gi|315225231|ref|ZP_07867048.1| 50S ribosomal protein L20 [Capnocytophaga ochracea F0287]
 gi|213954023|gb|EEB65349.1| ribosomal protein L20 [Capnocytophaga sputigena Capno]
 gi|256581415|gb|ACU92550.1| ribosomal protein L20 [Capnocytophaga ochracea DSM 7271]
 gi|314944914|gb|EFS96946.1| 50S ribosomal protein L20 [Capnocytophaga ochracea F0287]
          Length = 114

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 80/114 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V   A+ KK++K AKGF+GRRKN    AK AV+++ QYAYRDRR KKR FR+L
Sbjct: 1   MPRSVNAVARRARRKKIMKQAKGFFGRRKNVWTVAKNAVEKAMQYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R++ L+YSQF+  L  A I L+RKVL+DLA+   ++FK IVE  +
Sbjct: 61  WIVRINAGARLHGLSYSQFMGKLKAADIQLNRKVLADLAMNHPEAFKAIVEKVK 114


>gi|291300540|ref|YP_003511818.1| 50S ribosomal protein L20 [Stackebrandtia nassauensis DSM 44728]
 gi|290569760|gb|ADD42725.1| ribosomal protein L20 [Stackebrandtia nassauensis DSM 44728]
          Length = 121

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/121 (46%), Positives = 77/121 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR + +  K + VL SAKG+ G+R    R AK  +  S +Y+YRDRR +K DFR L
Sbjct: 1   MARVKRALNAKKKRRVVLDSAKGYRGQRSRLYRKAKEQLLHSYEYSYRDRRARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WI RINAA R   + Y++FI GL  A + +DRKVL+DLA+T   +F  +V+++R  L   
Sbjct: 61  WITRINAAARANGITYNRFIQGLKAAEVEVDRKVLADLAVTDEAAFTALVDVARKALPAT 120

Query: 121 V 121
            
Sbjct: 121 A 121


>gi|46198493|ref|YP_004160.1| 50S ribosomal protein L20 [Thermus thermophilus HB27]
 gi|55980522|ref|YP_143819.1| 50S ribosomal protein L20 [Thermus thermophilus HB8]
 gi|60390495|sp|Q72L76|RL20_THET2 RecName: Full=50S ribosomal protein L20
 gi|62297591|sp|P60491|RL20_THET8 RecName: Full=50S ribosomal protein L20
 gi|116668252|pdb|2J01|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4).
           This File Contains The 50s Subunit From Molecule I.
 gi|116668313|pdb|2J03|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4).
           This File Contains The 50s Subunit From Molecule Ii.
 gi|119389750|pdb|2HGJ|T Chain T, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgi.
 gi|119389807|pdb|2HGQ|T Chain T, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgp.
 gi|119389863|pdb|2HGU|T Chain T, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
           Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgr.
 gi|149240900|pdb|1VSA|O Chain O, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
           Functional Interactions And Rearrangements. This File,
           1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome
           Subunit Is In The File 2ow8
 gi|157836535|pdb|2V47|U Chain U, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 2 Of 4). This File Contains The 50s
           Subunit For Molecule 1.
 gi|157836591|pdb|2V49|U Chain U, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 4 Of 4). This File Contains The 50s
           Subunit Of Molecule 2.
 gi|160285442|pdb|1VSP|O Chain O, Interactions And Dynamics Of The Shine-Dalgarno Helix In
           The 70s Ribosome. This File, 1vsp, Contains The 50s
           Ribosome Subunit. 30s Ribosome Subunit Is In The File
           2qnh
 gi|209156534|pdb|3D5B|U Chain U, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of One 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes As Described In Remark 400.
 gi|209156588|pdb|3D5D|U Chain U, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 50s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 gi|211938871|pdb|2JL6|U Chain U, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 2 Of 4). This File
           Contains The 50s Subunit.
 gi|211938929|pdb|2JL8|U Chain U, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome (Part 4 Of 4). This File
           Contains The 50s Subunit.
 gi|218766811|pdb|3F1F|U Chain U, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes As Described In
           Remark 400.
 gi|218766867|pdb|3F1H|U Chain U, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes As
           Described In Remark 400.
 gi|226887450|pdb|2WDI|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule I.
 gi|226887482|pdb|2WDJ|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule Ii.
 gi|226887539|pdb|2WDL|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule I.
 gi|226887596|pdb|2WDN|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule Ii.
 gi|237823582|pdb|2WH2|U Chain U, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 gi|237823641|pdb|2WH4|U Chain U, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 gi|260100026|pdb|3HUX|U Chain U, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule I.
 gi|260100082|pdb|3HUZ|U Chain U, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule Ii.
 gi|261824540|pdb|2WRJ|U Chain U, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 2 Of 4).
 gi|261824602|pdb|2WRL|U Chain U, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State. (Part 4 Of
           4).
 gi|261824661|pdb|2WRO|U Chain U, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 2 Of 4).
 gi|261824720|pdb|2WRR|U Chain U, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 4 Of 4).
 gi|281307208|pdb|3KIR|U Chain U, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 2 Of 4)
 gi|281307266|pdb|3KIT|U Chain U, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 4 Of 4)
 gi|281307324|pdb|3KIW|U Chain U, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 2 Of 4)
 gi|281307382|pdb|3KIY|U Chain U, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 4 Of 4)
 gi|288965645|pdb|3KNI|U Chain U, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule I
 gi|288965677|pdb|3KNK|U Chain U, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule Ii.
 gi|288965709|pdb|3KNM|U Chain U, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule I.
 gi|288965741|pdb|3KNO|U Chain U, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule Ii
 gi|294979489|pdb|3I8F|1 Chain 1, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
           Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 gi|294979573|pdb|3I8I|1 Chain 1, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
           Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 gi|294979627|pdb|3I9C|1 Chain 1, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule B.
           The 30s Subunit Can Be Found In Pdb Entry 3i9b. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 gi|294979681|pdb|3I9E|1 Chain 1, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule A.
           The 30s Subunit Can Be Found In Pdb Entry 3i9d. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 gi|295982128|pdb|2X9S|U Chain U, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|295982187|pdb|2X9U|U Chain U, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 gi|307568014|pdb|2XG0|U Chain U, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 2 Of 4)
 gi|307568072|pdb|2XG2|U Chain U, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 4 Of 4)
 gi|309320301|pdb|3OH5|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320331|pdb|3OH7|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320403|pdb|3OHJ|U Chain U, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320433|pdb|3OHK|U Chain U, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 gi|309320484|pdb|3OHZ|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320535|pdb|3OI1|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320586|pdb|3OI3|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|309320637|pdb|3OI5|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|312207726|pdb|2XQE|U Chain U, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
           Ribosome With A Gtp Analog
 gi|313754050|pdb|2XTG|U Chain U, Trna Tranlocation On The 70s Ribosome: The        Pre-
           Translocational Translocation Intermediate Ti(Pre)
 gi|313754108|pdb|2XUX|U Chain U, Trna Tranlocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 gi|325533455|pdb|2Y0V|U Chain U, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|325533514|pdb|2Y0X|U Chain U, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 gi|325533573|pdb|2Y0Z|U Chain U, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 gi|325533632|pdb|2Y11|U Chain U, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 gi|325533691|pdb|2Y13|U Chain U, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 gi|325533750|pdb|2Y15|U Chain U, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 gi|325533809|pdb|2Y17|U Chain U, Ef-Tu Complex 3
 gi|325533868|pdb|2Y19|U Chain U, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 gi|46196115|gb|AAS80533.1| LSU ribosomal protein L20P [Thermus thermophilus HB27]
 gi|55771935|dbj|BAD70376.1| 50S ribosomal protein L20 [Thermus thermophilus HB8]
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 79/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K GVV   KHKK+LK AKG++G R  + R A+  +  +  YAY  R+ +KRDFR L
Sbjct: 1   MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R + LNYS FI+GL KAGI +DRK L+DLA+ +   F ++VE +++ 
Sbjct: 61  WIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAA 116


>gi|71280047|ref|YP_269607.1| 50S ribosomal protein L20 [Colwellia psychrerythraea 34H]
 gi|109893107|sp|Q480B2|RL20_COLP3 RecName: Full=50S ribosomal protein L20
 gi|71145787|gb|AAZ26260.1| ribosomal protein L20 [Colwellia psychrerythraea 34H]
          Length = 119

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/119 (55%), Positives = 84/119 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVQARARHKKVLKQAKGYYGARSRVYRVAYQAVTKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE +++ L  
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASIEIDRKILADIAVYDKAAFTFLVEKAQASLAA 119


>gi|257784329|ref|YP_003179546.1| 50S ribosomal protein L20 [Atopobium parvulum DSM 20469]
 gi|257472836|gb|ACV50955.1| ribosomal protein L20 [Atopobium parvulum DSM 20469]
          Length = 119

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 78/119 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V    K + +++  KG+YG    T R  K     S QYAYRDRR KKRDFR+L
Sbjct: 1   MARVKRAVAGRKKRQTLVERTKGYYGTSSRTFRGMKEQSQHSGQYAYRDRRNKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WIQRINAA R+ DL+YS+F++GL  AG+ LDRKVL+++A +    F  + E+++  L  
Sbjct: 61  WIQRINAAARINDLSYSKFMHGLKLAGVELDRKVLAEIAYSDEQGFADLAEIAKKALAE 119


>gi|332993604|gb|AEF03659.1| 50S ribosomal protein L20 [Alteromonas sp. SN2]
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG V+ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGTVARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +V+ ++  L 
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASVEIDRKILADIAVHDKAAFSALVDAAKGALA 118


>gi|56707931|ref|YP_169827.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110670402|ref|YP_666959.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|224457011|ref|ZP_03665484.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254370419|ref|ZP_04986424.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874736|ref|ZP_05247446.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|81820784|sp|Q5NGL5|RL20_FRATT RecName: Full=50S ribosomal protein L20
 gi|123169438|sp|Q14I17|RL20_FRAT1 RecName: Full=50S ribosomal protein L20
 gi|56604423|emb|CAG45453.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|110320735|emb|CAL08836.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|151568662|gb|EDN34316.1| hypothetical protein FTBG_00184 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840735|gb|EET19171.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159114|gb|ADA78505.1| 50S ribosomal protein L20 [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/106 (62%), Positives = 82/106 (77%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+RVKRGV + A+HKKVL  AKG+YG R    R AK AV ++ QYAYRDR+VKKR FRSL
Sbjct: 1   MSRVKRGVTARARHKKVLNQAKGYYGARSRVYRVAKQAVIKAGQYAYRDRKVKKRTFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R +D++YSQ INGL+K G+ LDRK L++LA+   D+F
Sbjct: 61  WIVRINAAARQHDISYSQLINGLNKVGVELDRKALAELAVYNKDAF 106


>gi|239993782|ref|ZP_04714306.1| 50S ribosomal protein L20 [Alteromonas macleodii ATCC 27126]
 gi|332141019|ref|YP_004426757.1| 50S ribosomal protein L20 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|226730348|sp|B4RSL5|RL20_ALTMD RecName: Full=50S ribosomal protein L20
 gi|327551041|gb|AEA97759.1| 50S ribosomal protein L20 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG ++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGTIARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGMSYSRFINGLKKASVEIDRKILADIAVHDKAAFSALVEAAKGALA 118


>gi|43068|emb|CAA23562.1| unnamed protein product [Escherichia coli]
 gi|146344|gb|AAA51468.1| ribosomal protein L20 [Escherichia coli]
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 62/118 (52%), Positives = 84/118 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK AKG+YG R      A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKQAKGYYGARSRVYAVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L 
Sbjct: 61  WIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAALA 118


>gi|305664646|ref|YP_003860933.1| 50S ribosomal protein L20 [Maribacter sp. HTCC2170]
 gi|88707347|gb|EAQ99593.1| 50S ribosomal protein L20 [Maribacter sp. HTCC2170]
          Length = 114

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 79/114 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KKV+K AKG++GRRKN    AK AV+++  YAYRDRR KKR FR+L
Sbjct: 1   MPRSVNAVASRARRKKVMKQAKGYFGRRKNVWTVAKNAVEKAMLYAYRDRRNKKRTFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R++ ++YSQF+  +    I L+RKVL+DLA+   D+FK IV+  +
Sbjct: 61  WITRINAGARLHGMSYSQFMGKVKANNIELNRKVLADLAMNHPDAFKAIVDKVK 114


>gi|309800231|ref|ZP_07694410.1| ribosomal protein L20 [Streptococcus infantis SK1302]
 gi|308116139|gb|EFO53636.1| ribosomal protein L20 [Streptococcus infantis SK1302]
          Length = 119

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARINGLSYSQLMHGLKLAEIEVNRKMLADLAVND 102


>gi|261867958|ref|YP_003255880.1| 50S ribosomal protein L20 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261413290|gb|ACX82661.1| 50S ribosomal protein L20 [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 117

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|322419728|ref|YP_004198951.1| 50S ribosomal protein L20 [Geobacter sp. M18]
 gi|320126115|gb|ADW13675.1| ribosomal protein L20 [Geobacter sp. M18]
          Length = 117

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 58/106 (54%), Positives = 75/106 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG  +  +  KVLK AKG+ G R    R+A  AVDR+  YA+RDRRVKKRDFR+L
Sbjct: 1   MPRVKRGFKARQRRNKVLKLAKGYRGARSKLFRSATEAVDRALNYAFRDRRVKKRDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSF 106
           WI RINAA R+  L+YS+ I+GL  A + +DRKV++DLA++    F
Sbjct: 61  WITRINAAARINGLSYSKLIHGLKLANVEIDRKVMADLAVSDPKGF 106


>gi|152967111|ref|YP_001362895.1| ribosomal protein L20 [Kineococcus radiotolerans SRS30216]
 gi|189041868|sp|A6WCU2|RL20_KINRD RecName: Full=50S ribosomal protein L20
 gi|151361628|gb|ABS04631.1| ribosomal protein L20 [Kineococcus radiotolerans SRS30216]
          Length = 129

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 52/114 (45%), Positives = 73/114 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + VL+ A G+ G+R    R AK  V  S  YAYRDR+ +K DFR L
Sbjct: 1   MARVKRAVNAQKKRRTVLEQASGYRGQRSRLYRKAKEQVTHSLVYAYRDRKARKGDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R   + Y++FI GL  A I +DR++L++LA++   +F  +V  ++
Sbjct: 61  WIQRINAAARAEGMTYNRFIQGLKAAEIEVDRRMLAELAVSDPAAFGALVRTAK 114


>gi|261880445|ref|ZP_06006872.1| 50S ribosomal protein L20 [Prevotella bergensis DSM 17361]
 gi|270332868|gb|EFA43654.1| 50S ribosomal protein L20 [Prevotella bergensis DSM 17361]
          Length = 114

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 80/114 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  KG+YG RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASKAKRKRILKLTKGYYGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R++D++YSQ +  L KAGI ++RKVL+DLA+   ++FK IV+  +
Sbjct: 61  WIQRINAAARIHDMSYSQLMGALRKAGIEINRKVLADLAMNNPEAFKAIVDKVK 114


>gi|182414171|ref|YP_001819237.1| 50S ribosomal protein L20 [Opitutus terrae PB90-1]
 gi|226730430|sp|B1ZQM8|RL20_OPITP RecName: Full=50S ribosomal protein L20
 gi|177841385|gb|ACB75637.1| ribosomal protein L20 [Opitutus terrae PB90-1]
          Length = 127

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 55/114 (48%), Positives = 72/114 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RV     S  + KKVLK AKG++G +    R AK AV  + QYAY  RR KK DFR+L
Sbjct: 1   MARVTNSPASRKRRKKVLKYAKGYFGSKSKLYRYAKEAVQHAWQYAYDHRRKKKSDFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI R+NAA R   ++YS+F+ GL  A I LDRKVL+DLA+     F  +V+ ++
Sbjct: 61  WIVRVNAACRNAGISYSRFMEGLKAANIALDRKVLADLAVRDEAGFNVLVKQAQ 114


>gi|83319552|ref|YP_424190.1| 50S ribosomal protein L20 [Mycoplasma capricolum subsp. capricolum
           ATCC 27343]
 gi|331703215|ref|YP_004399902.1| 50S ribosomal protein L20 [Mycoplasma mycoides subsp. capri LC str.
           95010]
 gi|109893122|sp|Q2SSS3|RL20_MYCCT RecName: Full=50S ribosomal protein L20
 gi|83283438|gb|ABC01370.1| 50S ribosomal protein L20 [Mycoplasma capricolum subsp. capricolum
           ATCC 27343]
 gi|256383816|gb|ACU78386.1| ribosomal protein L20 [Mycoplasma mycoides subsp. capri str. GM12]
 gi|256384646|gb|ACU79215.1| ribosomal protein L20 [Mycoplasma mycoides subsp. capri str. GM12]
 gi|296455302|gb|ADH21537.1| ribosomal protein L20 [synthetic Mycoplasma mycoides JCVI-syn1.0]
 gi|328801770|emb|CBW53923.1| 50S ribosomal protein L20 [Mycoplasma mycoides subsp. capri LC str.
           95010]
          Length = 119

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/117 (48%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ K+ +K AKG++G +K++ + A   V RS  YA+  R+ +KRDFRSL
Sbjct: 1   MARVKYGKVTRARRKRWIKLAKGYFGTKKSSYKKAHEQVIRSMAYAFIGRKERKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   L+YS F++GL  A I ++RK+LS+LAI   + FK+IV+ ++  L
Sbjct: 61  WIVRINAAVRPEGLSYSTFMHGLKLANININRKMLSELAINNSEEFKQIVQQAKKAL 117


>gi|331268134|ref|YP_004347783.1| ribosomal protein L20 [Chlorella variabilis]
 gi|325296311|gb|ADZ05031.1| ribosomal protein L20 [Chlorella variabilis]
          Length = 115

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 76/115 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  + K+VL  A GF G      R A+    ++  Y+YRDR+ KKR+F  L
Sbjct: 1   MTRVKRGNVARKRRKQVLNLANGFRGSSSRLFRTAQQQTMKALSYSYRDRQQKKREFCGL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
           WI R+NAA R + LNY++F + L KAGI L+RKVLS +A+    +F++++ L ++
Sbjct: 61  WITRLNAAARSHGLNYTEFRHNLKKAGIQLNRKVLSQVALRDQQAFEQLILLVKN 115


>gi|225389794|ref|ZP_03759518.1| hypothetical protein CLOSTASPAR_03542 [Clostridium asparagiforme
           DSM 15981]
 gi|225044152|gb|EEG54398.1| hypothetical protein CLOSTASPAR_03542 [Clostridium asparagiforme
           DSM 15981]
          Length = 118

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH +VLK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARIKGGLNAKKKHNRVLKMAKGYRGARSKQYRIAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ + GL  A + L+RKVLSD+AI   + F K+ EL++S++ 
Sbjct: 61  WIARINAAARINGLSYSKLMYGLKLANVDLNRKVLSDMAINDAEGFAKLAELAKSKIA 118


>gi|313183908|ref|YP_004021762.1| ribosomal protein L20 [Equisetum arvense]
 gi|281371628|gb|ADA63561.1| ribosomal protein L20 [Equisetum arvense]
          Length = 115

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/114 (41%), Positives = 65/114 (57%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG  +     K+LK A GF G      R A   V R+  ++YRDR  +KRD R L
Sbjct: 1   MTRVKRGFGARKYRTKILKIASGFKGSHSKLFRTANQQVLRALTFSYRDRNNRKRDLRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINA  R   ++Y+  I+ L+K  I L+RK L+ +AI   + F  I++  +
Sbjct: 61  WITRINATARKNGMSYNNLISFLYKNSIYLNRKTLAQMAILDNECFSDIIKNIK 114


>gi|325266385|ref|ZP_08133063.1| inorganic pyrophosphatase [Kingella denitrificans ATCC 33394]
 gi|324982178|gb|EGC17812.1| inorganic pyrophosphatase [Kingella denitrificans ATCC 33394]
          Length = 118

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/118 (55%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKV+  A G+ GRRKN  R AK AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MPRVKRGVTARARHKKVIALATGYRGRRKNVYRIAKQAVMKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINA  R   L+YS+F+NGL +A I LDRKVL+DLA+    +F ++VE +++ L 
Sbjct: 61  WIARINAGARQNGLSYSKFMNGLKRAAIELDRKVLADLAVFDKPAFAQLVEKAKAALA 118


>gi|153809787|ref|ZP_01962455.1| hypothetical protein RUMOBE_00168 [Ruminococcus obeum ATCC 29174]
 gi|149833965|gb|EDM89045.1| hypothetical protein RUMOBE_00168 [Ruminococcus obeum ATCC 29174]
          Length = 118

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 47/118 (39%), Positives = 74/118 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  +H + LK AKG+ G R    R AK +V R+   +Y  R+ KKR FR L
Sbjct: 1   MARIKGGLNAKKRHNRTLKLAKGYRGARSKQYRVAKQSVMRALASSYAGRKQKKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  A I ++RK+L++LA+   + F  + E+++  + 
Sbjct: 61  WIARINAAARMNGLSYSKMMHGLKVANIDINRKMLAELAVNDAEGFAALAEIAKKAVA 118


>gi|317491933|ref|ZP_07950367.1| ribosomal protein L20 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920054|gb|EFV41379.1| ribosomal protein L20 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 118

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 85/118 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKV+K AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVMKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L 
Sbjct: 61  WIARINAAARQNGISYSRFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSALA 118


>gi|139437955|ref|ZP_01771508.1| Hypothetical protein COLAER_00494 [Collinsella aerofaciens ATCC
           25986]
 gi|133776152|gb|EBA39972.1| Hypothetical protein COLAER_00494 [Collinsella aerofaciens ATCC
           25986]
          Length = 119

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 79/119 (66%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+KR V +  K + V+  AKG+YG    T + AK  V  S QY YRDRR KKR+ RSL
Sbjct: 1   MARIKRAVAAKKKRRTVMHRAKGYYGAASRTYKHAKEQVQHSLQYQYRDRRNKKREIRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RINAA R+ D++YSQF++GL  AGI LDRKVL+ +A   ++SF ++  +++  L  
Sbjct: 61  WITRINAAARLNDISYSQFMHGLKVAGIELDRKVLAQMAYEDIESFNELATIAKKALEA 119


>gi|332878460|ref|ZP_08446181.1| ribosomal protein L20 [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332683555|gb|EGJ56431.1| ribosomal protein L20 [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 114

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/114 (49%), Positives = 77/114 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK+L   KG++G RKN    AK   ++   YAYRDR+ KKR+FR+L
Sbjct: 1   MPRSVNHVASRARRKKILGLTKGYFGARKNVWTVAKNTWEKGLTYAYRDRKNKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+  ++YSQ +  LHKAGI ++RKVL+DLA+   ++FK +V   +
Sbjct: 61  WIQRINAAARLEGMSYSQLMGALHKAGIEINRKVLADLAMNHPEAFKAVVAKIK 114


>gi|293392220|ref|ZP_06636554.1| 50S ribosomal protein L20 [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952754|gb|EFE02873.1| 50S ribosomal protein L20 [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 117

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQSGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|125718309|ref|YP_001035442.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK36]
 gi|262282398|ref|ZP_06060166.1| ribosomal protein L20 [Streptococcus sp. 2_1_36FAA]
 gi|293365206|ref|ZP_06611923.1| 50S ribosomal protein L20 [Streptococcus oralis ATCC 35037]
 gi|296876706|ref|ZP_06900754.1| 50S ribosomal protein L20 [Streptococcus parasanguinis ATCC 15912]
 gi|306825432|ref|ZP_07458772.1| 50S ribosomal protein L20 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|307703744|ref|ZP_07640685.1| ribosomal protein L20 [Streptococcus oralis ATCC 35037]
 gi|315612969|ref|ZP_07887880.1| 50S ribosomal protein L20 [Streptococcus sanguinis ATCC 49296]
 gi|322374505|ref|ZP_08049019.1| ribosomal protein L20 [Streptococcus sp. C300]
 gi|322392245|ref|ZP_08065706.1| 50S ribosomal protein L20 [Streptococcus peroris ATCC 700780]
 gi|331266578|ref|YP_004326208.1| 50S ribosomal protein L20 [Streptococcus oralis Uo5]
 gi|166220796|sp|A3CNY7|RL20_STRSV RecName: Full=50S ribosomal protein L20
 gi|125498226|gb|ABN44892.1| 50S ribosomal protein L20, putative [Streptococcus sanguinis SK36]
 gi|262261689|gb|EEY80387.1| ribosomal protein L20 [Streptococcus sp. 2_1_36FAA]
 gi|291316656|gb|EFE57092.1| 50S ribosomal protein L20 [Streptococcus oralis ATCC 35037]
 gi|296432208|gb|EFH18007.1| 50S ribosomal protein L20 [Streptococcus parasanguinis ATCC 15912]
 gi|304432370|gb|EFM35346.1| 50S ribosomal protein L20 [Streptococcus sp. oral taxon 071 str.
           73H25AP]
 gi|307622579|gb|EFO01575.1| ribosomal protein L20 [Streptococcus oralis ATCC 35037]
 gi|315315079|gb|EFU63120.1| 50S ribosomal protein L20 [Streptococcus sanguinis ATCC 49296]
 gi|321144780|gb|EFX40180.1| 50S ribosomal protein L20 [Streptococcus peroris ATCC 700780]
 gi|321280005|gb|EFX57044.1| ribosomal protein L20 [Streptococcus sp. C300]
 gi|324991557|gb|EGC23490.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK353]
 gi|324993918|gb|EGC25837.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK405]
 gi|324994763|gb|EGC26676.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK678]
 gi|325690867|gb|EGD32868.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK115]
 gi|325694912|gb|EGD36817.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK150]
 gi|325696065|gb|EGD37956.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK160]
 gi|326683250|emb|CBZ00868.1| 50S ribosomal protein L20 [Streptococcus oralis Uo5]
 gi|327461075|gb|EGF07408.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK1057]
 gi|327463180|gb|EGF09501.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK1]
 gi|327470712|gb|EGF16168.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK330]
 gi|327474789|gb|EGF20194.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK408]
 gi|327489896|gb|EGF21685.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK1058]
 gi|328946546|gb|EGG40685.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK1087]
 gi|332359449|gb|EGJ37269.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK355]
 gi|332361942|gb|EGJ39744.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK49]
 gi|332362514|gb|EGJ40314.1| 50S ribosomal protein L20 [Streptococcus sanguinis SK1056]
          Length = 119

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVND 102


>gi|262037714|ref|ZP_06011156.1| ribosomal protein L20 [Leptotrichia goodfellowii F0264]
 gi|261748186|gb|EEY35583.1| ribosomal protein L20 [Leptotrichia goodfellowii F0264]
          Length = 114

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 75/114 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+V   +HKKVLK AKG+ G  K   + A  AV ++  YA   R+ KKR  R L
Sbjct: 1   MPRVKTGIVRRKRHKKVLKEAKGYRGSVKTNFKKANEAVKKAMAYATEHRKQKKRKMREL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R+  ++YS+F+NGL KAGI LDRKVL+DLA+     F K+VE  +
Sbjct: 61  WIIRINAAARLNGVSYSKFMNGLKKAGIELDRKVLADLALNNPADFAKLVEKVK 114


>gi|304382820|ref|ZP_07365303.1| 50S ribosomal protein L20 [Prevotella marshii DSM 16973]
 gi|304336005|gb|EFM02252.1| 50S ribosomal protein L20 [Prevotella marshii DSM 16973]
          Length = 114

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/114 (51%), Positives = 79/114 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S AK K++LK  +G+YG RKN    AK   ++   YAYRDRR+KKR+FR+L
Sbjct: 1   MPRSVNHVASRAKRKRILKLTRGYYGARKNVWTVAKNTWEKGLTYAYRDRRLKKRNFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WIQRINAA R+ D++YS  +  LHKAGI ++RKVL+DLA+    +FK IV+  +
Sbjct: 61  WIQRINAAARMEDMSYSTLMGALHKAGIEINRKVLADLAVNNPQAFKAIVDKVK 114


>gi|317507015|ref|ZP_07964782.1| ribosomal protein L20 [Segniliparus rugosus ATCC BAA-974]
 gi|316254699|gb|EFV14002.1| ribosomal protein L20 [Segniliparus rugosus ATCC BAA-974]
          Length = 126

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 76/118 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKR V +  K + +L ++KG+ G+R    R AK    RS  YA+RDRR +K +FR L
Sbjct: 1   MARVKRAVNAHKKRRTILDASKGYRGQRSRMYRKAKEQQLRSLVYAFRDRRARKGEFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L Y++FI GL  AGI +DRK+L++LA+ +   F ++VE +R  + 
Sbjct: 61  WITRINAAARANGLTYNRFIQGLALAGIEVDRKILAELAVNEPQVFAQLVEAAREAVA 118


>gi|307718471|ref|YP_003874003.1| 50S ribosomal protein L20 [Spirochaeta thermophila DSM 6192]
 gi|306532196|gb|ADN01730.1| 50S ribosomal protein L20 [Spirochaeta thermophila DSM 6192]
 gi|315187009|gb|EFU20766.1| LSU ribosomal protein L20P [Spirochaeta thermophila DSM 6578]
          Length = 119

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/119 (47%), Positives = 80/119 (67%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R   G     + KK+LK AKGF+GRRK+  R AK AV ++  Y+YRDR+ +KR+FR L
Sbjct: 1   MPRAIDGTRRKDRRKKILKLAKGFWGRRKSNFRTAKDAVAKALVYSYRDRKYRKREFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLV 119
           WI RI+AA R   + YS+FI GL K+ I ++RKVLS++AI    +FK++V  ++  L V
Sbjct: 61  WIARISAACREEGMTYSRFIEGLRKSNIAINRKVLSNMAIEDPQAFKELVATAKKALEV 119


>gi|75909654|ref|YP_323950.1| 50S ribosomal protein L20 [Anabaena variabilis ATCC 29413]
 gi|109893096|sp|Q3M7I1|RL20_ANAVT RecName: Full=50S ribosomal protein L20
 gi|75703379|gb|ABA23055.1| LSU ribosomal protein L20P [Anabaena variabilis ATCC 29413]
          Length = 118

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 74/116 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  +  K+LK AKGF G      R A   V ++ + AYRDR+ KKRDFR L
Sbjct: 1   MTRVKRGNVARKRRNKILKLAKGFRGSHSTLFRTANQQVMKALRSAYRDRKKKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R + L+YSQ I  L KA I L+RK+L+ LA+    SF K+ EL+   
Sbjct: 61  WITRINAAARQHGLSYSQLIGNLKKADIQLNRKMLAQLAVLDPASFGKVAELAIQA 116


>gi|322385724|ref|ZP_08059368.1| 50S ribosomal protein L20 [Streptococcus cristatus ATCC 51100]
 gi|321270462|gb|EFX53378.1| 50S ribosomal protein L20 [Streptococcus cristatus ATCC 51100]
          Length = 119

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVND 102


>gi|307706459|ref|ZP_07643268.1| ribosomal protein L20 [Streptococcus mitis SK321]
 gi|307618169|gb|EFN97327.1| ribosomal protein L20 [Streptococcus mitis SK321]
          Length = 119

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVND 102


>gi|195977987|ref|YP_002123231.1| 50S ribosomal protein L20 [Streptococcus equi subsp. zooepidemicus
           MGCS10565]
 gi|225868681|ref|YP_002744629.1| 50S ribosomal protein L20 [Streptococcus equi subsp. zooepidemicus]
 gi|225870362|ref|YP_002746309.1| 50S ribosomal protein L20 [Streptococcus equi subsp. equi 4047]
 gi|270292935|ref|ZP_06199146.1| ribosomal protein L20 [Streptococcus sp. M143]
 gi|289167804|ref|YP_003446073.1| 50S ribosomal protein L20 [Streptococcus mitis B6]
 gi|306829313|ref|ZP_07462503.1| 50S ribosomal protein L20 [Streptococcus mitis ATCC 6249]
 gi|307704691|ref|ZP_07641590.1| ribosomal protein L20 [Streptococcus mitis SK597]
 gi|307708593|ref|ZP_07645057.1| ribosomal protein L20 [Streptococcus mitis NCTC 12261]
 gi|307709142|ref|ZP_07645601.1| ribosomal protein L20 [Streptococcus mitis SK564]
 gi|319939327|ref|ZP_08013687.1| 50S ribosomal protein L20 [Streptococcus anginosus 1_2_62CV]
 gi|319946725|ref|ZP_08020959.1| 50S ribosomal protein L20 [Streptococcus australis ATCC 700641]
 gi|322376455|ref|ZP_08050948.1| ribosomal protein L20 [Streptococcus sp. M334]
 gi|322388181|ref|ZP_08061785.1| 50S ribosomal protein L20 [Streptococcus infantis ATCC 700779]
 gi|322389276|ref|ZP_08062836.1| 50S ribosomal protein L20 [Streptococcus parasanguinis ATCC 903]
 gi|226730456|sp|B4U2K1|RL20_STREM RecName: Full=50S ribosomal protein L20
 gi|254800340|sp|C0M8T1|RL20_STRE4 RecName: Full=50S ribosomal protein L20
 gi|259646199|sp|C0MGL8|RL20_STRS7 RecName: Full=50S ribosomal protein L20
 gi|195974692|gb|ACG62218.1| 50S ribosomal protein L20 RplT [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225699766|emb|CAW93548.1| 50S ribosomal protein L20 [Streptococcus equi subsp. equi 4047]
 gi|225701957|emb|CAW99498.1| 50S ribosomal protein L20 [Streptococcus equi subsp. zooepidemicus]
 gi|270278914|gb|EFA24760.1| ribosomal protein L20 [Streptococcus sp. M143]
 gi|288907371|emb|CBJ22208.1| 50S ribosomal protein L20 [Streptococcus mitis B6]
 gi|301801804|emb|CBW34515.1| 50S ribosomal protein L20 [Streptococcus pneumoniae INV200]
 gi|304428399|gb|EFM31489.1| 50S ribosomal protein L20 [Streptococcus mitis ATCC 6249]
 gi|307615342|gb|EFN94551.1| ribosomal protein L20 [Streptococcus mitis NCTC 12261]
 gi|307620088|gb|EFN99205.1| ribosomal protein L20 [Streptococcus mitis SK564]
 gi|307621738|gb|EFO00776.1| ribosomal protein L20 [Streptococcus mitis SK597]
 gi|319746773|gb|EFV99032.1| 50S ribosomal protein L20 [Streptococcus australis ATCC 700641]
 gi|319811313|gb|EFW07608.1| 50S ribosomal protein L20 [Streptococcus anginosus 1_2_62CV]
 gi|321140853|gb|EFX36354.1| 50S ribosomal protein L20 [Streptococcus infantis ATCC 700779]
 gi|321144020|gb|EFX39438.1| 50S ribosomal protein L20 [Streptococcus parasanguinis ATCC 903]
 gi|321282262|gb|EFX59269.1| ribosomal protein L20 [Streptococcus sp. M334]
          Length = 119

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVND 102


>gi|323351274|ref|ZP_08086930.1| 50S ribosomal protein L20 [Streptococcus sanguinis VMC66]
 gi|322122498|gb|EFX94209.1| 50S ribosomal protein L20 [Streptococcus sanguinis VMC66]
          Length = 119

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKILADLAVND 102


>gi|255994772|ref|ZP_05427907.1| ribosomal protein L20 [Eubacterium saphenum ATCC 49989]
 gi|255993485|gb|EEU03574.1| ribosomal protein L20 [Eubacterium saphenum ATCC 49989]
          Length = 117

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 59/116 (50%), Positives = 85/116 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K+GV + A+HKK+LK AKGFYG +KN  RAA  AV R+ + AY+ R+ +KRDFR L
Sbjct: 1   MARIKKGVTAHARHKKILKQAKGFYGTKKNVFRAANTAVMRALREAYKGRKHRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R+  L+YS+ INGL K+G+ ++RK+LS+LAI   ++F  + + ++  
Sbjct: 61  WITRINAAARLNGLSYSKLINGLKKSGVEVNRKMLSELAINNKEAFTALCDKAKMA 116


>gi|332295140|ref|YP_004437063.1| 50S ribosomal protein L20 [Thermodesulfobium narugense DSM 14796]
 gi|332178243|gb|AEE13932.1| 50S ribosomal protein L20 [Thermodesulfobium narugense DSM 14796]
          Length = 115

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/113 (50%), Positives = 77/113 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  +HKKVLK  KGF G      R A   +  + +YA+ DRR KKR+FRSLWI
Sbjct: 2   RVKGGFVTRRRHKKVLKMTKGFRGSLHKLYRTANQHLLHALKYAFVDRRRKKREFRSLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRS 115
            RINAAVR Y L+YS+F+N L K+G+ +DRKVL+ +A++  + FKK+V   + 
Sbjct: 62  VRINAAVREYGLSYSKFMNALKKSGLDIDRKVLAQMALSYPEQFKKVVMKVKE 114


>gi|332288525|ref|YP_004419377.1| 50S ribosomal protein L20 [Gallibacterium anatis UMN179]
 gi|330431421|gb|AEC16480.1| 50S ribosomal protein L20 [Gallibacterium anatis UMN179]
          Length = 117

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|225375384|ref|ZP_03752605.1| hypothetical protein ROSEINA2194_01009 [Roseburia inulinivorans DSM
           16841]
 gi|225212873|gb|EEG95227.1| hypothetical protein ROSEINA2194_01009 [Roseburia inulinivorans DSM
           16841]
          Length = 118

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 46/118 (38%), Positives = 74/118 (62%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  +H + LK AKG+ G R    R AK +V R+   +Y  R+ +KR FR L
Sbjct: 1   MARVKGGLGAKKRHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  ++YSQ ++GL  +GI ++RK+L+++A+     F  + E+++  + 
Sbjct: 61  WIARINAAARMNGISYSQMMHGLKVSGIDINRKMLAEMAVNDAAGFAALAEVAKKAVA 118


>gi|312867636|ref|ZP_07727842.1| ribosomal protein L20 [Streptococcus parasanguinis F0405]
 gi|311096699|gb|EFQ54937.1| ribosomal protein L20 [Streptococcus parasanguinis F0405]
          Length = 119

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K++LK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRILKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARMNGLSYSQLMHGLKLAEIEVNRKMLADLAVND 102


>gi|297565685|ref|YP_003684657.1| 50S ribosomal protein L20 [Meiothermus silvanus DSM 9946]
 gi|296850134|gb|ADH63149.1| ribosomal protein L20 [Meiothermus silvanus DSM 9946]
          Length = 116

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 55/116 (47%), Positives = 79/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K GVV   KHKK+LK AKGF+G R  T+R A+  +      ++ DRR KK ++R L
Sbjct: 1   MPRAKTGVVRRRKHKKILKLAKGFWGLRSKTVRKARETLFSGAMRSFNDRREKKNEYRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAAVR + ++YS F+ GL KAGI +DRK+L+DLA+ + ++F ++V  ++  
Sbjct: 61  WIVRINAAVRQHGMSYSVFMGGLKKAGIEIDRKLLADLAVREPEAFAQLVAKAKGA 116


>gi|221134663|ref|ZP_03560966.1| 50S ribosomal protein L20 [Glaciecola sp. HTCC2999]
          Length = 118

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/118 (53%), Positives = 82/118 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRG ++ A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGTIARARHKKVLKQAKGYYGARSRVYRVAVQAVTKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +V  ++  L 
Sbjct: 61  WIARINAASRQNGLSYSRFINGLKKASVEIDRKILADIAVHDKVAFTALVATAKGALA 118


>gi|16273230|ref|NP_439471.1| 50S ribosomal protein L20 [Haemophilus influenzae Rd KW20]
 gi|32034415|ref|ZP_00134597.1| COG0292: Ribosomal protein L20 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|52425111|ref|YP_088248.1| 50S ribosomal protein L20 [Mannheimia succiniciproducens MBEL55E]
 gi|68249989|ref|YP_249101.1| 50S ribosomal protein L20 [Haemophilus influenzae 86-028NP]
 gi|126207713|ref|YP_001052938.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae L20]
 gi|145629399|ref|ZP_01785197.1| 50S ribosomal protein L20 [Haemophilus influenzae 22.1-21]
 gi|145630793|ref|ZP_01786571.1| 50S ribosomal protein L20 [Haemophilus influenzae R3021]
 gi|145633195|ref|ZP_01788926.1| 50S ribosomal protein L20 [Haemophilus influenzae 3655]
 gi|145634938|ref|ZP_01790645.1| 50S ribosomal protein L20 [Haemophilus influenzae PittAA]
 gi|145636196|ref|ZP_01791866.1| 50S ribosomal protein L20 [Haemophilus influenzae PittHH]
 gi|145638899|ref|ZP_01794507.1| 50S ribosomal protein L20 [Haemophilus influenzae PittII]
 gi|145641652|ref|ZP_01797229.1| 50S ribosomal protein L20 [Haemophilus influenzae R3021]
 gi|148826023|ref|YP_001290776.1| 50S ribosomal protein L20 [Haemophilus influenzae PittEE]
 gi|148826977|ref|YP_001291730.1| 50S ribosomal protein L20 [Haemophilus influenzae PittGG]
 gi|165975681|ref|YP_001651274.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|229845143|ref|ZP_04465278.1| 50S ribosomal protein L20 [Haemophilus influenzae 6P18H1]
 gi|229847479|ref|ZP_04467576.1| 50S ribosomal protein L20 [Haemophilus influenzae 7P49H1]
 gi|260581333|ref|ZP_05849149.1| ribosomal protein L20 [Haemophilus influenzae RdAW]
 gi|260582455|ref|ZP_05850246.1| ribosomal protein L20 [Haemophilus influenzae NT127]
 gi|260914008|ref|ZP_05920482.1| inorganic diphosphatase [Pasteurella dagmatis ATCC 43325]
 gi|303251653|ref|ZP_07337826.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303252804|ref|ZP_07338964.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307245037|ref|ZP_07527132.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307247210|ref|ZP_07529260.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307249438|ref|ZP_07531427.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307251755|ref|ZP_07533658.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307253991|ref|ZP_07535840.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307256251|ref|ZP_07538036.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307258446|ref|ZP_07540185.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307260683|ref|ZP_07542373.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307262815|ref|ZP_07544440.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|315634194|ref|ZP_07889483.1| inorganic diphosphatase [Aggregatibacter segnis ATCC 33393]
 gi|319776262|ref|YP_004138750.1| 50S ribosomal subunit protein L20 [Haemophilus influenzae F3047]
 gi|319897108|ref|YP_004135303.1| 50S ribosomal subunit protein l20 [Haemophilus influenzae F3031]
 gi|322514761|ref|ZP_08067786.1| inorganic pyrophosphatase [Actinobacillus ureae ATCC 25976]
 gi|325578414|ref|ZP_08148549.1| inorganic pyrophosphatase [Haemophilus parainfluenzae ATCC 33392]
 gi|329123402|ref|ZP_08251966.1| inorganic pyrophosphatase [Haemophilus aegyptius ATCC 11116]
 gi|1172988|sp|P44358|RL20_HAEIN RecName: Full=50S ribosomal protein L20
 gi|60390342|sp|Q65TP7|RL20_MANSM RecName: Full=50S ribosomal protein L20
 gi|81335587|sp|Q4QKK6|RL20_HAEI8 RecName: Full=50S ribosomal protein L20
 gi|166219601|sp|A3MYU7|RL20_ACTP2 RecName: Full=50S ribosomal protein L20
 gi|166219649|sp|A5UC92|RL20_HAEIE RecName: Full=50S ribosomal protein L20
 gi|166219650|sp|A5UEZ1|RL20_HAEIG RecName: Full=50S ribosomal protein L20
 gi|226730345|sp|B0BSM8|RL20_ACTPJ RecName: Full=50S ribosomal protein L20
 gi|1574780|gb|AAC22965.1| ribosomal protein L20 (rpL20) [Haemophilus influenzae Rd KW20]
 gi|52307163|gb|AAU37663.1| RplT protein [Mannheimia succiniciproducens MBEL55E]
 gi|68058188|gb|AAX88441.1| 50S ribosomal protein L20 [Haemophilus influenzae 86-028NP]
 gi|126096505|gb|ABN73333.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|144978242|gb|EDJ88006.1| 50S ribosomal protein L20 [Haemophilus influenzae 22.1-21]
 gi|144983675|gb|EDJ91135.1| 50S ribosomal protein L20 [Haemophilus influenzae R3021]
 gi|144986041|gb|EDJ92631.1| 50S ribosomal protein L20 [Haemophilus influenzae 3655]
 gi|145267804|gb|EDK07801.1| 50S ribosomal protein L20 [Haemophilus influenzae PittAA]
 gi|145270718|gb|EDK10651.1| 50S ribosomal protein L20 [Haemophilus influenzae PittHH]
 gi|145271871|gb|EDK11780.1| 50S ribosomal protein L20 [Haemophilus influenzae PittII]
 gi|145273699|gb|EDK13568.1| 50S ribosomal protein L20 [Haemophilus influenzae 22.4-21]
 gi|148716183|gb|ABQ98393.1| 50S ribosomal protein L20 [Haemophilus influenzae PittEE]
 gi|148718219|gb|ABQ99346.1| 50S ribosomal protein L20 [Haemophilus influenzae PittGG]
 gi|165875782|gb|ABY68830.1| ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|229809620|gb|EEP45347.1| 50S ribosomal protein L20 [Haemophilus influenzae 7P49H1]
 gi|229811979|gb|EEP47673.1| 50S ribosomal protein L20 [Haemophilus influenzae 6P18H1]
 gi|260092000|gb|EEW75947.1| ribosomal protein L20 [Haemophilus influenzae RdAW]
 gi|260094435|gb|EEW78332.1| ribosomal protein L20 [Haemophilus influenzae NT127]
 gi|260632095|gb|EEX50272.1| inorganic diphosphatase [Pasteurella dagmatis ATCC 43325]
 gi|301156310|emb|CBW15781.1| 50S ribosomal subunit protein L20 [Haemophilus parainfluenzae T3T1]
 gi|301170068|emb|CBW29672.1| 50S ribosomal subunit protein L20 [Haemophilus influenzae 10810]
 gi|302648365|gb|EFL78561.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302649495|gb|EFL79678.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306854061|gb|EFM86271.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306856268|gb|EFM88421.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306858512|gb|EFM90579.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306860756|gb|EFM92766.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306863054|gb|EFM94999.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306865250|gb|EFM97148.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306867488|gb|EFM99337.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306869604|gb|EFN01391.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306871830|gb|EFN03549.1| 50S ribosomal protein L20 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|309750875|gb|ADO80859.1| 50S ribosomal protein L20 [Haemophilus influenzae R2866]
 gi|309973158|gb|ADO96359.1| 50S ribosomal protein L20 [Haemophilus influenzae R2846]
 gi|315477444|gb|EFU68187.1| inorganic diphosphatase [Aggregatibacter segnis ATCC 33393]
 gi|317432612|emb|CBY80973.1| 50S ribosomal subunit protein L20 [Haemophilus influenzae F3031]
 gi|317450853|emb|CBY87077.1| 50S ribosomal subunit protein L20 [Haemophilus influenzae F3047]
 gi|322119299|gb|EFX91419.1| inorganic pyrophosphatase [Actinobacillus ureae ATCC 25976]
 gi|325160150|gb|EGC72279.1| inorganic pyrophosphatase [Haemophilus parainfluenzae ATCC 33392]
 gi|327470984|gb|EGF16439.1| inorganic pyrophosphatase [Haemophilus aegyptius ATCC 11116]
          Length = 117

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 66/117 (56%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKKVLK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK+L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKVAFAALVEKAKSAL 117


>gi|21672410|ref|NP_660477.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|22654279|sp|P46246|RL20_BUCAP RecName: Full=50S ribosomal protein L20
 gi|21623019|gb|AAM67688.1| 50S ribosomal protein L20 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 118

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 82/117 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVLK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVTAHARHKKVLKQAKGYYGARSRIYRVACQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAAVR   ++YS F+ GL KA I +DRK+LSD+AI    SF  +++ ++  L
Sbjct: 61  WITRINAAVRQSQMSYSSFMYGLKKASINIDRKILSDIAIFDGFSFNILIKKAKEAL 117


>gi|104774346|ref|YP_619326.1| 50S ribosomal protein L20 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|300813183|ref|ZP_07093557.1| ribosomal protein L20 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|215274941|sp|Q049G3|RL20_LACDB RecName: Full=50S ribosomal protein L20
 gi|103423427|emb|CAI98300.1| 50S ribosomal protein L20 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|300495841|gb|EFK30989.1| ribosomal protein L20 [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|325126141|gb|ADY85471.1| 50S ribosomal protein L20 [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
 gi|325685795|gb|EGD27868.1| 50S ribosomal protein L20 [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 118

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 76/118 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G V+ A+ KKVLK AKG+ G +    +AA   +  S +YA+RDR+ +K +FR L
Sbjct: 1   MPRVKGGTVTRARRKKVLKLAKGYRGSKHVQFKAASTQLFVSYKYAFRDRKKRKSEFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+ ++GL  AG+ ++RK+L+D+A     +F  + E ++  L 
Sbjct: 61  WIARINAAARQNGLSYSKMMHGLKLAGVDMNRKMLADIAYNDEKTFAALAETAKKALA 118


>gi|33152808|ref|NP_874161.1| 50S ribosomal protein L20 [Haemophilus ducreyi 35000HP]
 gi|39931809|sp|Q7VKS2|RL20_HAEDU RecName: Full=50S ribosomal protein L20
 gi|33149032|gb|AAP96550.1| 50S ribosomal protein L20 [Haemophilus ducreyi 35000HP]
          Length = 117

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 65/117 (55%), Positives = 85/117 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV++ A+HKK+LK+AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARVKRGVIARARHKKILKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KA + +DRK L+D+A+    +F  +VE ++S L
Sbjct: 61  WIARINAAARQNGLSYSKFINGLKKASVEIDRKTLADIAVFDKVAFAALVEKAKSAL 117


>gi|315651592|ref|ZP_07904609.1| inorganic diphosphatase [Eubacterium saburreum DSM 3986]
 gi|315486151|gb|EFU76516.1| inorganic diphosphatase [Eubacterium saburreum DSM 3986]
          Length = 118

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 55/118 (46%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK  + +  +H +VLK AKG+ G R    R AK +V R+   AY  R+ +KR FR L
Sbjct: 1   MARVKGALNAKKRHNRVLKLAKGYRGARSKQYRIAKQSVMRALASAYAGRKERKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  AG+ ++RKVL+DLA+     F KI EL++S+L 
Sbjct: 61  WIARINAAARLNGLSYSKLMHGLKSAGVDMNRKVLADLAVNDAVGFSKIAELAKSKLA 118


>gi|223931052|ref|YP_002586913.1| ribosomal protein L20 [Syntrichia ruralis]
 gi|219562266|gb|ACL27597.1| ribosomal protein L20 [Syntrichia ruralis]
          Length = 116

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 44/116 (37%), Positives = 63/116 (54%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  + K +     GF G      R A     R+   +YRDR  +KRD R L
Sbjct: 1   MTRVKRGYVARKRRKNIFILTSGFQGAHSKLFRTANQQGMRALASSYRDRSKRKRDLRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI RINAA R   L+Y++ I  L++  ++L+RKVL+ +A+     F  I++     
Sbjct: 61  WITRINAAARSNGLSYNKLIQNLYQNQVLLNRKVLAQIALLDNSCFFTILKKVNES 116


>gi|260438621|ref|ZP_05792437.1| ribosomal protein L20 [Butyrivibrio crossotus DSM 2876]
 gi|292809215|gb|EFF68420.1| ribosomal protein L20 [Butyrivibrio crossotus DSM 2876]
          Length = 118

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 76/117 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK G+ +  KH +VLK AKG+ G R    R AK +V R+   AY  R+ KKR  R L
Sbjct: 1   MARVKGGLNAKKKHNRVLKLAKGYRGARSKQYRIAKQSVMRALTSAYAGRKQKKRQMRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R+  L+YS+F+ GL  AGI ++RK+L++LA+    +F K+ + +++ L
Sbjct: 61  WIARINAAARMNGLSYSRFMFGLKTAGIEMNRKMLAELAVNDAAAFTKLADAAKANL 117


>gi|189183696|ref|YP_001937481.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Ikeda]
 gi|226730431|sp|B3CRZ0|RL20_ORITI RecName: Full=50S ribosomal protein L20
 gi|189180467|dbj|BAG40247.1| 50S ribosomal protein L20 [Orientia tsutsugamushi str. Ikeda]
          Length = 121

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 67/121 (55%), Positives = 88/121 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M+R + G V+  +HKK+LK AKG+ GR KN  R A   V+++ QY+YRDRR +KR FR+L
Sbjct: 1   MSRARSGKVNKNRHKKILKLAKGYRGRAKNCFRIAIQKVEKALQYSYRDRRNRKRQFRAL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
           WIQRINAAVR YD+ YSQFINGL +A I +DRKV++DLA+   DSF  +VEL++  L   
Sbjct: 61  WIQRINAAVRQYDITYSQFINGLKQANITVDRKVMADLAVHNADSFVHLVELTKKSLAKT 120

Query: 121 V 121
            
Sbjct: 121 A 121


>gi|71908287|ref|YP_285874.1| 50S ribosomal protein L20 [Dechloromonas aromatica RCB]
 gi|109893109|sp|Q47CM7|RL20_DECAR RecName: Full=50S ribosomal protein L20
 gi|71847908|gb|AAZ47404.1| LSU ribosomal protein L20P [Dechloromonas aromatica RCB]
          Length = 119

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/103 (62%), Positives = 75/103 (72%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGV + A+HKKVL  AKG+ GRRKN  R AK AV ++ QY YRDRR +KR FRSL
Sbjct: 1   MPRVKRGVTARARHKKVLVQAKGYRGRRKNVYRIAKQAVMKAGQYQYRDRRQRKRQFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQL 103
           WI RINAA R   + YS F+NGL KA I +DRKVL+DLA+   
Sbjct: 61  WIARINAAARELGMKYSTFMNGLKKANIEVDRKVLADLAVFDQ 103


>gi|166032008|ref|ZP_02234837.1| hypothetical protein DORFOR_01710 [Dorea formicigenerans ATCC
           27755]
 gi|166028461|gb|EDR47218.1| hypothetical protein DORFOR_01710 [Dorea formicigenerans ATCC
           27755]
          Length = 118

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 47/118 (39%), Positives = 76/118 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH + LK AKG+ G R    R AK +V R+   +Y  R+ +KR  R L
Sbjct: 1   MARIKGGLNAKKKHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKRQMRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+ ++GL  AG+ ++RK+L+++A+   + F  + EL++S++ 
Sbjct: 61  WIARINAAARLNGLSYSKMMHGLKVAGVDINRKMLAEMAVNDAEGFATLAELAKSKIA 118


>gi|330719253|ref|ZP_08313853.1| 50S ribosomal protein L20 [Leuconostoc fallax KCTC 3537]
          Length = 139

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 79/118 (66%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G VS A+ KK +K AKG+ G+R+   + AK  V +S  YAYRDR+  KR+FR LWI
Sbjct: 2   RVKGGTVSRARRKKFIKLAKGYRGQRRINFKVAKQQVYKSYLYAYRDRKNTKRNFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD 120
            RINAA R+  L+YS+ ++GL  AG  L+RK+L+DLA++  ++F  +   ++  L  +
Sbjct: 62  ARINAAARMNGLSYSKLMHGLTLAGSQLNRKMLADLAVSDFETFSALANQAKEALASE 119


>gi|325263824|ref|ZP_08130557.1| ribosomal protein L20 [Clostridium sp. D5]
 gi|324030862|gb|EGB92144.1| ribosomal protein L20 [Clostridium sp. D5]
          Length = 118

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 46/118 (38%), Positives = 77/118 (65%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R+K G+ +  KH + LK AKG+ G R    R AK +V R+   +Y  R+ +KR  R L
Sbjct: 1   MARIKGGMNARKKHNRTLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRKQRKRQMRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R+  L+YS+F++GL  A + ++RK+L++LA++  + F  + E++++++ 
Sbjct: 61  WIARINAAARMNGLSYSKFMHGLKLAEVDMNRKMLAELAVSDKEGFATLAEVAKAKIA 118


>gi|91215267|ref|ZP_01252239.1| 50S ribosomal protein L20 [Psychroflexus torquis ATCC 700755]
 gi|91186872|gb|EAS73243.1| 50S ribosomal protein L20 [Psychroflexus torquis ATCC 700755]
          Length = 114

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 58/114 (50%), Positives = 81/114 (71%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R    V S A+ KK++K AKG++GRRKN    AK AV+++  YAYRDR+ KKR+FRSL
Sbjct: 1   MPRSTNSVASRARRKKIMKQAKGYFGRRKNVWTIAKNAVEKAMLYAYRDRKTKKRNFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSR 114
           WI RINAA R++ L+YSQF+  +    I L+RKVL+DLA+   ++FK +V+  +
Sbjct: 61  WIIRINAAARLHGLSYSQFMGKVKAHNIELNRKVLADLAMNNPEAFKAVVDKVK 114


>gi|240047799|ref|YP_002961187.1| 50S ribosomal protein L20 [Mycoplasma conjunctivae HRC/581]
 gi|239985371|emb|CAT05384.1| 50S ribosomal protein L20 [Mycoplasma conjunctivae]
          Length = 124

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 57/114 (50%), Positives = 78/114 (68%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVK G V+  + KK LK AKG++G +    + AK AV +S  YA+RDR+  KRDFR LWI
Sbjct: 2   RVKGGTVTRQRRKKWLKLAKGYWGHKSIGYKVAKQAVVKSWTYAFRDRKQVKRDFRKLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
            RINAA R Y + YSQ +NG+  A I ++RK+LS+LAI   ++F +IV+L+R  
Sbjct: 62  SRINAASRNYGMTYSQLMNGIKLAEIDINRKMLSELAIHHEEAFAQIVKLARDA 115


>gi|183598819|ref|ZP_02960312.1| hypothetical protein PROSTU_02251 [Providencia stuartii ATCC 25827]
 gi|268592570|ref|ZP_06126791.1| ribosomal protein L20 [Providencia rettgeri DSM 1131]
 gi|188021027|gb|EDU59067.1| hypothetical protein PROSTU_02251 [Providencia stuartii ATCC 25827]
 gi|291311984|gb|EFE52437.1| ribosomal protein L20 [Providencia rettgeri DSM 1131]
          Length = 118

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 64/118 (54%), Positives = 83/118 (70%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R KRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR L
Sbjct: 1   MARAKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WI RINAA R   L+YS+FINGL KA I +DRK+L+D+A+    +F  +VE ++  L 
Sbjct: 61  WIARINAAARQNGLSYSRFINGLKKASIEIDRKILADIAVFDKAAFTALVEKAKGALA 118


>gi|34811568|pdb|1PNU|O Chain O, Crystal Structure Of A Streptomycin Dependent Ribosome
           From Escherichia Coli, 50s Subunit Of 70s Ribosome. This
           File, 1pnu, Contains Only Molecules Of The 50s Ribosomal
           Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site
           Trna Are In The Pdb File 1pns.
 gi|34811621|pdb|1PNY|O Chain O, Crystal Structure Of The Wild Type Ribosome From E. Coli,
           50s Subunit Of 70s Ribosome. This File, 1pny, Contains
           Only Molecules Of The 50s Ribosomal Subunit. The 30s
           Subunit Is In The Pdb File 1pnx.
 gi|56966360|pdb|1VOR|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966413|pdb|1VOU|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966466|pdb|1VOW|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966519|pdb|1VOY|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 gi|56966572|pdb|1VP0|R Chain R, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400
          Length = 117

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 61/115 (53%), Positives = 79/115 (68%)

Query: 2   TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            R K G+V   +HKKVLK AKGF+G R    R A   +  +  Y YRDRR KKRDFR LW
Sbjct: 1   PRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRLW 60

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           IQRINA  R++ +NYS FINGL +A I L+RKVL+D+A  + ++FK +V+ SR+ 
Sbjct: 61  IQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAREPEAFKALVDASRNA 115


>gi|322372881|ref|ZP_08047417.1| ribosomal protein L20 [Streptococcus sp. C150]
 gi|321277923|gb|EFX54992.1| ribosomal protein L20 [Streptococcus sp. C150]
          Length = 119

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 58/102 (56%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVND 102


>gi|282896967|ref|ZP_06304971.1| Ribosomal protein L20 [Raphidiopsis brookii D9]
 gi|281198140|gb|EFA73032.1| Ribosomal protein L20 [Raphidiopsis brookii D9]
          Length = 118

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 57/113 (50%), Positives = 73/113 (64%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG V+  +  K+LK AKGF G      R A   V ++ + AYRDR+ KKRDFR L
Sbjct: 1   MTRVKRGNVARNRRNKILKLAKGFRGSHSTLFRTANQQVMKALRSAYRDRKKKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELS 113
           WI RINAA R   L+YSQ I  L KA + L+RK+L+ LA+    +F K+ EL+
Sbjct: 61  WITRINAASRQQGLSYSQLIGNLKKANVELNRKMLAQLAVLDPATFAKVAELA 113


>gi|55821143|ref|YP_139585.1| 50S ribosomal protein L20 [Streptococcus thermophilus LMG 18311]
 gi|55823054|ref|YP_141495.1| 50S ribosomal protein L20 [Streptococcus thermophilus CNRZ1066]
 gi|116627858|ref|YP_820477.1| 50S ribosomal protein L20 [Streptococcus thermophilus LMD-9]
 gi|228477492|ref|ZP_04062128.1| ribosomal protein L20 [Streptococcus salivarius SK126]
 gi|312862899|ref|ZP_07723139.1| ribosomal protein L20 [Streptococcus vestibularis F0396]
 gi|322516718|ref|ZP_08069627.1| 50S ribosomal protein L20 [Streptococcus vestibularis ATCC 49124]
 gi|81820293|sp|Q5LZL9|RL20_STRT1 RecName: Full=50S ribosomal protein L20
 gi|81820455|sp|Q5M472|RL20_STRT2 RecName: Full=50S ribosomal protein L20
 gi|122267545|sp|Q03KJ1|RL20_STRTD RecName: Full=50S ribosomal protein L20
 gi|55737128|gb|AAV60770.1| 50S ribosomal protein L20 [Streptococcus thermophilus LMG 18311]
 gi|55739039|gb|AAV62680.1| 50S ribosomal protein L20 [Streptococcus thermophilus CNRZ1066]
 gi|116101135|gb|ABJ66281.1| LSU ribosomal protein L20P [Streptococcus thermophilus LMD-9]
 gi|228250927|gb|EEK10115.1| ribosomal protein L20 [Streptococcus salivarius SK126]
 gi|311101759|gb|EFQ59962.1| ribosomal protein L20 [Streptococcus vestibularis F0396]
 gi|312278439|gb|ADQ63096.1| 50S ribosomal protein L20 [Streptococcus thermophilus ND03]
 gi|322124751|gb|EFX96189.1| 50S ribosomal protein L20 [Streptococcus vestibularis ATCC 49124]
          Length = 119

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 58/102 (56%), Positives = 71/102 (69%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVK GVVS  + K+VLK AKG+YG +    R AK  V  S  YAYRDRR KKRDFR L
Sbjct: 1   MARVKGGVVSRKRRKRVLKLAKGYYGAKHILFRTAKEQVMNSYYYAYRDRRQKKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQ 102
           WI RINAA R+  L+YSQ ++GL  A I ++RK+L+DLA+  
Sbjct: 61  WITRINAAARLNGLSYSQLMHGLKLAEIEVNRKMLADLAVND 102


>gi|295109212|emb|CBL23165.1| LSU ribosomal protein L20P [Ruminococcus obeum A2-162]
          Length = 118

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.