RPSBLAST alignment for GI: 254780318 and conserved domain: PRK14537

>gnl|CDD|173003 PRK14537, PRK14537, 50S ribosomal protein L20/unknown domain fusion protein; Provisional. Length = 230
 Score = 99.7 bits (248), Expect = 2e-22
 Identities = 51/105 (48%), Positives = 70/105 (66%)

Query: 13  KHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVY 72
           + KKVLK AKG++G +    + A   V RS QYAYRDR+ +KRDFR LWI RINA   + 
Sbjct: 13  RRKKVLKMAKGYFGSKSTLYKTAHEQVMRSLQYAYRDRKQRKRDFRKLWISRINAGAMLC 72

Query: 73  DLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            + YS+ ++GL  A + ++RKVLSDLA  Q + F + VEL++  L
Sbjct: 73  GIKYSRLMHGLALAKVDINRKVLSDLAHLQPEVFVQYVELAKKFL 117