RPSBLAST alignment for GI: 254780318 and conserved domain: CHL00068

>gnl|CDD|177008 CHL00068, rpl20, ribosomal protein L20. Length = 115
 Score =  113 bits (286), Expect = 1e-26
 Identities = 51/111 (45%), Positives = 71/111 (63%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRG ++  + KK+LK A GF G      R A     ++   +YRDR+ KKRDFR L
Sbjct: 1   MTRVKRGYIARKRRKKILKFASGFRGAHSRLFRTANQQKMKALVSSYRDRKKKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVE 111
           WI RINAA+R   ++YS+FI+ L+K  I+L+RK+L+ +AI   + F  I  
Sbjct: 61  WITRINAAIRENGVSYSKFIHNLYKNQILLNRKILAQIAILDPNCFYTISN 111