RPSBLAST alignment for GI: 254780318 and conserved domain: COG0292

>gnl|CDD|30640 COG0292, RplT, Ribosomal protein L20 [Translation, ribosomal structure and biogenesis]. Length = 118
 Score =  145 bits (368), Expect = 3e-36
 Identities = 70/117 (59%), Positives = 86/117 (73%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M RVKRGVV+ A+ KK+LK AKG+ G R    R AK AV ++ QYAYRDRR +KRDFR L
Sbjct: 1   MARVKRGVVARARRKKILKLAKGYRGARSRLYRVAKQAVMKALQYAYRDRRQRKRDFRKL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           WI RINAA R   L+YS+FINGL KAGI +DRKVL+DLAI    +F  +VE +++ L
Sbjct: 61  WIARINAAARENGLSYSRFINGLKKAGIEIDRKVLADLAINDPAAFAALVEKAKAAL 117