RPSBLAST alignment for GI: 254780318 and conserved domain: KOG4707

>gnl|CDD|39905 KOG4707, KOG4707, KOG4707, Mitochondrial/chloroplast ribosomal protein L20 [Translation, ribosomal structure and biogenesis]. Length = 147
 Score = 98.1 bits (244), Expect = 6e-22
 Identities = 49/116 (42%), Positives = 71/116 (61%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           +    RG     + +++ K A  F GR++   R A   V R+  YA +DR +KKRD R+L
Sbjct: 8   LWLRNRGPDRYMRRQELFKFAAHFRGRKRRCYRLAVRTVIRALVYATKDRYLKKRDMRTL 67

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WI+R+NA    + + YS F +GLHK+ I+L+RKVLS LAI +  SF  +V LS+ R
Sbjct: 68  WIERVNAGAAEHGVRYSPFKHGLHKSPILLNRKVLSQLAIVEPRSFCALVVLSKER 123