RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780319|ref|YP_003064732.1| 50S ribosomal protein L35 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >gnl|CDD|30639 COG0291, RpmI, Ribosomal protein L35 [Translation, ribosomal structure and biogenesis]. Length = 65 Score = 58.7 bits (142), Expect = 3e-10 Identities = 32/65 (49%), Positives = 42/65 (64%) Query: 1 MPKMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAKKVIR 60 MPKMKT + KRF IT TGK++ + AGKRH + K+S K R+ R T V++ AD K+V R Sbjct: 1 MPKMKTKKGAAKRFKITGTGKIKRKHAGKRHILTKKSTKRKRHLRKTAVVSKADLKRVKR 60 Query: 61 NYLPN 65 L Sbjct: 61 LLLYA 65 >gnl|CDD|145004 pfam01632, Ribosomal_L35p, Ribosomal protein L35. Length = 61 Score = 45.0 bits (107), Expect = 4e-06 Identities = 25/59 (42%), Positives = 40/59 (67%) Query: 2 PKMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAKKVIR 60 PKMKT ++ KRF TA+GK++ + AGKRH + K+S K R R ++++ D+K+V + Sbjct: 1 PKMKTVKAAAKRFKRTASGKIKRRKAGKRHLLTKKSTKRKRRLRKHVLVSKTDSKRVDK 59 >gnl|CDD|177032 CHL00103, rpl35, ribosomal protein L35. Length = 65 Score = 38.1 bits (89), Expect = 6e-04 Identities = 20/58 (34%), Positives = 33/58 (56%) Query: 1 MPKMKTNSSSKKRFSITATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAKKV 58 MPK+KT ++ KR+ T GK + A K H + K+S+K R T+ ++ D+K + Sbjct: 1 MPKLKTRKAAAKRYKKTGNGKFLRRKAFKSHLLQKKSSKQKRKLSQTVCVSKGDSKSI 58 >gnl|CDD|100030 cd02194, ThiL, ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine. Thiamine salvage occurs in two steps, with thiamine kinase catalyzing the formation of thiamine phosphate, and ThiL catalyzing the conversion of this intermediate to thiamine pyrophosphate. The N-terminal domain of ThiL binds ATP and is related to the ATP-binding domains of hydrogen expression/formation protein HypE, the AIR synthases, FGAM synthase and selenophosphate synthetase (SelD).. Length = 291 Score = 27.5 bits (62), Expect = 0.84 Identities = 10/27 (37%), Positives = 14/27 (51%) Query: 6 TNSSSKKRFSITATGKVRAQAAGKRHG 32 T S S+ S+TA G+V +R G Sbjct: 119 TTSGSELVISVTALGEVEKGKPLRRSG 145 >gnl|CDD|37485 KOG2274, KOG2274, KOG2274, Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport, Nuclear structure]. Length = 1005 Score = 26.1 bits (57), Expect = 2.0 Identities = 6/17 (35%), Positives = 9/17 (52%) Query: 51 ASADAKKVIRNYLPNGI 67 S + K +IR L N + Sbjct: 83 VSEEVKALIREQLLNLL 99 >gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp. PCC 7335 (EDX86601). Uncharacterized aldehyde dehydrogenase of Synechococcus sp. PCC 7335 (locus EDX86601) and other similar sequences, are present in this CD. Length = 452 Score = 26.1 bits (58), Expect = 2.2 Identities = 10/26 (38%), Positives = 15/26 (57%) Query: 19 TGKVRAQAAGKRHGMIKRSNKFIRNA 44 G+ AQA G+ GM++R+ I A Sbjct: 68 MGRPIAQAGGEIRGMLERARYMISIA 93 >gnl|CDD|111392 pfam02488, EMA, Merozoite Antigen. This family represents the immunodominant surface antigen of Theileria parasites including equi merozoite antigen-1 (EMA-1) and equi merozoite antigen-2 (EMA-2). The protein shows variation at a putative glycosylation site, a potential mechanism for host immune response evasion. Length = 280 Score = 24.7 bits (54), Expect = 6.3 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 7/59 (11%) Query: 10 SKKRFSITATGKVRAQAAGKRHGMIKRSN-KFIRNARGTMVLASADAKKVIR-NYLPNG 66 S K+++ AT KV GK + N K++ V D KKV+R +Y G Sbjct: 162 SGKKYTFKATFKVSKVTFGK-KDVGDGDNAKYL----DVFVYVGGDDKKVVRLDYFYTG 215 >gnl|CDD|88584 cd04333, ProX_deacylase, This CD, composed mainly of bacterial single-domain proteins, includes the Thermus thermophilus (Tt) YbaK-like protein, a homolog of the trans-acting Escherichia coli YbaK Cys-tRNA(Pro) deacylase and the Agrobacterium tumefaciens ProX Ala-tRNA(Pro) deacylase and also the cis-acting prolyl-tRNA synthetase-editing domain (ProRS-INS). While ProX and ProRS-INS hydrolyze misacylated Ala-tRNA(Pro), the E. coli YbaK hydrolyzes misacylated Cys-tRNA(Pro). A few CD members are N-terminal, YbaK-ProX-like domains of an uncharacterized protein with a C-terminal, predicted Fe-S protein domain.. Length = 148 Score = 24.7 bits (54), Expect = 6.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Query: 17 TATGKVRAQAAGKRHGMIKRSNKFIRNARGTMVLASADAK 56 T T + A+A G G I +S F + +V+ S DA+ Sbjct: 24 TRTAALAAEALGCEPGQIAKSLVFRVDDEPVLVVTSGDAR 63 >gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like. Succinate-semialdehyde dehydrogenase 2 (SSADH2) and similar proteins are in this CD. SSADH1 (GabD1, EC=1.2.1.16) catalyzes the NADP(+)-dependent oxidation of succinate semialdehyde to succinate. SSADH activity in Mycobacterium tuberculosis is encoded by both gabD1 (Rv0234c) and gabD2 (Rv1731), however ,the Vmax of GabD1 was shown to be much higher than that of GabD2, and GabD2 (SSADH2) is likely to serve physiologically as a dehydrogenase for a different aldehyde(s). Length = 454 Score = 24.2 bits (53), Expect = 8.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Query: 17 TATGKVRAQAAGKR 30 TATG+V A+ AG+R Sbjct: 205 TATGRVVAERAGRR 218 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.127 0.342 Gapped Lambda K H 0.267 0.0669 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 678,451 Number of extensions: 24417 Number of successful extensions: 61 Number of sequences better than 10.0: 1 Number of HSP's gapped: 61 Number of HSP's successfully gapped: 12 Length of query: 67 Length of database: 6,263,737 Length adjustment: 38 Effective length of query: 29 Effective length of database: 5,442,595 Effective search space: 157835255 Effective search space used: 157835255 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.5 bits)