>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation. It is expressed ubiquitously, with elevated levels in muscle and brain. Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth. TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell. TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb. The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb. Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le

Probab=99.40 E-value=1.3e-11 Score=97.50 Aligned_cols=155 Identities=22% Similarity=0.344 Sum_probs=101.6 Q ss_pred EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH Q ss_conf 17999801389877889999998298054444311305867798719505232799997437884389999617873002 Q gi|254780321|r 12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF 91 (606) Q Consensus 12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF 91 (606) T Consensus 2 ~KIvlvGd~~VGKTsli~r~~--~~~f~~~y-~~Ti----------~~~~-~k--~i~---~~~~~~~l~iwDtaG~e~~ 62 (180) T cd04137 2 RKIAVLGSRSVGKSSLTVQFV--EGHFVESY-YPTI----------ENTF-SK--IIR---YKGQDYHLEIVDTAGQDEY 62 (180) T ss_pred CEEEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCC----------CCCC-CE--EEE---ECCEEEEEEEEECCCCCCC T ss_conf 889999989988999999997--09789985-8812----------4411-37--999---9999999999989987010 Q ss_pred HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-----HCCCCEEEEECCCCCCCCCCCC--HHHHHHHHHHHHHHH Q ss_conf 799999997302689999868788655899999999-----7099679983267887532113--388877555322321 Q gi|254780321|r 92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-----DNNHEIITVLNKADLPSADPDR--VKKQIEETIGISTED 164 (606) Q Consensus 92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-----~~~l~~I~viNKiD~~~A~~e~--v~~ei~~~~g~~~~~ 164 (606) T Consensus 63 ~~~~~~~~~~a~~~ilvydvt~~~Sf~~~~~~~~~~~~~~~~~~~piilVgNK~DL~~~r~V~~~e~~~~a~~~~~---~ 139 (180) T cd04137 63 SILPQKYSIGIHGYILVYSVTSRKSFEVVKVIYDKILDMLGKESVPIVLVGNKSDLHTQRQVSTEEGKELAESWGA---A 139 (180) T ss_pred CHHHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHCCCCHHHHHHHHHHCCC---E T ss_conf 0667999863557899974388788999999999999975888886797765346244078899999999998399---8 Q ss_pred HHHHHHHCCCCCCHHHHHHHHHHH Q ss_conf 000111002232006787763210 Q gi|254780321|r 165 ALLVSAKTGEGIPLLLERIVQQLP 188 (606) Q Consensus 165 ii~vSAktG~GV~~LLd~Iv~~iP 188 (606) T Consensus 140 f~EtSAk~g~nV~e~F~~l~~~i~ 163 (180) T cd04137 140 FLESSARENENVEEAFELLIEEIE 163 (180) T ss_pred EEEECCCCCCCHHHHHHHHHHHHH T ss_conf 999776889198999999999998

HHsearch alignment for GI: 254780321 and conserved domain: cd04137