>cd04177 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi. In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization. The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site. It is believed that cdc42 interacts directly with RSR1 in vivo. In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha. In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key featu

Probab=99.37 E-value=1.5e-11 Score=97.11 Aligned_cols=157 Identities=19% Similarity=0.241 Sum_probs=100.9 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH Q ss_conf 79998013898778899999982980544443113058677987195052327999974378843899996178730027 Q gi|254780321|r 13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT 92 (606) Q Consensus 13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~ 92 (606) T Consensus 3 KivlvGd~~VGKTsli~rf~--~~~f~~~y-~pTi----------~~~~-~k--~i---~i~~~~~~l~iwDtaG~e~~~ 63 (168) T cd04177 3 KIVVLGAGGVGKSALTVQFV--QNVFIESY-DPTI----------EDSY-RK--QV---EIDGRQCDLEILDTAGTEQFT 63 (168) T ss_pred EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCC----------CCEE-EE--EE---EECCEEEEEEEEECCCCCCCC T ss_conf 99998999977999999996--19389865-8833----------3159-99--99---999999999998278862333 Q ss_pred HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-HHHHHHH Q ss_conf 99999997302689999868788655899999999-----70996799832678875321133888775553-2232100 Q gi|254780321|r 93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-----DNNHEIITVLNKADLPSADPDRVKKQIEETIG-ISTEDAL 166 (606) Q Consensus 93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-~~~~~ii 166 (606) T Consensus 64 ~~~~~~~~~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL~~~r~v~-~~e~~~~a~~~~~~~~~ 142 (168) T cd04177 64 AMRELYIKSGQGFLLVYSVTSEASLNELGELREQVLRIKDSDNVPMVLVGNKADLEDDRQVS-REDGVSLSQQWGNVPFY 142 (168) T ss_pred CCHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHCCCCC-HHHHHHHHHHCCCCEEE T ss_conf 45154512686679853689888999999999999985178887489887314612137689-99999999974997799 Q ss_pred HHHHHCCCCCCHHHHHHHHHHHC Q ss_conf 01110022320067877632100 Q gi|254780321|r 167 LVSAKTGEGIPLLLERIVQQLPS 189 (606) Q Consensus 167 ~vSAktG~GV~~LLd~Iv~~iP~ 189 (606) T Consensus 143 E~SAk~~~nV~e~F~~l~~~il~ 165 (168) T cd04177 143 ETSARKRTNVDEVFIDLVRQIIC 165 (168) T ss_pred EECCCCCCCHHHHHHHHHHHHHH T ss_conf 96248784689999999999999

HHsearch alignment for GI: 254780321 and conserved domain: cd04177